Thermobaculum terrenum ATCC BAA 798

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269925243|ref|YP_003321866.1| OsmC family protein [Thermobaculum terrenum ATCC BAA-798]
    MATAQSKAHVDWSGDLLQGNGQVSVGSGSFGPLPISWRTRTERGGGGTSPEELIAAAHAGCYAMALSNTLAKHGSPPENL
    SVDATCNFEFGEGGARITSIDLNVTGRVPGLSEEEFKSIAEEAEKG
    CPVSNALRNNVDIRLNAQLA

    >gi|269925361|ref|YP_003321984.1| Redoxin domain protein [Thermobaculum terrenum ATCC BAA-798]
    MNAARWLVAGILAGVLVLLILFGYGLAKQREGDTLEQGARIVSVGGDVPIEPHPAPDFTLKGFDGKQVKLSDYKGKVVIV
    NFWASW
    CPPCAEEAPTLESGWQKFKNEGVVFLGVNLWDDPQNAEQFIEDNDLTYINGTTKTGTATEYGLTGIPETYVIDK
    NGQVIRRWRGPLTDHELANLVEAGLSSK

    >gi|269925362|ref|YP_003321985.1| periplasmic binding protein [Thermobaculum terrenum ATCC BAA-798]
    MRIVSLLPSATEIVCSLGLIDSLVGVTHECDYPPEVMGKPILTRSLIDTTQDSYSIDRQVVESLHEHRTLYALDEELLRE
    LSPDLILTQELCDV
    CAVSYTVVEKAARILPAETPVVSLEPNTLYDILETILLVGRLTGTEARAQKLIDELITRIRAVESK
    ASSVAHKPKVYCMEWVNPPYKSGHWIPEMVRIAGGEEVFGLEGIPSSRASWEEIAQAAPEVVVVMACGFDADRTERELML
    INEREEWQSLPAVRNGNVWVSNGSAYFARPGPRIVDSLEMLAHAIHPELFPEPDRTQFRRFRPLAAASLV

    >gi|269925426|ref|YP_003322049.1| Rhodanese domain protein [Thermobaculum terrenum ATCC BAA-798]
    MSYETLISVQEAAKHLHDPNWVFIDCRYTLGDPEKGLRDYLQAHIPGAVYAHLDKDLSGKVIPGKTGRHPLPDLIDFDKT
    MSRLGVSQESQVVAYDEQTGAMAAARLWWLLKWAGHNNVAVLDGGFRAWIANGLPVATGKESRASTEFHGKYNHKLVASA
    DDLRATIGSRSCKIVDSRTRDRYRGENETIDPKAGHIPTAISLPYTENLDTDGFFRPPQILRERFASIAEQYPPESIVFY
    CGSGVTAAHNVLAFAHAGMGMPKLYPGSWSEWITDESRPIATGDE

    >gi|269925427|ref|YP_003322050.1| peptide methionine sulfoxide reductase [Thermobaculum terrenum ATCC BAA-798]
    MSNISRIQEATLGGGCFWCMEPIFKDLKGVIEVIPGYSGGHVPNPTYEQVCTDTTGHAEVVNIKFDPNQISFRDLLEVFF
    SVHDPTTLNRQGEDVGTQYRSIILYRDEEQRRIAQEVIEELTRNKVWQDPIVTQVVPFEAFYPAEEYHWDYFRRNPNQAY
    CRLVIAPKYEKFRKRYTELIKQ

    >gi|269925432|ref|YP_003322055.1| methylated-DNA/protein-cysteinemethyltransferase [Thermobaculum terrenum ATCC BAA-798]
    MENLDQYFSIDLPIGRLYVAYNPLGISATAIASDDSSFEDYFLRRFQKSIRPELHACEDIRVKVRKYLDGYRGSLSDFDL
    RGTTAFQRKVLETTLSIPRGEVRTYTWVANKIGNPKALRAVGTALASNPVPILIP
    CHRVVRSDGVIGKYLFGTACKQQLL
    HMEDVKATLESPISM

    >gi|269925458|ref|YP_003322081.1| methylated-DNA/protein-cysteinemethyltransferase [Thermobaculum terrenum ATCC BAA-798]
    MSTPKEAKSFKEIVWKIVSSIPKGKVMTYGQIAALAGYPGSAQVVGWILHYTPPELNIPCQRVVNRFGGLAAGYGWGGVY
    SHKKDLEKDGVEVREDFTVDLQKYQWFPPQELVDEWLSFKLERLSQDS

    >gi|269925502|ref|YP_003322125.1| glutaredoxin [Thermobaculum terrenum ATCC BAA-798]
    MEHSATIVVYSTSWCGDCKRAKMVLDSMNINYKLIDLELHPHAEEEMLKVNGGIWRVPTIILPTGKVLVEPSVNELLAAL
    EGRAA

    >gi|269925570|ref|YP_003322193.1| selenide, water dikinase [Thermobaculum terrenum ATCC BAA-798]
    MDDRERIRLTSLASCAGCAAKLGPGDLAQVLQPFTGRNTSNLLVGLDVADDAAVYRLDEGQALVQTVDFFPPIVDDPYTF
    GAIAAANSLSDIYAMGGTPILALNIAGWPGNLPLDMLAQIFRGGMDKVEEAGAVIGGGHTVMDQEPKYGLCVTGLIHPGK
    ITTKGAVKPGDLLVLTKPLGTGVITTALKSGKVRDVDIQAAVDSMLRLNKVASELAVELGIRAMTDITGYGLLGHAFEMS
    EASNVCLNIELSKLPVLPGALDYIRQDIYPGGLNRNRSYLTGEQDGRKKISYDNSIIVDENLVKLAMDPQTSGGLLIAVP
    QEQADEFTARAEQRGQSIWIIGFASEGYGVRLLP

    >gi|269925625|ref|YP_003322248.1| glutaredoxin-like protein, YruB-family [Thermobaculum terrenum ATCC BAA-798]
    MALPEVVIYTTPTCGFCRQAKDYLRQKNIPFVEKDVSVDRNAAYEMIRISGQQGVPVIRVGNEIIIGFDRKRLDRVLQSA
    VEGKASLGVSVADSSRIALEHGVVPIFGAYVGRVAAGSAAERAGLRPGDIITEVNARPIRNAEDLEKAIENLRKGSQVTL
    VWVRGQDTLRSTVTL

    >gi|269925863|ref|YP_003322486.1| dithiol-disulfide isomerase involved in polyketide biosynthesis-like protein [Thermobaculum terrenum ATCC BAA-798]
    MATLEFWADYICPWAYVARVRIDPLIKEYKNSVKLEIKALPLEWVNGVPTSRESLEAEWWVAAVHDRRAVFGLYRDNTFP
    NTAIPVFRAGKAALLQSYDKFLEFDLQVRRALFQDGMDISKVDVLLSIASRVGLDLDRFRKYMDSEESLEAVKQDYEQGR
    EKLDPQGSHSFVLPNGKHLYNPAAASITWDRDRIVGLNPPPCIGSNCDEIYRLLFEISK

    >gi|269925967|ref|YP_003322590.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobaculum terrenum ATCC BAA-798]
    MAKLVSKIIYLAMLLSILTVSCTKPLARNDSEQYAGTELSGKAPDFSLIDQHGRQMSLSDLHGKIVVLSFMDPHCADICI
    LTSQDIKKAYQNLGSLRDQVVFLAINVNPEVSSKKDINKAIRQWGLEEISNFHFLNGSPSTLRTVWKNYNVLSEKSQKYG
    GQIIHTPGIFIIDQQGNKRWYVYTPLGWQGPNMSDLMLQHIRGLAS

    >gi|269926099|ref|YP_003322722.1| thioredoxin [Thermobaculum terrenum ATCC BAA-798]
    MATQVHPIEVTDENFEEKILKSEIPAIVDFWAPWCGPCRMMAPIFEELAGQYAGRVLFAKLNVDDNMQTPSAFGTYSIPT
    LIIFKEGQEVQRLVGFTTKDKLSAVIDSVL

    >gi|269926252|ref|YP_003322875.1| heavy metal translocating P-type ATPase [Thermobaculum terrenum ATCC BAA-798]
    MSEQQAKLSKSEAKTYRVQGFTCANCAAKFENNVKSLPGVQDAKVNFGASKITVWGTTTIEELEKAGAFENLKVREDKEK
    SVKREPFWKQKENIKVYISAVLLVISWFLGKQYGEEHIFATIGYAAAILIGGYSLFIKGFKNLVRLNFDMNTLMTVAILG
    AAAIGEWGEGATVVILFAISEALERYSMDKARQSLESLMDIAPKEALIRRGNEEMMVPVDDIQVGDIMIVKPGQKLAMDG
    IVIKGTSTLNQAAITGESVPVTKTVGDEVFAGTLNEEGLLEVKVTKRVEDTTLSKIIHLVEEAQAERAPSQAFVDRFAKY
    YTPAIIIFALLLAVIPPLFMGADWSEWIYRGLAVLVVGCPCALVISTPVSIVTAIGNAAKNGVLIKGGIYLEEAGNLKVI
    AFDKTGTLTKGIPSVTDVVTYNGNENELMTITAAIEKGSQHPLASAIIRKAEEDGLNFNDVSVEEFQSITGKGVKAKVNN
    AMYYVGSPGLFEELLPNGIQSEIKEQITTLQIQGKTVMVLGTEKEILALIAVADEIRESSKEVIRKLHQVGIEKTVMLTG
    DNQRTAEAIGKQVGVSDIKADLLPEDKLNFIKELRDKYRSVAMVGDGVNDAPALAASTVGVAMGGAGTDTALETADIVLM
    SDDLSKLPYTIKLSRKALAIIKQNITFSLGIKALSLLLIVPGWLTLWLAVFADMGATLIVTLNSMRLLKVKE

    >gi|269926333|ref|YP_003322956.1| thioredoxin reductase [Thermobaculum terrenum ATCC BAA-798]
    MAQTDTRSVIIIGSGPAGYTAAIYAARANLSPLVLAGSQMGGQLMITTDVENYPGFPDGVQGPELMALFQQQAERFGAEI
    VPVDVTKVDFSSRPFKVWTDEEEYSALSVIIATGASAKFLGVPGESEFMGRGVSA
    CATCDGFFFRDKKVVVVGGGDVAME
    EALFLTRYASSVTVIHRRDQLRASKIMQERAKSNPKIDFIWNTVVEEILGDQNVKAIKVRNVVTGELREIPVDGVFVAIG
    HKPNTDIFVGQVELDEKGYIKAQDSWSTATNVDGVFAAGDVRDHKYRQAVTAAGDGCKAAMDAERWLESQGVQVDISDEI
    YSLPK

    >gi|269926393|ref|YP_003323016.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobaculum terrenum ATCC BAA-798]
    MANRRFEGKIRAPDFPGGLKWFNTDRHISLADLRGKIVILDFWTYCCINCMHILPHLRKLEEKYPDELVVIGVHSAKFMA
    ERSDTGIRNAIRRYSVRHPVVNDANLQIWSEYAVRAWPTLYFIDPTGRIVGMHEGEIRFPELDNIISQMIQEYDSLGILD
    RTPIRFNAERAPEGILAFPGKVLALEDEDSLYIADSNHNRILECSLSGKIRRIWGNGEEGLVDGSASEAKFNHPQGMAIR
    GNELYVADTENHALRLLHLNEGKVETIAGTGEQGYPISFQPSIGKYTELNSPWDLEIVNDVLYIAMAGCHQIWAMEMPSG
    VVRPLAGTAREGIKDGPASAAWLAQPSGLTTDGQLLYFADSETSSIRLLDPASGRVETLVGIDLFEFGDVDGVGGMVRLQ
    HPLDVEWHAGKLYIADSYNNKIKILDPHTRECRTWVGSGKQELRDGTRQDASLAEPGGLSATSRYLYVADTNNHAIRIVD
    FSTGEVSTLKIHE

    >gi|269926415|ref|YP_003323038.1| Rhodanese domain protein [Thermobaculum terrenum ATCC BAA-798]
    MPYRLAKDEEETQEPFDRIPPEEAYRMVESGEAVLIDVREQNEWDEGHMPKARHVPLQTFLSDPTKYVSPDQKVIFSCAS
    GQRSAVAAEMAAAVGVRQAYNLEGGIKAWSEKGLPVEK

    >gi|269926419|ref|YP_003323042.1| Rhodanese domain protein [Thermobaculum terrenum ATCC BAA-798]
    MTQSVEQTTQQYANPDALVSTEWVAQHLNDPNIRIIEVDVDTSAYEQGHIPGAIAWNWKQDLQQQPVRDIPNKEQWEDLL
    SRSGITPDTTVILYGDNNNWFAAFAYWLFKLYGHNNVKLMNGGRKKWLEEGRELTNDVPSYPRTDYKAPEPTPQLRALRD
    EVMKVLGRPDVGLVDVRSPKEFSGELLAPENLPQEGAQRGGHIPGAKNIPWSTAVNEDGTFKSPEELRKIYQDQGITPDK
    EVVTY
    CRIGERSAHTWFVLHELLGYKDVRNYDGSWTEWGSVVGAPIER

    >gi|269926420|ref|YP_003323043.1| UBA/THIF-type NAD/FAD binding protein [Thermobaculum terrenum ATCC BAA-798]
    MAKVEVQIPGPLRVHTNQQTKVEASGSNVSEVLANLAEQYPGLKSQLYEADGSVRRFINLFVNGEDVRGKQGLDTPVNDG
    DKIGILPAMAGGAELTPEQVRRYHRHIIMPEIGSKGQRRLINSKVLIIGAGGLGSPAALYLAAAGVGTIGIVDFDVVEIS
    NLHRQILHGDADLGRPKVDSAADAIHRVNPTVNVVKHNEPLTSENAREIIRQYDVVINGSDNFPTRYLVNDVSYWEGKPL
    VDGSIMRFDGQVTVYAPGYGCYRDLFPTPPPPGSVPS
    CAEAGVLGVMCGIIGSIQAMEAIKLIVGIGEPLIGRMLIVDAL
    NTEFRELKLRKDPNCPVCGEHPTITEPIDYVEFCGVPHETALIG

    >gi|269926518|ref|YP_003323141.1| iron-sulfur cluster assembly accessory protein [Thermobaculum terrenum ATCC BAA-798]
    MVTITESAAAKIKDLMEKEGQQGAALRLYVAGGGCSGLNYGMAFEEEVDPEDHVFEQNGVKILIDSYSYPYVKGSEIDYI
    DGLFGSGFTINNPNAVSTCACGHSFDTGSNAATARSCR

    >gi|269926545|ref|YP_003323168.1| OsmC family protein [Thermobaculum terrenum ATCC BAA-798]
    MKTVTVHSREGYQQEIMAGSHAFMSDLPISEGGNETAPEPYDLLLAALGACTSMTLRMYAERKGWDLEDIRVELSIHKSP
    GEKDVIHKKIEVTGDLTEDQIERLRYIATR
    CPVNLTLRRGVEMEEEIQLASTYQATTNIPRD

    >gi|269926556|ref|YP_003323179.1| dihydrolipoamide dehydrogenase [Thermobaculum terrenum ATCC BAA-798]
    MSENQEFDIAIIGGGPAGYVAGIYAQQMGVRAVVIEKQYWGGTCLNVGCIPTKAMVSTVEVLKLARQGAEMGLKGDIEPD
    FDAIVARRDKVVKQLVSGVQGLLRSNGATQIFGEATIKTPNEIEVRTQEGTQTVRTRNILIATGSVPAKPPVEGMDLPGV
    VDSTGLLSLKEQPQELVIIGGGYIGIEFASIFVNLGTKVTVIEMLPRILAGYDEELTKRLQQLLQRDGVEFHLNAPVQAV
    EQGEGKLLVRYSENGQEKVAEGDVVLVATGRIPYTEGLGLDNLGVEMNKRAVKVDDRMQTNIPNVYAAGDVVAKMPLAHV
    AWTEAQVAVRNMLGKRTKMEYFAVPSCVFSVPEMASVGLTEQAAYEQGYEIKVGRFPFSANGRALGMGESQGLVKIISEA
    DSGEILGAHILGPHASDLIAELTLAMEMGATAEDVDLTIHAHPTLPEAIQEAALATTGRAIHYIVK

    >gi|269926597|ref|YP_003323220.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobaculum terrenum ATCC BAA-798]
    MAVYNSEEEIRNSKKSNQRLLVGLIILASILAALLAWMFLSSSRNSVSLPSRPIKVGDQVPNWTITMMDGKHIDMRDLRG
    SPVWLNFWASW
    CGPCRAEMPDMAIVGKKFESKGGKLIAINVGESEGTIRSYLETTGLQGLPVAMDSDGKIANALGIYTLP
    VHVFITPDGKVVDVHMGSLDAKAMEEELSKIQR

    >gi|269926781|ref|YP_003323404.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobaculum terrenum ATCC BAA-798]
    MVSEGNVAPDFTLPDENGNQVSLSQFRGRKVILYFYPKDDTPGCTTEACGIRDSFPNFEASGAVVLGVSPDSVESHKKFK
    EKYNLPFTLLADTDHKVAEMYGVWGTKKMYGREFTGVLRTTFLIDEEGKVQKVFKNVKPDVHAQELVEALAS

    >gi|269926785|ref|YP_003323408.1| protein of unknown function DUF255 [Thermobaculum terrenum ATCC BAA-798]
    MPNRLAQESSPYLLQHAENPVDWYPWGQEAFDKARKEDKPILLSIGYSSCHWCHVMAHESFENPEIAKIMNDNFVNIKVD
    REERPDIDAIYMEAVQAMTGQAGWPLNVFLTPDGKPFFGGTYFPPEDRVGMPGFKRLLLWLSEVYHTRRQEIEQSASQIA
    QQLLQISRAELKSHDISLEILESACQSLKSSFDHQYGGFGTAPKFPQPMTVEYLLQSFIRAQQKEYLDMVTLTLVRMSLG
    GIHDHLGGGFHRYSVDRTWLIPHFEKMLYDQALIARAYLHAWQVTHNSWYLKVVNRTLQYVLKDMTSSQGGFYSAQDADS
    EGEEGKYYLWSLDEIKRVLNEREVELVCEHYGVTASGNFEGKNILHIAKSIEDLARDHNMDLSEVEKIIDEASMKLLHYR
    DQRTPPAKDTKVVTSWNALMSTTLAEAGFAMNNPEYIAASQRNAQFLLDNLVVDGLLHHTYSDSKPKVPGFLEDYAALSN
    SLITLYEITSDGKWLESARRFVQDMIDSFWKEEIGTFSDTSIKHSDIFLQPRNLYDNATPSGNSLACMALLRLAVIFDRQ
    DYREIASRVVRGLALVMSKHPTAFGHMLCVANTLLSPSVEIVILGDKHSVNTEALLEVIRQTYIPNKILISTTEEEASRS
    DLPLLQGRTLRNNKPTAFVCRNYACSMPVNEPDELREQLTLQVHAP

    >gi|269926795|ref|YP_003323418.1| heavy metal translocating P-type ATPase [Thermobaculum terrenum ATCC BAA-798]
    MNQAEKIVIKVEGMDCASCARVVESAVRSVEGVSDCNVNFSTSSVQVTLQDESHKEDTAGKLVKAIRSAGYGAEPVGQNN
    VDTESTPVRNNDWISQVLHIQQLRAAITAGFFYLLGVIFGFLNSKGIIPQFPEIPSILAVFGLSLEKVNLIQLIFYGLAI
    VFGGYNIARSGVIALLRTRTASIDLLMTIAVLGAVIINQWAEAATVVMLFSLGEGMESLTINRARNAIQELLQIAPQVAR
    IRRGSETIQLPVEEVELQDVMLVRPGERIAMDGRVISGYSTVNQAPITGESLPVEKSPGDEVYAGTLNQRGYLEVEVTKL
    AEDSTLARITRLIETAGANRAKTERFMERFAKYYTPAVIALAILLAVIPPLMGEPFIPWFYRALTLLVISCPCALVISTP
    VAIVAALANASRHGMLIKGGGYIELAGQIGAIAFDKTGTLTHGRPEVVEVYATDGYEPEEVISLAATIEERSEHPLAAAI
    LRRRELEVTASPQHVHGDQHQHLYPHDESEFELIAKEISDFEAITGRGARATIDGTTYYIGTPRLFEELGVDISKLSHVI
    KKWQENGRTVLIVGSDREVFGAIAVEDEPRPESREVIQKLKENGIQHIVMLTGDNSTTARSLAQRLGIDEYRAELLPEDK
    VQAIRELKDEYGKVAMVGDGINDAPAMAAADLGIAMGAAGSDTAIETSDIALMSSDLTKLPFAIKLSRSTLTTIKSNIAF
    SLFIKAAIILLSAIGITSLWLAILADTGASIIVTANAMRILRHKPAE

    >gi|269926835|ref|YP_003323458.1| heavy metal translocating P-type ATPase [Thermobaculum terrenum ATCC BAA-798]
    MATTSEEKSLTIPVEGMTCASCVRHVEQAISKLPGVEAVDVNLATSKAFIRLGAPVSALQIAEAVRDAGYEVPEATVELQ
    IEGMT
    CASCVRAVEKSLANLTGVLSADVNFATSKALVRYVPGAIGPQEMIRAVEDAGYEARLADATQTQVVQTDHQREYK
    NTITKAVVSLVSGLFLMFLSMRDYFSVLQAIDPKAINWIGLLITLPVQAWTGWTFYKAAWRSALHRSANMNTLIAVGTAA
    AFIYSALVTLFPGVFAMMGETPHVYYDTGLIIIGLVLLGRALESRARGKASDAIRKLLDLQPPVARVMREGQEVEVPVSE
    LVPGDVVIVRPGERIPVDGIVTGGRSVVDESMITGESIPVDKAVGSQVFAGTINQSGSFAFRATRVGSETLLAQIVRLVE
    QAQGSKPPIQRLADVIAGYFVPAVIGIALVTFVIWLVFGPEPRLTMALLNFIAVLIIACPCALGLATPTAIIVATGRAAQ
    MGILVRDAVALEALSRVDTFVLDKTGTLTKGKPVVADVIPVNGFDAASLLQVVASAEALSEHPLGRAIVEHAQSNNINIT
    KPDKFEAIVGGGVRAEIDGKQVLAGNPRMMAEMLGDRTVDSYSTVVEDVAARGATPIMVAVDGQLVGVVAVEDELRAESF
    SLVKSLKDIGREVVILTGDNRLVAEAIARRLGVDQVISEVKPDQKAEVIKSLRDKGKKVAMVGDGINDAPALTLADVGIS
    MSSGTDIAMESADITLMSPNLKLIVDALELSRATVRVIKQNLFWAFIYNVVLIPLAAGVLYPFFAGSGGWNGLLNPMIAA
    AAMGLSSVSVVSNSLRLRGWRPKDYKSSLRPEAMPDALL

    >gi|269926838|ref|YP_003323461.1| DSBA oxidoreductase [Thermobaculum terrenum ATCC BAA-798]
    MSQSRRATQTNRAALVLSLVVVVIAVVIVALLIVLNRPASTTPESASNRNQVAVPTGVPAEGNVMGDPNAPVTVEVWADY
    Q
    CPYCREFVMGPEAQLKKTLIPEGKVKLVYRNFAFIGQESVDAAAAAYCAQDQGRFWDYNYKLFSEQGAENSGTFSKANL
    IRFASDLGLNVAQFRSCLDSGKYLSKVQADTQDGRAKGVRATPTIFVNGEKIEGLPSYEQLVQVINSVQSK

    >gi|269839083|ref|YP_003323775.1| glutaredoxin-like domain protein [Thermobaculum terrenum ATCC BAA-798]
    MVSSVVRDKMKQILEDRLADEVKLVLFSQKELPIYVPGRECPQCPVARKVLEELVGMSPKLQLEFHDIYSEGDLARERGV
    ERIPTIEIEGRNRGRMRFLGAPAGHELSALLDAISDASTGSTSLGNDTKQWLQELGSSLHIRVFSTPT
    CPYCPQMARLAW
    QLAVESPQVTAEVVDATAFPDLAQRYMVYGVPKTIVNDRLSLEGAMAEADLVAQLRTLLVPPSEDRRGTE

    >gi|269839113|ref|YP_003323805.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobaculum terrenum ATCC BAA-798]
    MSSTNKKVGAQRATAGWRGAGLILPVAVLVLATAVVGALLLSNGRQPGSAQGPGQTASSSRQLAPDFSVTTLDGSTFSLS
    AHRGKAVVLMFTAPW
    CYSCIPEIAKLNQLYDKYHGQGLQVLVLDVESDDGRGDLLRFKQQTNGGDYGWAVDRDYKVTTAY
    GVQVADTKVIIDRQGRVVARFEGGTSPGELEAAVQEALR

    >gi|269839119|ref|YP_003323811.1| mercuric reductase [Thermobaculum terrenum ATCC BAA-798]
    MTTDEARHYRMRIQGMTCSHCAEVVTGALEGAGAQEVSVDYLKGEANFRFAGDLSTLRQAVIEAGYVPDGVVDVTQEGRG
    GAMHDGHDYDLVVVGSGGAAFAGAIRATELGARVLMIERGTVGGT
    CVNVGCIPSKFLLRSAEVYHEAAHHPYRGVETRAS
    SVDLGELVRQKGELTERLRQEKYLDLIGEYGWELELGEARFVDEGTLEVNGHRVRGRHYLLATGARPAVPPIPGLEEAGY
    ITSTTAMELDHVPESLLIIGAGYVALELGMVFRRLGSQVTIMQRGGRILREYDPEVSDAVMEVLRREGISVLTGARVQRV
    LRDGGSKLLEVRTGDGTLTLRGEEVLVATGRSPNVEALDLPVAGVQLDDTGAVAVDEAQRTTNPRVWAAGDVTRTPQFVY
    VAAYEGGLAAGNALTGARTYRDLSALPSVIFTQPQIASVGMTEAEARAKGLEVRTSTLPLDAVPRARVNGDGLGLFKLVA
    EASSDRLLGAQVVAENAGDVIYAAVLATRFGLRVSDLLDTFAPYLTMAEGLKLAAQSFSRDVKKLSC
    CAA

    >gi|269839137|ref|YP_003323829.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Thermobaculum terrenum ATCC BAA-798]
    MEDFDVVVLGAGTAGETLALELASEGVRVAVVADGLVGGECPFLACMPSKAMLHSARRHRLCGGPDAEAFREAIAWRDEV
    AEHRDDSAHAEELARAGARLFRGRGKVSRPGVVEVGRLEIGWRDLVVCTGSRPRLPRILGLEDLPCWTSDQALSSPELPG
    SLAILGGGAVACELAQVYAAFGTEVTVVQRSPRLLSRESPWVGELMAEVLGSQGVRVLTGRSVLGARTTSSGVALELEGG
    GEVPADRLLVAVGRDPNTRGLGLEQLGIATAGPLKVDARCRVEGQAHVWAAGDVTGVAPYTHTANYQARVVAANLLGRRA
    LADYRAVPRTVYTHPPVAAVGLTRERAEEAGVEVVSARVELSEVARASAEGERIGRLELVADAARGVLVGASALGPRADE
    WIGEAALAIRAEVPVEVLADVVRPFPTYSEAYTEALRGILRELRAGVG

    >gi|269839258|ref|YP_003323950.1| glutaredoxin [Thermobaculum terrenum ATCC BAA-798]
    MIGAPYQRRSPFGVVSSPAAAPVVVYGTRWCAATQIVRRFLDRLGIPYEYVDLDLDPAAARRVAWLTGGYVSHPTVSVAG
    EVLVEPTLGELEWALARAGLI

    >gi|269839259|ref|YP_003323951.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermobaculum terrenum ATCC BAA-798]
    MIQEVWRSFSGSALASRSPSELTLEDIASLYKTAPEMRGEAICEPLPVGTPAPDFTLRDPNNEPVTLSNFRGRPVVLVFY
    PLDWSPT
    CSDQLSLYQAEISEFERFGAQILGISVDSIYCHGAWAAVRGLQFPLLADFEPKGEVARLYQVYREPDGFSERA
    LYVVDPEGIIRYAHVSPRLDMIPDIYELYQVLSEITGLPAPAPTTVA

    >gi|269839397|ref|YP_003324089.1| glutaredoxin [Thermobaculum terrenum ATCC BAA-798]
    MSERPILYSHERCSPCRAVKEFLGQLGVAYELRDVTRDPRALEEFLSLGAPLPPVVLYKGRWVAGYKPDEIEHLLADLLG


    >gi|269839602|ref|YP_003324294.1| Heavy metal transport/detoxification protein [Thermobaculum terrenum ATCC BAA-798]
    MTSKHTEVLIVPDMSCSHCVSRVDRALRSLEGVEGVSVDLDSKRVTVQFDPSVTSLEKIEAELEAIGYPSAGRGVTDGSP
    RT

    >gi|269839738|ref|YP_003324430.1| Rhodanese domain protein [Thermobaculum terrenum ATCC BAA-798]
    MPWQWWRSNVDEVEASEAAVKLRVGEAQVVDVREPHEWLQEHVPGSRHIPLGELASRAHELSPKLPVFTLCASGRRSKVA
    AEILQRAGYEQVASIRGGIKAWKANGYSVVSGR

    >gi|269839741|ref|YP_003324433.1| beta-lactamase domain protein [Thermobaculum terrenum ATCC BAA-798]
    MILRMLYNDQLAQASYLVGCPESGEALIVDPNRHVEQYLELAERLGLRITAVTETHIHADFVSGSRELAEVTGARLYLSD
    EGPSEWKYPYAAEAGAVLVREGDAFELGSVRVEVMHTPGHTPEHISFIVTDKARGSEPLGAFTGDFLFVGDVGRPDLLEK
    AAGITGTMEQGARQLFDSIQRFRTLPDHLQIWPAHGAGSACGRALGGVPQSTLGYEKLYNWAFSTQDPEEFIRRVLEGQP
    DPPRYFAQMKRVNKEGPAIASKLPAPAPLAYGDIEVMLRQGLVVDTRPADVYSQGFIPGTINIPLGASFLTWAGWLLPYD
    RPIALVIDREKLEHATQLLRLIGLDNLRGYWTPAVIDRWAGEGRKLATYRRLTPEEAGQLLGDGVCVVDVRWDSEREKGY
    VPGSIHLPLGYLEEHLEEIPTDKPLLVY
    CASGTRSAIASSILAGRTRAPVMDIKGGFDAWKATGNPVEEPKSTTTV

    >gi|269839886|ref|YP_003324437.1| dehydrogenase, selenocysteine-containing protein [Thermobaculum terrenum ATCC BAA-798]
    MAVLSDRDKEKVRKTFEERLKEPVSIQLFTQHESPLVLPGHECATCRETRELLEEVASLSDKISLEVKDFLTDRQEAESM
    GIERIPAILLDGKVKGRVRFFGAPSGYEFSVLLQDIVDASSGELGLSEDTLRKLGELQEDLHIQVFTTPT
    CPYCPRAASL
    AHRLAMASERITADAVEVSEYPELINKYNIRGVPKIVINDQVEFEGALPEKQFVERVLSAVQQEEQQG