Thermoanaerobacterium thermosaccharolyticum DSM 571 uid51639

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|304315743|ref|YP_003850888.1| methylated-DNA/protein-cysteine methyltransferase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MLYDYLDTPIGKLTIYSSENGIMRIDFPNDKHMKCDRGTNEFIDSCKKQLKLYFDGRLREFKIKLDIKGTDFQKSVWKEL
    MKIPYGFYATYGEIAKRIGKPNASRAVGNALNKNPIPIVIP
    CHRVIGSDMTLKGFGGGLNVKAFLLEHEGIAFKK

    >gi|304315763|ref|YP_003850908.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MKVVIVGGVAGGASAAARLRRLDENAEIILFEKGEYISYANCGLPYYIGEVIKEREKLIVQTPEAMSKRFNIDIRTLSEV
    TKIIPSEKTVIVHDIQNNKTYKETYDKLILSPGAEPIKPPMPGIDGKNIFTLRNIPDTYRIKDFVDYNKPKKAVVVGGGF
    IGLEVAENLKEVGLDVTVVELADHVMAPLDYEMASIVHQHLRDKGINLILKDGVKEFQHKNNSTTVVLNSGKTIDTDMVV
    LGIGVRPDIKLAKDAGLAIGDRGGIKVNEYLQTSDPDIYAVGDAIEVKDYINGSYTLIPLAGPANKQGRIAADNICGRNS
    KYDGTQGTSVAKIFDLTVAATGNNETILKRAGIDYEKVIIHPNSHASYYPDALPMTIKLIFKKEDGKILGAQIVGFDGVD
    KRIDVIATAIRANMTVYDLEELELSYAPPYSSAKDPVNMAGFAASNILRGDISVFHWDEIENIDMSKSIILDVRTDMEYE
    LGNIKGSINIPVDELRENLDKIPKDKNIYVY
    CQVGLRGYIACRILMQNGFKSVKNLSGGYKIYETATSDSSDITIRYDDE
    QTECGMCISSDKKKLDDSIITLEIDACGLQCPGPIMQTFNAIKNLKDGDILKIKASDPGFENDIKTWCQRTGNTLLDLYH
    EGRTIVAKIKKNTNDKKVEVSQNSEKNDKAIIVFSGDLDKAIAAFIIANGAAAMGRKVTLFFTFWGLNILRKPEKVSIKK
    DFLSKMFGMMMPRGSKKLKLSKMNMLGIGPKMIRYIMNKKNVASLENLIKQALKNGVRIVACNMSSDIMGITKEELIDGV
    ELGGVASFIGAAEQSDTTLFI

    >gi|304315861|ref|YP_003851006.1| Methyltransferase type 11 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MDAKENIINRYEKLAEEEDNLSCGGKNIVLAELKEGENVLDLGCGRGNDILNAAKTIGEKGIAVGLDLTKRMIEKAEKNR
    EKLNIKNVEFIVGDVENIPLQDGKFDVVISDCVINHAKDKEKVYREIYRVLKDGGRFVVSDVVSIDRLPEEIVNDPDAWA
    D
    CFGGAILEEDYIKAIKNAGFKDVQYLKRREYKKNGYLVASITIKGFKR

    >gi|304315897|ref|YP_003851042.1| hypothetical protein Tthe_0389 [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MDLKQLFYNGVSFSEFVKSENNEITERLKSRYDNIALDGTAVNFKNKVRYVLAFAENWCPDCQVSVPIMAKLCDVAKIDF
    KILKREGHEEEMKPFYEDGKAKIPTFAFLDDSFNVVGTWIERPKVIKELVAKGDNSYRRGYVNGEYDKDIVNELLEIMSR


    >gi|304315985|ref|YP_003851130.1| thioredoxin reductase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MYDLIILGGGPAGLAAGLYACRSKLDTVMIEQMYVGGQIVTTYEIENYPGFDGISGPDLINKMEAQAKSYGLQIYNEEVV
    GLDITGKVKKVTTNKKTYEAKAIILATGATPKELGFDKERKFRGSGVSY
    CATCDGAFYKDQVVAVVGGGDTAMEDSNYLT
    KFAKKVYVIHRRDKLRATKTLQDRAFANPKIEFIWDTVVKDIQGEYGVEGLVLKNVKTNEESTLKVDGVFIAIGLSPNSD
    LVRGIVDTDEYGYILTDEDMKTNIPGVFAAGDVRKKTLRQVVTATADGAIAAYVAEKYIDSLE

    >gi|304316088|ref|YP_003851233.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MMEHDIVIVGAGPAGLGAAVEAYEKGVKDILIIERDSHPGGILQQCIHNGFGLIEFKEELSGPEYAERFIEKVKRYGIKI
    MLDTMVLDITSDKIVKAVNQKNGVMEIKAKAVILAMGCRERPRGAISIPGTRPAGIFTAGTAQRYVNMEGYMPGKEIVIL
    GSGDIGLIMARRFTLEGAKVKAVVELMPYSSGLTRNIVQCLEDFGIPLLLSHTVIEIHGKDRVEGVTIAQVDANRKPILK
    TAKYISCDTLILSVGLIPENELSKSAGVVLDPVTGGPIVNESMETNIPGIFACGNVLQVHDLVDNVTKESRLAADSAVKY
    IKGLLKQEGKFINAKAGSGIRYVVPQKVNYENIDDKVKFHMRPTDVFKNAYINVKSGGREIMRRKMQRLTPGEMILIEIK
    KDKFLDNDLHPVDDITFEVEVV

    >gi|304316210|ref|YP_003851355.1| copper ion binding protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MSLFGPKGETTTIDVKGMSCNHCKMTVEKALKALDGVSKATVDLDKANVTVTYDPKKVTIDEMKKAIIDAGYEA

    >gi|304316239|ref|YP_003851384.1| copper-translocating P-type ATPase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MPEKTTLKISGMSCASCAAKIEKGLKNMDGVDEANVNLAIEKATVIYDPNKVDIDDMTKKIEDLGYGVIKDKVELILIGM
    S
    CASCAAKIEKALNNLQGVNRATVNFATETATVEFDSSKVDVAAMIKAVRNIGYDAKEKTGIGMDTEKEEREREVKTLKR
    LVTISSILTIPLLISMFGRIFGFSAGILDNPWAQIIISFPVQFIIGYRYYKGAWHNLKNLSANMDTLIAMGTTAAYFYSL
    YNVFTKPMSEIHNYLYFEASAVIITLITLGKLLEAIAKGKTSEAIKKLMGLQAKTARVIRNGEEIDIPIEEVEVGDIVVV
    RPGEKIPVDGVIVEGSSAIDESMITGESIPVDKNVNDEVIGATINKTGTFKFKATKVGKDTVLSQIIKMVEDAQGSKAPI
    QEIADKVSGVFVPVVIGIAVVTFLIWYFVLGNFNAGIISAVSVLVIACPCALGLATPTSVMVGTGKGAENGILIKGGEYL
    QKAKEINAIVLDKTGTITKGEPEVTDIISLGDLSDNEILYISGIAEKNSEHPLGKAIVNKSKEIYEKLPDPNKFEAIPGH
    GIYAIINEKEYYFGNRRLMEKNNIDISNIESKLEQLENEGKTAMILASNEKVEGLIAVADTPKEDSAKAIKELKALNIDI
    YMITGDNKRTAQAIAKQVGIEHVLAEVLPENKAEEVIKLQKQGKIVAMVGDGINDAPALAQSDVGIAIGTGTDVAIETSD
    ITLISGNLMGLVTAIKLSRATMRNIYQNLFWAFIYNTIGIPFAAMGLLSPAIAGGAMAFSSVSVVSNALRLRRFRSAK

    >gi|304316304|ref|YP_003851449.1| cadmium-translocating P-type ATPase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MLKKEVILEGLDCANCAAKIEDEVNKLNGVKAYMNFMNKTLTLETESEQEYKNTLQQVKTIVHKHEPDVVVKEKSVNKSN
    KKVLILEGLD
    CANCAAKIEAQTQSLEGVNSATVDFVSKKLTIEAVDKKEFGKILGEVTSIVNKLEPDVKIVDAEKKKVNK
    SIVMLEGLG
    CANCAAKMEKEISGLEGVEFAAVDFVSKKLTLEISPKVNRSELNEKIEGIVKKIEPDVKVIFEENNSKTKI
    NENNEEEEEGVNKKEIIRLVVGGAIFAVGIIFNFQNWLELTLFIISYIIVGGEVVLRAIKGIARGQVFSEHFLMSIATIG
    AFFVGEYPEGVAVMLFYLVGELFQDIAVGHSRKSIRALMDIRPDYANLKVGDEIRKVSPEEVNIGDIIIVKPGEKVPLDG
    KVIEGNSMVDTAALTGESVPRELGPGDDALSGFINKNGVLTIEVTKDFGDSTVSKILDLVQNASSKKAPTEKFITKFARF
    YTPIVVFGALALAIIPPLVIPGATFSTWIYRALVFLVISCPCALVISIPLGFFGGIGGASKRGILVKGSNYLDALNNVET
    VVFDKTGTLTKGIFEVVDVNPQADFTDEELIEYAAFAESHSSHPIALSILKVYNKDVDITKIENYEEIAGHGILAKVGGK
    EILVGNSKLMNKENIKYQEVETLGTIVHVAVDKKYAGNIVISDAVKEDSADAIKGLKALGVRNTVMLTGDSKAVGEKIAT
    QLGIDEVYTELLPTDKVEKIEALDAKKSHKGKIVFVGDGINDAPVLARADIGVAMGGLGSDAAIEAADIVIMTDEPSKIV
    TAIKVAKRTRKIVMQNIVFALGVKAIFLALGAVGVATMWEAVFADMGVAIIAILNAMRVMNTKSI

    >gi|304316328|ref|YP_003851473.1| electron transport complex, RnfABCDGE type, E subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MSIFNTFKNGIWKENPTFIQVIGMCPTLAVTTAALNGIAMGIAATFVLFFSNILISSLRKFTPDKIRIPIFIVVIATFTT
    IIGMLIKAFSPALDKALGIYIPLIVVN
    CIIMARAEAFAYKNTVLQSAADGLGMGLGFTLALFILGSIREIIGNGSIFGIS
    LFGPNYQPALIFIMPPGAFITLGLLLGFFRLMEGVQKKRREKAIKKKALLGGASHADRAYTYTD

    >gi|304316329|ref|YP_003851474.1| electron transport complex, RnfABCDGE type, A subunit [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MLTELILILISSILVNNFVLVRFLGECPFLGVSKNVETALGMGIAVTFVMTIASAFAYIVYNMILVPLGLSYLETIAFIL
    VIASLVQFVEMVIKKSSPALHQALGIYLPLITTN
    CAVLGVALLNVQQNYNFIESVVNGFGSAVGFTLAIVLYAGIRERLE
    LAPISKVLEGFPIALIGAGLMSIAFLGFQGLI

    >gi|304316434|ref|YP_003851579.1| alkylhydroperoxidase like protein, AhpD family [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MAIGVKLVSNEEASPEVKQLFEQIEKQMGFIPPTMRAMANKPEYLKLFLEKSRVVMGSGKIDGKTKLFVALTVSILNNCE
    M
    CITTYTNKLKEAGVTDEEIVELLSIIDLVGGLNHFNNGLMIKPSEK

    >gi|304316551|ref|YP_003851696.1| Heavy metal transport/detoxification protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MIKDVKLNIEGLSCPDCSKKIEQALASQEGVKEAKVLFTTGVAKVKFDDGVIDLDKIISVINSFGFNVSD

    >gi|304316610|ref|YP_003851755.1| peptide methionine sulfoxide reductase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MKEIVLAGGCFWGVQAYFDTIDGVAETKVGYANGNKENPTYEEVCTNTTGFAEACYVRYDENIISLEDLLRNYWKIINPT
    LKNRQGNDIGTQYRTVIYYIDSDDADIIIKSRDEEQKKYDKPIVTEIEPLKNFYDAEEYHQKYLEKNPNGYCHIPREFFK
    K

    >gi|304316689|ref|YP_003851834.1| Peroxiredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MIELEKEAPDFTLKSSDGNDVSLSDFKGKKVVLYFYPKDNTPGCTKEACQFRDNINTVKNKDAVILGVSLDDIESHKKFI
    EKFNLPFILLSDSDAKVSTEYGVYKEKNMYGKKKMGIERSTFIIDQKGIVKKIFRKVKVDGHVDEILEVLDNID

    >gi|304316705|ref|YP_003851850.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MAEVTITKNNFQEEVVNSNIPVLVDFWAEWCGPCRMVSPIIEELANDYEGKVKVGKINVDDENELAVQFKIMSIPTIALF
    KDGKMVDKIVGARPKSDFEDFINRNI

    >gi|304317040|ref|YP_003852185.1| UBA/THIF-type NAD/FAD binding protein [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MNFSNEQLERYSRHIILKEVGAKGQQKILNSKVLIVGTGGLGAPAAMYLAAAGVGTIGLVDYDKVDLSNLQRQIIHRTKD
    IGKDKVISGKETINEMNPDVNVITYHEWISSKNIIDIINDKDYDFIIDGTDNFPAKFLINDACVLIKKPFSHAGIIRFEG
    QTMTYVPGEGPCYRCVFQDPPPKDAVPT
    CKQAGVLGVMGGIIGTIQATEALKYILGVGELLTGYLLTFDALKMEFRKIKI
    SKRKSCQVCGVHPSIKELIDYAGLQCDLKEDHK

    >gi|304317063|ref|YP_003852208.1| thioredoxin [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MKPIDVTDMNFDSEVYNSDKPVLVDFWAAWCGPCRMMAPVLEEFAEDYSDKIKVVKLNVDENPLIASQYRIMSIPTLGVF
    QNGQLVDKVIGFMPKEQLEYRLAKYIDAQV

    >gi|304317064|ref|YP_003852209.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MKNNRFKDIKISGKKRKNIKLVASIAIILILGISIYFLNSYVMSNQSKSNSQNVSGVNTADEKIQVGTEKGDLAPDFSLK
    DINGNTMTLSKLRGKKVILNFWATT
    CPYCKIEMPELNKFYQNHKKDVVLLAIDIGEEKSTVENYLEGKGYGFTILLDSDA
    KTAINYKVQFIPMSFFIDEKGIIRSISNGAMTYDEIEEYYQTISQ

    >gi|304317378|ref|YP_003852523.1| dihydrolipoamide dehydrogenase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MNIEVKVPTEEVSQESTLNNTGVYNNEAKEYDLAVIGGGPGGYVAAIKAAKKGAKVALFEKDRLGGTCLNRGCIPTKAYA
    RVAEVYDIIKRADEFGFDVDVKLFDYKKVVERKDNIVNELVSGINTLLKANGVDLYSEEAKIDKDKNILFGENKIKAKNI
    IIATGSEPAELPIEGVKSENVINSNDILEITALPESMCVIGGGVIGMEFAFIMNQFGVEVSVVEMMPNILPSLDREVSNV
    IKSEARKKGIKVYTSSKVEKIFDEENGGSIVTISKNNETKCIYADKVFISIGRKLNTDVGPISELLEFDGKAIKVDEYLR
    TNVDNVYAIGDVTNKMMLAHVASAQGEAAVDNIFGDNVALDYMKIPAAVFTEPEIGYFGYTEEEAKSKFENVKVGKFYFA
    ANGRAKTYGETKGFAKIISSEDGDVLGAWVVGSDASEIAQIISTSRQSGANAEELKKAIYTHPTRSETIMEAVKDIFKES
    IHKV

    >gi|304317409|ref|YP_003852554.1| Thioredoxin domain [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MQKLNNIDDIKKLISDEKIVLLYFSTNDCGICTTLLPKIEKMLLDYPEISSAHVSIDELPAVSSEFSIFTVPTVLAFIEG
    KEVIREARFISMDILEDKIQKYYNLIFS

    >gi|304317621|ref|YP_003852766.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MSLVGKKAPDFKLDSTKGQISLSDYKGKWVVLFFYPLDFSSVCSTEIPEFNRRKSEFEKLNAEILGINTDSVYSHNAWIE
    SLGGIDYPLISDYNKEVTKQYGILIEEAGIALRAAFIINPDGIIDYEVVHEPVIGRNVDEILRVLNALQTGHACPVGWKP
    GDKVLD

    >gi|304317844|ref|YP_003852989.1| cadmium-translocating P-type ATPase [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MKGSKQTFLLEGLDCAVCAAKIEDNVKKIDGICNANVDLINTKLTVELKDINKINDINKTIKKVVKDVEPNIHISDSEVK
    IVKDKDSRFKWKIMQLLSAAALFILPVIFKLPEYAKFSFFFISYIISGGEIIALSIKKILKGQLFDENFLMSISTIGAFA
    IGKYEEGVSVMLFYQIGTLIEDYAVDNSRKSIKDLMDIRPDYANLKIENNIKKVPPEAVNIGDIILVKPGEKIPLDGKVI
    DGKSFVDTSSLTGEYLPMEVGIGSNVLSGFINKNGLLTVKVEKNFKESTVSKILDLIENAGNKKAQAENFITKFAKYYTP
    IVTLSALFIATIPPLLLNENFSNWIYRALVFLVISCPCALVISIPLSFFSGIGAASKSGILIKGSNYLEALNDVKTIVFD
    KTGTLTEGTFKVTEINAENPLKSDELLKYAAYGEYYSNHPIASSIVNAYGSKIDAGKIKDYVELAGNGIKAIIDDKEILI
    GNSKLMKSHNIAFKNVRPYSAVHIAVDGKYAGYIVISDTIKKDSKDTVKALKSLGVERLIMLTGDKKEISEYISNELGLD
    DVYSELLPDEKVNVVDELCSNTDLKGKVAFVGDGINDAPALTRADVGIAMGKIGTDAAIEAADVVLMTDEPYKLVDAIKI
    AKKTHKIVLENIIFALGVKLSVLTLGALGLATMWEAVFADVGVTVLAVLNSLRILTK

    >gi|304318031|ref|YP_003853176.1| glutaredoxin-like protein protein, YruB-family [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MLSFIKDRSEFEDIRKTEDFFMLMFYSNKSQKSLEALDNLKKFSDKNKDVKVYALNASDVRDIHPEFGVTAVPALITFSG
    GKVQQVVYGIQTEDYYDRLLTTSSVKPSDGSKKYHRVVVYTSPS
    CPWCSATKSYLRQNNIPFREVDVTKNPGAAEELVRR
    SGQRGVPQTDIDGTIVVGFDKSRLNALLGIQG

    >gi|304318132|ref|YP_003853277.1| glucose inhibited division protein A [Thermoanaerobacterium thermosaccharolyticum DSM 571]
    MIYDAGSYDVAVIGLGHAGCEAALATARLGLKTVAFAINLDSIALMPCNPAIGGPAKTNLVREIDALGGQMAINTDETLI
    QERTLNTSKGPAVRALRAQSDKKRYQFNMKYTLEKQENLDIKQAEVVDIEVENGEVKSVITKNGARYL
    CKSCIVTTGTYL
    RGRIIIGDVSYSGGPNGLFPANELSKCLERLNIKLMRFKTGTPARVDKKSINFDAMEIQPGDEKIKPFSYLHDEINVEQI
    PCWLTYTNSRTHEVIMRNIGRSPLYSGEIKGVGPRYCPSIEDKVVKFPDKPRHQLFIEPEGRNTNEMYVQGMSSSMPEDV
    QIEFLRTIKGLENVKVMRPGYAIEYDCIDPTQLKQSLELKTISGLFFAGQVNGTSGYEEAAAQGLMAGINAAMKLLNREP
    FILDRSEAYIGVLIDDLVTKGTNEPYRMLTSRAEYRLILRQDNADFRLTEKGRQIGLVDDERYERFLKKKIQYEKEMERL
    KTAMIVPSDFVNEYLKSKGSSPIVTGITMYDLLKRPEIDYISSKVIDKDRPEDIRDDVAEQIDINIKYEGYIKKQLEQVE
    KFKALENKKIPSWINYDDIKGISIEARQKLKSIMPTSVGQASRISGVSPADISVILIYMQSRR