Bacillus pseudofirmus OF4 uid45847

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|288553238|ref|YP_003425173.1| dihydrolipoamide dehydrogenase [Bacillus pseudofirmus OF4]
    MVVGDFANEVDTLVIGSGPGGYVAAIRAAQLGQKVTIVEKGTLGGVCLNVGCIPSKALISAGHRYHNAKHSEDMGVTAEG
    VSINFDKVQEWKGSVVKKLTGGVEGLLKGNKVEIVQGEAYFASENSVRIMDEKSSQTYNFKN
    CIIATGSSPIELPSFKYT
    ERVINSTGALALKEVPKKMVVIGGGYIGIELTGAYSNMGTEVVVLEGGKQILPGFEKQMSKLVEKRLKKNGVAFHTEALA
    KGVEETENGVKVTAEVKGKEEVFEADYVLVTVGRKPNTEELGLEQIGVEMTERGLIKTDKQCRTNVSNIYAIGDIIEGPA
    LAHKASYEGKIAAEAIAGEKSEIDYLAIPAVVFSDPELATVGYSEQEAKDAGYDIVAAKFPFAANGRALSLNDTDGFMKL
    ITRKEDGLVIGAQIAGPNASDMIAELGLAIETGMTAEDIALTIHAHPSLGEITMEAAEVAIGTPIHIVK

    >gi|288553248|ref|YP_003425183.1| 2-cys peroxiredoxin [Bacillus pseudofirmus OF4]
    MSDKRMVAKQAPRFEMDAVMPNKEFSKVSLEDNMKDDKWTVLFFYPMDFTHVCPTEIISLSDRYEKFDDLDAEIIGVSTD
    TIHTHKAWINTSRDDNGLGELKYPLAADTNHIVSREYGVLIEEEGIALRGLFIISPEGELMYSVVNHNNVGRDVDETLRV
    LQALQTGELCPANWKPGQKTLSL

    >gi|288553279|ref|YP_003425214.1| putative hydrolase [Bacillus pseudofirmus OF4]
    MSVKAMTAKEVTRKVMDKKELFILDVRNEGDFADWKIEGEKFDYLNIPYFDLIDGVEGIMDKLPKDKEILVVCAKEGSSI
    MVAEMILEAGLNVSYLSGGMKAWSEHLEPVKVGELSNGGEMYQFVRIGKGCLSYMVVSNGEAAIIDATRMTDIYINFASE
    IGATIKHVFDTHLHADHISGGRKIAEATGAAYWLPPKDAEEVLFEYHALQDGNEVKIGDTKINIHALYSPGHTIGSTSFV
    VDEKYLLSGDILFIDSIGRPDLAGMAEDWVGDLRESLYVKYKELSEELIVLPAHFMIIEELNADGSVAKKLGTLFAENHG
    LNIDDEETFRKLVTENLPPQPNAYQEIRQTNMGKVTPDVDEQREMEIGPNRCAVR

    >gi|288553280|ref|YP_003425215.1| hypothetical protein BpOF4_01275 [Bacillus pseudofirmus OF4]
    MSNKVAIIASNGGMFDAYKVFNIATAAASTDQEVAIFFTFEGLNLIHKEAHKQLAMPEGKEQIAEGFKEANVPGIPELVE
    MAQELGVRFIG
    CQMTMDVMGLEKKDFVDGIEVGGAVTFLEFAKDADVTLTF

    >gi|288553281|ref|YP_003425216.1| glutaredoxin-like protein, YruB-family [Bacillus pseudofirmus OF4]
    MKGVTVYTTNRCPYCVMLKNFLNEYQITFKEVNVEDKPELMQQLVNTTGQMGVPQTNINGKWVIGFDPNEIMSLMNRV

    >gi|288553282|ref|YP_003425217.1| rhodanese domain-containing protein [Bacillus pseudofirmus OF4]
    MKEMTAREVESLLMKKAPLNIIDVRGVDEVAEGKIPGALNIPLGLLEFRMHELDKSKEYIIVCRSGARSGRATQFLSERG
    YQVTNMVGGMIAWNGEVA

    >gi|288553310|ref|YP_003425245.1| dihydrolipoamide dehydrogenase [Bacillus pseudofirmus OF4]
    MAEEYDLVVLGAGTGGYVAAIRAAQHGLKVAVVEKEKLGGTCLHKGCIPSKALLRSAEVFETAKRADDFGVQTGEVSLDF
    TKVQNRKESIVDQLHRGVQHLMKKGKIDVFEGTGRILGPSIFSPTPGTISVEMANGDENMMLIPQNVIVATGSSPRTLPG
    LEIDGTHVLTSDEALQLETLPASILIVGGGVIGIEWASMLHDFGVDVTVIEYGAQILPTEDKDISKEAAKILKKKGIKIV
    TNAKVMADTIEKGDSVSIKADVNGKEETFTAEKLLVSVGRTANVKDIGLENTDIQVENGVILVNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIIAVDHIARKNPDPIDYDTVSKCIYSHPEMASVGITEEEAKKRGHNVKIGQFPFKAIGKALVFGET
    DGFVKIIADADNDDVLGVHMIGPHVTDMISEAALAKVLDAAHFEVAHTIHPHPTLSEVIGEAALAVEGKAIHS

    >gi|288553357|ref|YP_003425292.1| hypothetical protein BpOF4_01660 [Bacillus pseudofirmus OF4]
    MMIYLWLILLALVVYAVFKRFYTPKYLTTLTQEDFIKGYRKAQLIDVREPREYEGGHILGSRNIPMSQLRQRANEVRTDQ
    PVYLY
    CQSGARSRQAAQFLKKKRGVEDLYHLQGGFKKWTGKIKKK

    >gi|288553407|ref|YP_003425342.1| transcriptional regulator Spx [Bacillus pseudofirmus OF4]
    MVTLLTSPSCTSCRKAKAWLEENNIPFEERNIFSAPLSVEEVKEVVRMTEDGTDEIISTRSKVFQELNVELESLSLQTLF
    KIISDHPGLLRRPIIFDEKRLQVGYNEAEIRRFLPRKVRSFHLEEAKRMVN

    >gi|288553415|ref|YP_003425350.1| thiol/disulfide interchange protein [Bacillus pseudofirmus OF4]
    MKVRQMAFRSALILILCSVGFMYSQSQSVFQQVEEAVAASVKQGVQVGNEAKSFELHSLRGETVSLNDFHGTPVVINFFA
    TW
    CPPCQEEMPVIVELEKRLTQKGAKFIAVNMTSQEASIAEVEPFLKHFNASFDVLLDETGEVMNMYQIIGIPTTVVIDE
    NGVIVQRINGGLSYSMMEDLYLFRQ

    >gi|288553487|ref|YP_003425422.1| hypothetical protein BpOF4_02315 [Bacillus pseudofirmus OF4]
    MSNELDGIIQVDTDELKGMVNDSASPILIDVREIDEYEESHIPGVPLIPMQTIPAHLEKLDKSKSYVFICRSGARSQNVA
    LYLKNNGFNDVRNYYGGMLSWDGDRQDGLEWMVENTQELYR

    >gi|288553652|ref|YP_003425587.1| thioredoxin [Bacillus pseudofirmus OF4]
    MAIVNVTDQTFASETSEGVVLADFWAPWCGPCKMIAPVLEELDTEMGDKVKIAKLDVDENQETAGKYSVMSIPTLLVFKD
    GDVVDQVVGFQPKEALAELLNKHL

    >gi|288553725|ref|YP_003425660.1| Redoxin domain protein [Bacillus pseudofirmus OF4]
    MAEITFKNNPVTLLGTEVKVEEKAPDFKVLANDLSEVTLADTKGKVRLISVVPSIDTGVCDQQTRRFNEEASSLGNVEVL
    TVSVDLPFAQKRWCAAAGIENVQTLSDHRELSFGQAFGVAIEELRLLARSVFVIDSNDVVTYAEYVSEATNHPDYEAAIE
    AAKAAN

    >gi|288553801|ref|YP_003425736.1| thioredoxin [Bacillus pseudofirmus OF4]
    MEKLTSVEQFNKLAENETVVFMFSADWCPDCRVIEPILPRIEADFPSFSFYYVDRDEFIDLCQEHMVMGIPSFLAFSNGK
    EVDRFVSKDRKTEEEIIEFLTRAEANSY

    >gi|288553837|ref|YP_003425772.1| hypothetical protein BpOF4_04070 [Bacillus pseudofirmus OF4]
    MNKHVIVIGGGPAGLMASIAAAEHGANVTLLDKGNKLGRKLAISGGGRCNVTNRMDLQELIAHIPGNGRFMHSPFSVFNN
    EDIITFFEGLGIELKEEDRGRMFPVNDKATTVVSTLLNRVHALNVNIRTNTGVKSLQFNEEKVHSVQLQNGETLEADAVI
    VATGGKSVPHTGSTGDAYPWAEEAGHTITELYPTEVPITSNERFIKQKQLQGLSLRDIHLSVINPKGKVIKTHDGDMIFT
    HFGISGPAALRCSQYVVKALKKFSVKTIEMQIDLFPATNKEMLFQNLVKRVKEEPKKSLKNLLKGFVPERFLLFMFEQLD
    LDSTQAANTFSHDRLREIAGFCKAFSFKANGTLSIEKAFVTGGGVSVKEVEPKTMQSKKKQGLFFCGEVLDIHGYTGGYN
    ITCAFSTGYTAGKAAGELVSSL

    >gi|288553985|ref|YP_003425920.1| hypothetical protein BpOF4_04820 [Bacillus pseudofirmus OF4]
    MITLTEAAVSQIKEMMKAEGQEGLMLRVGVKGGGCSGLSYGMGFDTEKTEDDTKLEISGLPVLIDNESAPIIKGVVIDYK
    QNMMGGGFTIDNPNAIANCGCGSSFRTATNAGTPEDC

    >gi|288554033|ref|YP_003425968.1| hypothetical protein BpOF4_05060 [Bacillus pseudofirmus OF4]
    MEQQQQQNQSAVEMALLEYKEGLGHFTEKMPDIAKKYNAFTEACFAKGKLSQKEKQMIALGISVFSQDEYCIIYHTKGCL
    DQGCTEDEILEAVGVTAAFGGGAAMSQAVTLVQEAMTDLSGKGSQMQQ

    >gi|288554039|ref|YP_003425974.1| putative oxidoreductase with thioredoxin domain [Bacillus pseudofirmus OF4]
    MLVTFYHYPKCGTCRKAKKWLEENGVELNEVHIVESPPSKEELESFYKKSGLELKKFFNTSGQKYRELGLKDKLADMSDE
    EKLELLASDGMLIKRPITTDGNLVTVGFKEEQFEQTWK

    >gi|288554079|ref|YP_003426014.1| hypothetical protein BpOF4_05300 [Bacillus pseudofirmus OF4]
    MLQVVMYSKEQCPLCDKGEQMLQELKEELPFELSVVDIYKDDELLLNYQLMIPVAAVQTEEGIEEIDYGQLSKEKIRKRL
    LQIIG

    >gi|288554087|ref|YP_003426022.1| thioredoxin reductase [Bacillus pseudofirmus OF4]
    MSEEKVYDVIIAGAGPAGMTAAVYTSRANLSTIMLERGVPGGQMANTEDVENYPGFDHILGPELSTKMFEHAKKFGAEYG
    YGDVKEIIDEGNYKIVKAGSKEYKARSVIVATGAEYKKLGIPGEKELSGRGVSY
    CAVCDGAFFKGKELVVVGGGDSAVEE
    AVYLTRFASKVTVIHRRDQLRAQKILQDRAFNNDKIEFVWNHVVNEINEEGGKVGSVTIENTETGETKEFKTDGVFIYIG
    MLPLNASVKNLGILNEEGYVVTNEEMETKVPGIYAAGDIREKSLRQIVTATGDGSLAAQNVQHYLESLAEGTK

    >gi|288554134|ref|YP_003426069.1| assimilatory nitrite reductase [NAD(P)H] large subunit [Bacillus pseudofirmus OF4]
    MREKLVLIGNGMAGIRTIEEVLKKDPDRFDITVFGEEPHPNYNRIMLSSVLQGDASVDDIVLNSYEWYAENHITLHTGDA
    VKKVDTKKQVVYSEKGMVQSYDKLIMATGSNAFMLPLPGADKEGVIAFRNIKD
    CETMIETSKNYKRAVVIGGGLLGLEAA
    RGLLNLNMEVDVIHISDFLMERQLDEPAGRMLKEELEAQGMRFHLKKNTEQILGKDRVEEVRFTDGSVLKTDLVVMAVGI
    KPNIELGKRSGLKTERAIIVNDYMQTSAENVYAVGECAEHRGIAYGLVAPLYEQGKVLAAHLCSTDAASEPGYKGSIVYT
    QLKVSGVDVFSAGVFQDNEKTKAIRVHDEFEGIYKKVVVQDNKVVGAVLFGDTGDSPRLLNMMRSGEDISQMSKVAILPS
    ESSSDSKVSPVVAMADGETICGCNGVSKGDICTAITDLGLQSVEQVKQCTNAGRSCGGCKPLVADLLELTTGEEVGNVKE
    PMCGCTEYTHEEVVSEIRELGLSHPREVMNVLGWESDEGCSKCRPAINYYLQMVDPIKNADDPSSRFVNERVHANINHNG
    TFTVVPRMYGGVTNADQLRKIADVADKYSVPLLKVTGGQRIDLFGVEKEDLPKVWSDLGMRSGSAYAKALRTVKTCVGEQ
    FCRFGTQDSIGLGIELEKKFEYINTPHKVKMAVSACPRNCAESGIKDFGVVGVEGAWELYVGGNGGVDLRGGDLFCKVKT
    KEELIDTISAFLQYYREHARYLERTSHFVERVGLDHMKQVVLEDTEGRNALIERLEIALSTGKDPWKEIVENEEKQKQYQ
    KTHVTMS

    >gi|288554408|ref|YP_003426343.1| NADH dehydrogenase, NDH-2B [Bacillus pseudofirmus OF4]
    MTMKYVIIGGDAAGMSAAMQIVRRNKDADVTTLEMGEYYSYAQCGLPYAVGGLVKGGLDDLVARDVETFRSKYGIDARVN
    HEVTHVDTEKKLVSGKDFSVPYDKLLIATGASPIVPDWDGADLDGIHTVKTIPDTEAVIKDMHNDTHHIAVIGGGYIGLE
    MAENFVEQGKKVTMIERGPQLAGIFDQEMANLIHEEAEKHGVKLLFNEEVKGFKGDSRVEEIVTDKQSFKVDMVIVAIGV
    KPNTHFLEDCGVHLHENGAIQVNGYMETNIPDVYAAGDCATQYHRIKEHDDFIPLGTHANKQGRIAGLNMAGDSRTFKGI
    VGTSIMKFFSLTLGRTGLSLREAEELRIPTEIVDAEIPHHATYYPGSEILTIRLMYQRHTEQLLGAQIIGKEGVDKRIDV
    LATALYHKMTMEDLENLDLAYAPPYNGVWDPIQQASRRRG

    >gi|288554533|ref|YP_003426468.1| reductase [Bacillus pseudofirmus OF4]
    MYDCVIVGGGIAGLQAAIQLGRYEHRVLVIDSDGGRSLLCKSYHNILGYPYGVSGDYLRSIGKEHAVRLGVQFLQGKVET
    INKHKTYFTLQTDHREDILGKRVLLATGIMDRFPKLEGLLPCLGKSVYV
    CPDCDGYEIKDMKTVIIGSGDVGANMALTLL
    YWSKNLLYINHEKKTVSKDLLKQLKEKGVEYIQEEVSALTEEDGLLLDVRLKNGNVIKVNKGFIAFGGNEVRSDLAQQLG
    AERLSNKHIVVDPRSKMTSVEHVWAAGDVAAHSEQVTIAMGEGSQAAIWIHKSLC

    >gi|288554566|ref|YP_003426501.1| hypothetical protein BpOF4_07755 [Bacillus pseudofirmus OF4]
    MSLIGKEVLPFSAKAFKDGEFIDVTNESLKGQWSIFCFYPADFTFVCPTELEDLQNEYENLKALGVEVYSVSTDTHFTHK
    GWHDSSETIGKIKYAMIGDPSQTVSRNFEVLNEEEGLADRGTFIIDPDGVIQTVEINAGGIGRDASTLVNKVKAAQYVRN
    NPGEVCPAKWEEGSETLKPSLDLVGKI

    >gi|288554567|ref|YP_003426502.1| alkyl hydroperoxide reductase (large subunit) [Bacillus pseudofirmus OF4]
    MLLEADVKAQLNEYLKLLEGDILLKVSAGDDSVSKDMLALVDELASMSSKISVRQAELERTPSFSVNRIGEETGVTFAGI
    PLGHEFTSLVLALLQVSGRAPKVDQSVIDQIKNMDGEYHFETYVSLS
    CHNCPDVVQALNMMSVLNPGITHTMIDGAAFKE
    EVESKNVMAVPAVYLDGEFFSGGRISLEETLAKLGTGPDAAELSNKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVLDTMSIENFISVKSTEGPKLAASLEEHVKEYNIDIMNLQRAKNLEKNDLFELELENGAVLKSKSVIVSTGARWRN
    VGVPGEQEFKNKGVAY
    CPHCDGPLFEGKDVAVIGGGNSGIEAAIDLAGIVNHVTVLEFMPELKADEVLQKRLYSLPNVTV
    VKNVQTKEITGTDSVNGITYIDRETEEEHHVELAGVFVQIGLVPNTDWLDGFVERNRMGEIMVDKSGATTVPGLFAAGDC
    TDGPYNQIIISMGSGANASLAAFDYLIRN

    >gi|288554808|ref|YP_003426743.1| hypothetical protein BpOF4_08975 [Bacillus pseudofirmus OF4]
    MKIEVWSDFVCPFCYIGKRRLEKALEQFDDRNAVELIFRSYQLDPDAERNSEDHLYDVLAKKYGMTREKAKEMSDQVAMQ
    AKEEGLVFNFDTSIRTNTADAHRLAHFAYEQGKGLEVTERLLKAYFTDSLHIGDRDILSKLAAEAGVDKEEAEELLSSDR
    FKDTVEKDQQEGMTLGVKGVPFFVFERKYAVSGAQPTHVFLDVLQKVKEEAAVDISTEQEVSDNDCSDGSCNV

    >gi|288554885|ref|YP_003426820.1| Multidomain redox protein (NAD(FAD)-dependent oxidoreductase; Rhodanese domain; SirA-like redox domain; Peroxiredoxin) [Bacillus pseudofirmus OF4]
    MSTKVIIVGGVAGGATAAARLRRISEDVEIILVERGEHISFANCGLPYYIGETIKERSKLLVQTVEGMSKRFNLDIRNLS
    EVLSIDPQNNKVVIKNLRNEEEYEETYDKLLLSPGARPIVPPIPGLNENKTAFTLRNIPDTDKIKTYVDSNKPKKTVVIG
    GGFIGIEMAENLVDRGIEVTLVEMAKQIMAPIDVEMASILHTHLKEKGVHLVLENGVQAFTEQGKKVLLSDGTEIETDMT
    ILSIGVRPENELAKSAGLELGERGGIIVNEYLQTSKEDIYAVGDAIEVVDYINGKKAMIPLAGPANRQGRIAANNMLGKK
    EKYQGTMGTSIAKVFDLTVAATGNNEKTLKHLGITYEVVHIHPSSHAGYYPGAAPMALKLIFDKDTGKIFGAQAVGADGV
    DKRIDVIATAIKGELTVEDLTNLELSYAPPFSSAKDPVNMAGYVASNIRDGELEHIQWHEVDQIVSDGRLLIDVREPMER
    EFGFIKGSTNIPLNDLRDRLSELPKDQTIYVS
    CQVGLRGYLASQILKNKGYKVKNVDGGWKTYSSVLRENLAIDDKTTTN
    NFKENEIKVDKVVDVTGLTCPMPIIELKKGIESLEHGQVLELHVTDKGALNDLPAWSEKAGHTLLKTVQEEKIIKFWIKK
    K

    >gi|288554915|ref|YP_003426850.1| thiosulfate sulfurtransferase [Bacillus pseudofirmus OF4]
    MRKLVVLLCLLLKLTILVPMKGSAREVTYPNNDLLISLEETAQRLNEEHFIIVDTRSEGYTEGHIPGALPFDAAQLADKS
    HPVDGYLIRAEEFERLMNELEISNDDEIIVYDDGDDTAATRLFYALELYGHKKVRVLNGGLKAWKAQGKEVSTTPSEERK
    GSFKANMQANLEVEQDYVKASIDHPNKVLFDVRSKAEYMGEDVRAKRGGHIPSAVNLEWKKVLEDGEVPYFKEASVIDQM
    LEEAGVTREKQIIIY
    CQKAERASHMYFTLRLMGFEHLRMYEGSWEEWGNDPDTPMVNPSQQ

    >gi|288555015|ref|YP_003426950.1| hypothetical protein BpOF4_10015 [Bacillus pseudofirmus OF4]
    MPHQNENSKREWNLENSYVELPDMFYKEIEPNPVRDPKLVVLNEEVIQMLGLDKSELQSDTGIHILAGNSVPKGSHPIAQ
    AYAGHQFGHFTMLGDGRALLFGEQKTPTGETYDIQLKGSGRTPFSRGGDGRAALGPMLREYIISEAMHGLNIPTTRSLAV
    VTTGEPVYREREEIGAIMTRVASSHLRVGTFEYAFRFGGVEGVEKLADYTIDRHYPDARNDANPYLSLLNRVINRQAELV
    SKWQMAGFIHGVMNTDNMSICGETIDYGPCAFMDTYDPKTVFSSIDIQGRYAYGNQPYIAGWNLARFAESLLPLLDDNKE
    RAVEMAQDAIGGFSELFKKYWLKGMRSKLGLFNEEQEDEALIESLLGIMQKSDADFTNTFRALTLNELEKSELSKAAEFT
    QWQELWMARRERQDETKEASVKLMKEVNPAVIPRNHRVEEALHAAENGDYKVMEKLMHALKDPYAYSAEQEEYCSLPPQT
    DQTYQTF
    CGT

    >gi|288555082|ref|YP_003427017.1| glutathione peroxidase [Bacillus pseudofirmus OF4]
    MSTVHDFTVQSTKGEEVSLSTYKGQIMLIVNTATKCGLAPQFKGLEKLHQQYKDKGLAVLGFPCNQFMNQEPVSDEQMTE
    ACEINFGVTFPLFAKINVNGSDAHPLYKHLKKEQKGLLSSEIKWNFTKFLVDKNGEVVKRFGPNTSPEKMEDEIKELLGQ


    >gi|288555135|ref|YP_003427070.1| hypothetical protein BpOF4_10625 [Bacillus pseudofirmus OF4]
    MEFKMKENGFETDVEFGTLQVSGNAEHGFRPYQLLVSSIAVCSGGVLRKVLEKKRVAYEDIHIKADVVRNTEGAQEIQAV
    HMHFTISGCDASEQKIEKSLEVTRKN
    CSMVQSVKESIEITESFDLK

    >gi|288555191|ref|YP_003427126.1| bacterioferritin comigratory protein [Bacillus pseudofirmus OF4]
    MAIEIGQVAPDFTLEASSGEQVSLSQFRGKNVVLYFYPKDMTPGCTTQACDFRDRVESFESLDTVILGVSPDPLARHEKF
    IEKYDLPFLLLADEDHAVAELFDVWKLKKNFGKEYMGIERSTFVIDKEGKIVKEWRKVRVKDHVEEALTFIKEEVEV

    >gi|288555204|ref|YP_003427139.1| Rhodanese domain protein [Bacillus pseudofirmus OF4]
    MELIIQGLFIAFIVWFVVKRILPANGVKQITTEELRKELTRKDVQLVDVRTQGEFSGRKIKQAKNIPLHELKGRHNELSK
    DKEVIVI
    CQSGMRSNKACGTLKKLGYSNITNVKGGMSAWRG

    >gi|288555212|ref|YP_003427147.1| O6-methylguanine DNA alkyltransferase [Bacillus pseudofirmus OF4]
    MAVESTLFVNEMDSPLGTLTIVATERGVCHIHFGDLETCTAALRAKLRKQGLTGEFIRCEEHSANDTLHSVCEQLGDYFK
    GERIQFDVPLDLSGTPFQRKVWEALREIQYGETRSYKQIAESIGAPKAVRAIGGANNQNPLPIIVP
    CHRVIGSNGAMVGY
    GGGLDKKEILLNLEGAIEKIS

    >gi|288555481|ref|YP_003427416.1| Zn-dependent hydrolase [Bacillus pseudofirmus OF4]
    MTVKAMLAKEVTEKVLNKENLFIFDVRNVSDFEDWKIEGENFEYLNVPYFELIDGIDEVRANIPQDKEILVVCAKEGSSM
    MVAEMLSEAGYDVSYLKGGMKSWSEYLYQTKVYEDENISVHQFIRVGKGCLSYMVVSNGEALIVDPSRFVEEYKEAAAEL
    GAKITHIVDSHLHADHISGGKILAEQTGANYYLMKSEGAVFDFEPLEDHDKIEFNQVKLEVLAVKTPGHTPGSVSFFVND
    TLLFSGDTIFVSGLGRPDLGNKVREWANDLYDTVYTKVSDIADDVFVLPGHYADFDEEMNEDGYIGDTLGNIRERNEKMF
    NATRDAFLDNVEKSASSVKPPNFEEIVGINRGVETADKEKMQELEIGPNRCAVHHAD

    >gi|288555482|ref|YP_003427417.1| YdfQ [Bacillus pseudofirmus OF4]
    MKDLTTIEMVDEFIQENKFSFVYVSRTNCSVCHALLPQVKEVLSEFPLINQGFVNADQLEEIAGRLSIFTVPALLLFIDG
    KETIREARFVPIETFEEKVRKVYQLSTAD

    >gi|288555604|ref|YP_003427539.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus pseudofirmus OF4]
    MKKWFVFILLFGMVGWVLYDTIDWQSGEEASPGQITQEINDPEDEIGLKEGNIAPNFTLETLDGGEMALTDFRGQKVFVN
    FWATW
    CPPCQAEMPHMQELYEEHDVEILAINLTETEPNVEQVDRFRNDFELTFPILLDHDVSIAELYQIQPIPSSYFIDT
    NGRIHSVALGALTKEMMVQRIEEMD

    >gi|288555688|ref|YP_003427623.1| cytochrome c biogenesis [Bacillus pseudofirmus OF4]
    MRAKLVLLIMTGFLAFGVFDSITSESSLSKEKTGDGGSGYAPDFTLETLTGDKLSLSDFRGEPVMINFWATWCPPCRAEM
    PDMERFYQETDIIILAVNQTGSEASVAGVQSFTDELNLTFPILLDEKGEAASLYSVQPLPTSVFINRDGEVHHVQVGAMN
    KEMMERVLAEL

    >gi|288555696|ref|YP_003427631.1| Zn-dependent hydrolase and Rhodanese-related sulfurtransferase [Bacillus pseudofirmus OF4]
    MFFRSFFDEKLAHMSYLIGCQKTGEAIIVDPGRNLTPYFEVAKKEGFTISAVTETHIHADYASGAKELAELFNVHLYLSD
    EGDKDWKYEFAKDVGATLVKEGDEFSIGGVHLKVMHTPGHTPESISILLTDKGGGAREPMGVFTGDFLFVGDVGRPDLLE
    KSAGSAGTAKVGAKDMFASLQKARNLSDDLQIWPAHGAGSACGKSLGAVPVSTIGYERKHNWAFQITDEDEFVDELLSSQ
    PEPPTYFGVMKKLNKKGAEQKPGNMPRRLQSLSDLKEMIDDHVYVLDTRKSPLFAYGHIKEAVNISIEKSFTNWAGWLVP
    YDKDLIVVVEEEKLDEVITALQSIGLDRTIAFIDQKTIEQDVTLPMYKQVDVHEAYQTVRSSEAALIDVRNDDEWTNGHA
    PEAIHAFLGHIEDHLEDLPKDQPLYVL
    CGSGVRSAIAVSVLQKHGFDRVVNVKGGFTAWVGADLPVTKDES

    >gi|288555699|ref|YP_003427634.1| SirA family protein [Bacillus pseudofirmus OF4]
    MTIKADHVLDAKGLSCPMPIVKTKKTLDGIEPGQVLEVQATDKGSLADLKAWAGSTGHQYLGTIEEGDTLVHYIRKASAN
    EEKEEVDFANVISNEELEAKIGSENVTILDVREPAEYAFSHIPTAASIPLGELESRLGELNQDHEVYVV
    CRTGSRSAMAA
    QLLQDNGFTNVTNVKPGMTAWNGKTESK

    >gi|288555705|ref|YP_003427640.1| Rhodanese domain protein [Bacillus pseudofirmus OF4]
    MKFLSLTVLAILIGIGVFSLFNQSSNNVEEITTTELKEQMKTDQTAVYIDVREVDEFEDGHVEGMKNMPLSSFTETYSEL
    PKDKEIVVM
    CRSGNRSMQAAEYLVQQGYKNVINVSGGMLAWDGPVK

    >gi|288555799|ref|YP_003427734.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus pseudofirmus OF4]
    MENTYERYSRQMLFQPIGESGQKKLSDQKVLVIGVGALGTVLSNHLVRAGVGMVRIVDRDYVEQSNLQRQMLFDEEDVAK
    HLPKAIAAKEKLKRINSDVEVDAIVCDASIENIDSLMDGVDLVLDGTDNFKTRFLLNDACFKKGIPFAYGGAVSARGMSA
    LFIPGETPCLRCFIDHGETQGQT
    CDTIGVISPIVDIVASYQVVEAMKYLVGDKKALRNTLRTFDLWGNHQYDMKMTKAKE
    GCPTCQKKEYPALHASGDLITTLCGRETVQIQREHKIDLNEWSERLERVAEVKKTPFLLRVQLTEGEKFVLFPDGRVLIQ
    GTEDIARAKSLYSKYIGD

    >gi|288555832|ref|YP_003427767.1| methionine sulfoxide reductase B [Bacillus pseudofirmus OF4]
    MSRNKEELKERLTPMQYEVTQNNGTEPPFRNEYYNVEDDGIYVDIVSGKPLFSSLDKYDAGCGWPSFTKPIVDEEIIEKE
    DRSHFMIRTEVRSKDADSHLGHVFNDGPGPNGLRY
    CINSAALRFIPKEDLEKEGYGAYLKLFQA

    >gi|288555833|ref|YP_003427768.1| methionine-R-sulfoxide reductase [Bacillus pseudofirmus OF4]
    MAEAFRKATFAGGCFWCMVKPFDSYDGIESVISGYTGGHTENPTYKEVCSETTGHYEAVQITYNPEIFSYKQLVEIFWQQ
    IDPTDAGGQFHDRGDSYRPAIFYHDESQKETAEESKAELQASGRFTKPITVDILPAQTFYPAEEYHQDYYKKNPFHYMMY
    HKGSGRAAFIKNNWGDNQDESK

    >gi|288555949|ref|YP_003427884.1| thioredoxin (thiol:disulfide interchange protein) [Bacillus pseudofirmus OF4]
    MKRKRTFLVLAIACILAVVTVVTMDRQEVGNEVGMVAEDFELPTYQGGQESFNQYEGQVVILNMWASWCEPCRDEMPDFM
    ELQQDYHQEGLDIVTVNMQTYERTLNDAPEFIEEMNLTLPVFFDADGLVSDRYGIRVLPTTFVIDREGVIAHVIPGEVNY
    ERLEELIKPLL

    >gi|288555962|ref|YP_003427897.1| organic hydroperoxide resistance protein [Bacillus pseudofirmus OF4]
    MAEVMFTAQAKAKNGRNGHVTSNNGVIDHKLVMPTGGNSDKDGTNPEQLFAAGYAACFDGALNLMAKNSNEDIDSEIEAE
    VSLLKDPSDDGFKIGVTLNVMIKGVSQATAEELTHKAHEF
    CPYSKATRGNVDVNLNVKAE

    >gi|288555966|ref|YP_003427901.1| hypothetical protein BpOF4_14800 [Bacillus pseudofirmus OF4]
    MKKVLIFGGIIVILFGLLAVVNSMKQSQLAEGNPFGKERIDPATAELVNDPNYQNVILPEELEEILEDNGDVTVYFYSST
    CPYCKEATPRLVPISEELGVDLVQYNLTEFDEGWSDHNIESTPTIVQFENGEEVDRIVGSAPDEEYRAFFERNVNN

    >gi|288556015|ref|YP_003427950.1| thiol-disulfide oxidoreductase [Bacillus pseudofirmus OF4]
    MKRKRLIMRTSILAVIAIALAYTFYSNYIADHSVARAGNDAVNFALTDLEGERIELDEYRGQGVFLNFWGTYCPPCVKEM
    PIMEDLYDEYKEQGVEIIAVNVNEPELTVNQFVNRLNLTFPIAIDKGMRVSDAYGISPLPTTILIDEHGEIVKVHTGGMT
    DSQVREFLELIKPSTNS

    >gi|288556149|ref|YP_003428084.1| rhodanese-like domain protein [Bacillus pseudofirmus OF4]
    MNQNLPFIKTAKEVKNLLENGASLRLIDCRTKLGDPSDGLSRYEESHLPNAAYLDLEGDLTGEKGEHGGRHPLPTPEALE
    ELFSHLGIDQETMVVAYDDEGGAFASRLWWMLSYVGHENVYVLNGGFKEWTEHGFPVTKEIPVFTKKDFSANVQPHMTIS
    KEEVAASLNEAILIDSRELARYQGISEPVDKKAGRIPGAVHGFWKENLDESGMWKDEHRLRERFADLHFDEEIIVY
    CGSG
    VTACPNILALKGLGYQNVKLYPGSWSDWITYPDAPIEKEPQS

    >gi|288556157|ref|YP_003428092.1| probable thioredoxin [Bacillus pseudofirmus OF4]
    MESITEQELNERLKSKEELQFVFVTTPLCGTCKLARRMLMILEESAPAFKPLELNVNTAAGFANRWKIKSVPVLLVFKKG
    LGVERIYAFHSIAHLYEMLKPYVGKEGIHNLGEDKKGR

    >gi|288556159|ref|YP_003428094.1| thioredoxin [Bacillus pseudofirmus OF4]
    MNSTAPDFTLPALNGTESLTLGSLKGKVVLLTFFTTWCPDSKKDILEKQALFQSMNRDDVKMIFVHVTGRDSSVDLSKWQ
    EEMQLTLPVYMDLGTKTYDAYRCMGVPTTVLIDKDQSIKGLYNDKARMIDIIKGLGGLL

    >gi|288556315|ref|YP_003428250.1| cadmium-transporting ATPase [Bacillus pseudofirmus OF4]
    MTEARARISEEESKTYRVQGFSCAGCAKTFEENVKHLDGVSDAQVNFGASKITVTGAVSMKELEKAGAFENLQLRNEHEK
    AAPHIPFWKQKTTIKVYIAIALLLMSFLSNYIVEEGSSLPLMLIILSILIGGYTLFIKGLNNLIRLKFDMSTLMTIAIIG
    AAFIGEWIEGAVVVILFAISEALERYSMDKARQSIASLMDIAPNEALIRRREQEMLVNVDEIEIGDIMIVKPGQKLAMDG
    VVVKGISTINQAAITGESVPVMRSVDDEVFAGTLNEEGLLEVRVTKRVEDTTIAKIIHLVEEAQAEKAPSQAFVDKFAKY
    YTPAIIILAALIIVIPPMMLGGEWSEWIYLGLATLVVGCPCALVVSTPIAVVTAIGNAARSGVLIKGGVYLEEAGALRAI
    AFDKTGTLTKGVPNVTEIVTLKGEEAETLKITAAIEKGSQHPLASAIMRKAEDSGLDFHSVQVEEFQSLTGKGLKAQVDG
    VQYYVGSPALFQDLHKEIESTIHDLIIQLQNEGKTVMVVGTKNEILSLIAVADEVRESSKEVIQKLNQIGIDTMMLTGDN
    RRTAEAIGKQVGVKNIEADLLPEDKLTYIKGLNDKHQRVAMVGDGVNDAPALAASTVGVAMGGAGTDTALETADIALMSD
    DLSKLPYTILLSRKALTIIKQNITFSLAIKAFALLLIIPGWLTLWMAIFADMGATLLVTLNSLRLMKMNDNE

    >gi|288556607|ref|YP_003428542.1| heavy metal-transporting ATPase [Bacillus pseudofirmus OF4]
    MEQKEVSLTISGMTCAACANKIEKGLSRVEGVKEANVNFALEKTTIKYDPSVVDKKEFEAKIEKLGYQVIHDKTEFDISG
    MT
    CAACANRIEKRMNKLEGVSSANVNFALETLSVEYDNRAINPNEMVETIKKLGFTLIPKQDARETVDHKEKEIEKQYGK
    FIFSAILTLPLLWTMVTHFEMTAFLYMPGMFMNPWVQLALATPVQFIVGAQFYKGAYQALKNKSANMDVLVALGTSAAYF
    YSIYLGWEWMAAGGQGMPELYFEAAAVIITLIVLGKLFEVRAKGRTSQAIQKLLGLQAKTARVIRNGEEVEIPAEEVIVG
    DVVIIKPGEKVPVDGELIEGRSAIDESMITGESIPVDKSIGDSVIGATINKNGSIKVKATKVGRDTALSQIVKVVEEAQG
    SKADIQRLVDKVSGIFVPVVVAIAIATFLIWYFIVAPGDLRQALIPMISILVIACPCALGLATPTSIMAGSGRAAEMGLL
    FKGGEHLENTQNIQTVVLDKTGTVTKGQPELTDVEIAEGFTEEDVLYYVGSAEKHSEHPLAQAMVKGIKEKGISLNDSTD
    FEAIPGYGIRAIVDNKEILAGTRNLMKQHSVPMKNADSLMEELENQGKTAMLIAVEGQFAGIIAVADTVKETSKEAIERM
    HDLGLEVIMLTGDNERTAKAIASQVGITHVIAEVIPEQKSSEVKKLQEQGKKVAMVGDGINDAPALAVADIGMAIGTGTD
    VAIEAADITLMRGDLNSVADAIHMSRKTMKNIKQNLFFAFIYNTSAIPIAAVGLLAPWVAGAAMAFSSVSVVLNALRLQK
    VKFTK

    >gi|288556783|ref|YP_003428718.1| transporter [Bacillus pseudofirmus OF4]
    MNLQTKAEPLDSRSLEHPALPPVQTIFLAAGITAAILLSIATFTIADANLLIQLWIGLLLGYTLFHARFGFTSAFRRLMS
    VGNGEGLRAHMLMLAVASSLFAPILAYGASFYGHDPTGFVSPVGTSLLVGAFIFGIGMQLGGG
    CASGTLYSVGGGRSSMF
    ITLFGFIAGSVIGAAHFDFWMNETPTLPAISLATDTGLGYGGAWLLQLVIFAGIIFLTYYIQRKKNPPKMALVPSAQGMK
    RIFRGSWPLLIAGVVLAVLNAVTLLVRGQPWGITSAFALWGSKAAQFIGIDVASWGYWSGERAQELNQSVFLDSTSVMNF
    GIMAGAFIAAAAGGVFVLKKIPPKVMIASLIGGIMMGYGARLAFG
    CNIGAYFSGVASFSLHGWVWAVMALAGTYVALYLR
    PLFGLSIPKPTDSSC

    >gi|288561500|ref|YP_003428906.1| cadmium resistance protein B [Bacillus pseudofirmus OF4]
    MSEQQAKLSEEEMKTYRVQGFTCANCAGKFENNVKKLPGVQDAKVNFGASKISVYGDATIEELEKAGAFENLKVNPEKSA
    RHVSQEVTDDTKEEKVPFYKKYSTLLYSTSFLAFGYLSYFVNGEENLLTTLLFLASMLVGGLSLFKVGLQNLLRFEFDMK
    TLMTVAVIGGAIIGEWGEVAIVVILFAISEELERFSMDRARNSIRSLMDIAPKEALVRRNGQEIMIHVDEIAVGDIMIVK
    PGEKIAMDGVVVNGYSAVNQAAITGESVPVEKTVDDEVFAGTLNEEGLLEIKITKLVEDTTISKIIHLVEEAQGERAPSQ
    AFVDKFAKYYTPIIMIIAALVAVVPPLLLGSSWETWVYQGLAVLVVGCPCALVISTPISIVSAIGNAAKKGVLVKGGVYL
    EEMGALKAIAFDKTGTLTKGVPVVTDFDVLNNQTNEKDLLAIITALEYRSQHPLASAIMKKAEEENILYSKVLVEDFSSI
    TGKGIKGIVNGMTYYIGSPKLFRELLTTDFDKDLEQNITALQNQGKTAMIIGTEKEILGIIAVADEVRESSKDIIQKLHQ
    LGIKKTIMLTGDNKGTANAIGSHVGVSDIRADLMPQDKLEYIKQLRADFGNVAMVGDGVNDAPALAASTVGIAMGGAGTD
    TALETADVALMGDDLRKLPFTVKLSRKALNIIKANITFAIAIKFIALLLVIPGWLTLWIAILSDMGATILVALNGLRLMR
    VKEE

    >gi|288561501|ref|YP_003428907.1| dihydrolipoamide dehydrogenase component of pyruvate dehydrogenase E3 [Bacillus pseudofirmus OF4]
    MTVEGKREVDLLVIGAGSGGYVAAIRAAQLGKKVVLVDKAELGGVCLNRGCIPSKALISASERVKHIKHANTIGIKVSGE
    VNVEMPEVVKWKDGIVNKLTNGVQTLLKGNGVEVISGEAYLTEPFVVKINIGNQEQVFSYKDLILAIGSLPTELKSMPFD
    RKRIISSTEALTLQEVPKHLVVVGGGYIGLELGTAYAKFGAKVTILEGSDTIIPGTDPMLTSVVKRHLKEHGITVKTNAL
    VQGGENTGDEVNIEVQINGKEEIIKGDYCLVSIGRKPNTGKMGLENIGVELDRHGFIKINDKCQTNVEHVYAIGDCAGGY
    LLAHKASYEGKIAAEVISGLKSVIDFQAMPFVIFSDPEVAYTGLTEKEAKEKGYETVSSRFPFQANGRALSVSDGDGFVK
    VVADKKSNRVLGVQMVGPDVSSLIAEAVFAIECGATAEDLSLTIHAHPTLPEPLMEAAEGVMGHAIHMLNKI

    >gi|288561523|ref|YP_003428929.1| heavy metal translocating P-type ATPase [Bacillus pseudofirmus OF4]
    MSKMIFSVKGMTCASCVNRVEKMISKVEGVRSVNVNLAANQAQVEADETIEMSEAIIKAIEKAGYDAKPIDNDDRRKVLF
    SVKGMT
    CSSCVTRVEKAIAKVEGVQSVNVNLAANQAQVEGEKGILDPEAVIKRIEKIGYEASIINENEQREESDEQEVET
    RKLLKDFTLAAVLTTVVLVGSIPHMMHGWGAWVPTFLSNPLFLLVLTSYIQLVPGWRFYKNSYKVLRNGSADMNVLVAMG
    TSAAWLYSGAMTLFPDQLTAMGFPYQLYYDVTTVITTLILLGRYFEAKAKGQTSTAIKKLMSLQAKTARVIRDGNELEIS
    VDEVKIDDEIIVRPGERIPVDGVVTKGRSTIDESMLTGESIPVEKAAGDEVIGATINKSGSFRFRATKVGKETALAQIIR
    MVNEAQGSKAPIQRVVDLISAYFVPAVLLIAVVSFIVWYFVGPDPSLIFALTTFIAILIIACPCALGLATPTAIMVGTEK
    GAENGILIKNATSLERAHKIKTVVLDKTGTITEGKPKLTDIITTEIVSEQELLQVAASVETASEHPLGEAIVEAAKEKDL
    PINDPESFEAIVGHGLLASLNNKEVLIGNIKLMSKYNIDLGLYEEKAIALADQGKTPMYVGIDGEFAGIIAVADTLKKGT
    IPAIKALKSMGIEVIMLTGDHKRTAKAIAMEAGIDNYIAEVLPEHKAEEVKKLQGEGKMVAMVGDGINDAPALAQADVGI
    AIGTGTDVAMETADITLMRGDIKSVVTALRLSKSTMKMIWQNLGWAFGYNIVLIPVAAGLLYPLFGILLNPMLAGAAMAF
    SSVSVVLNTLRLKKFKSTIE

    >gi|288561524|ref|YP_003428930.1| YvgY [Bacillus pseudofirmus OF4]
    MEQKTLKVNGMSCGHCISTIENNIGKLNGVNSVKVMLSEGKVNLNYDSDVISLDQIIHEIEEQGYDVE

    >gi|288561569|ref|YP_003428975.1| Rhodanese-related sulfurtransferase [Bacillus pseudofirmus OF4]
    MRKYLLPLSFIIVIGISVLITVNPFQAPIVKEDPISQKWDDIDQEEVLMEVGNEHVEMVDLREEELYRKGHISGAINIPY
    EEFQDRYDELNQEKRIILI
    CHTGRMGVESADFLVEKGYDKVANFGGGMAVWDGPLSIE

    >gi|288561575|ref|YP_003428981.1| thiol-disulfide oxidoreductase [Bacillus pseudofirmus OF4]
    MKTRRLFIRTVTLLIMAIAIGYTFYSNFFSDADAAVRVGDEAPNFVLTDLNGNEVELEDYRGQGVFLNFWGTYCPPCERE
    MPYMENQYAIYKDQGVEILAVNVGEPELTVQRFVERLNLTFPIPMDKGQQVLDRYGVIPLPTTFLINAEGEIINIITGGM
    TEQAIAQYMESIKPQE

    >gi|288561594|ref|YP_003429000.1| mercuric reductase [Bacillus pseudofirmus OF4]
    MNKFKINIQGMTCTGCEEHVAVALEKIGARNIEASFRRGEAVFELSDDIGVEIVKKAIDEAKYQLGEIEEVSPQENVVLG
    DDGDYDLLIIGSGGAAFSAAIKAIEYGAKVGMIERGTVGGT
    CVNIGCVPSKTLLRAGEINHLAKVNSFTGLQTSAGEVEL
    APLIKQKNKLVSELRNQKYVDLIDEYGFDLIEGEAKFVNENIVEVNGKKLSAKRFLIATGASPSLPSLSGLEEVDYLTST
    TLLELRKVPKRLTVIGSGYIGMELGQLFHNLGSEVTLMQRSERLLKEYDPEISEAVEKALIEQGINLVKGATLERVEQVG
    KLKKVHVTIDGKKKVVESEQLLVATGRKPNTDSLNLSAAGVEVGKRKEILINDYARTSNEKVYAAGDVTLGPQFVYVAAY
    EGGLVADNAIGGLNKKLDLSVVPGVIFTNPSIATVGLTEEQAKEKGYEVKTTVLPLDAVPRAIVNRETTGVFKLVADAKT
    LKVLGVHIVSENAGDVIYAATLAVKFGLTVEDLKESLAPYLTMAEGLKLAALTFDKDVSKLSC
    CAG

    >gi|288557187|ref|YP_003429254.1| cadmium resistance protein B [Bacillus pseudofirmus OF4]
    MSDQKAITSEQEMKAYRVQGFTCANCAGKFEKNVKQLSGVEDAKVNFGASKIAVYGNATIEELEKAGAFENLKVTPEKSA
    RQASQEVKEDTKEDKVPFYKKHSTLLYASLLIAFGYLSSYVNGEENIVTTLLFLASMFIGGLSLFKVGLQNLLRFEFDMK
    TLMTVAVIGGAIIGEWAEVAIVVILFAISEALERFSMDRARQSIRSLMDIAPKEALVKRNGQEIMIHVDDIAVGDIMIVK
    PGQKIAMDGVVVSGYSAVNQAAITGESVPVEKTVDNEVFAGTLNEEGLLEVEITKLVEDTTISKIIHLVEEAQGERAPSQ
    AFVDKFAKYYTPIIMIIAALVAIVPPLFFDGSWETWIYQGLAVLVVGCPCALVISTPISIVSAIGNAAKKGVLVKGGVYL
    EEMGALKAIAFDKTGTLTKGVPAVTDYNVLNKQINEKELLSIITALEYRSQHPLASAIMKKAEEENITYSDVQVEDFSSI
    TGKGIKGIVNGTTYYIGSPKLFKELLTNDFDKDLEQNVTTLQNQGKTAMIIGTEKEILAVIAVADEVRESSKEILQKLHQ
    LGIKKTIMLTGDNKGTANAIGGQVGVSDIEAELMPQDKLDFIKQLRSEYGNVAMVGDGVNDAPALAASTVGIAMGGAGTD
    TALETADVALMGDDLRKLPFTVKLSRKTLNIIKANITFAIAIKFIALLLVIPGWLTLWIAILSDMGATLLVALNGLRLMR
    VKE

    >gi|288556541|ref|YP_003428476.1| hypothetical protein BpOF4_17715 [Bacillus pseudofirmus OF4]
    MARITESKTGSTPFQRLLGHNPEVMNAWSNLGNVLERDALISADLKEQVRRTLAQGNGCEYCKAKGKPDDVHSDEKTSVA
    VALSEVFLKQKGTISDRQFQILEELFTEEEISELIAFITFTTASQYFGAMMRLEG