Thermoanaerobacter tengcongensis MB4 uid57813

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|20806613|ref|NP_621784.1| transporter components [Thermoanaerobacter tengcongensis MB4]
    MDPRLQGLLVGILFGIVLQRGRICFNSAIRDVKMTKDNYLMKLALLAILVETIGFHLAAQLGWIKLNPKPLIPLAQIIGG
    FLFGMGMVLAGG
    CASGVTYRIGEGYITAFIAAIFYGITAAAVKGGPLSFVNRWMGKPITTTNNPGGFYAAKDGAVNLTLA
    NLLNINPWIVTIIFALLLLIVLVFWKTTERKVSGLNWITGGIALGLVGVIAYLSQKTYPLGITGGWVNLFRTTTANLDLT
    QPIPYNWEGMEIVGIIIGAYLAALFAKEFRLRVPKDPKTFVQVAVGGILMGFGAGSAGG
    CNIGHILSGLPHLAISSIVFT
    IFAVLGNWFMVWYLFERK

    >gi|20806614|ref|NP_621785.1| uncharacterized ACR involved in intracellular sulfur reduction [Thermoanaerobacter tengcongensis MB4]
    MHVTIQVNVPPYTNEDMDTAIHLAEALLKRGHKVSIFLFADSVLAANKLVKPMKVDRNIPSKLRELSEKGVEVHICGLCA
    QYRGIGEDMKIEGSDFSGVPEMASLIYNSDRYINLLP

    >gi|20806617|ref|NP_621788.1| dihydrolipoamide dehydrogenase/glutathione oxidoreductase and related enzyme [Thermoanaerobacter tengcongensis MB4]
    MENLHTREYDLAVIGGGPGGYVAAIKAAKKGAKVALFEKDKLGGTCLNRGCIPTKAYARAAEVYGILKKAKEFGFDIQIN
    YFDYAQVVKRKDTIVGELVEGIKALLKANKIEVFNKEAKVDKEKNVIFEGEKIKAKNIIIATGSSPAELPIEGIDSKNVL
    NSDTILEITSLPKSLCIIGGGVIGMEFAFIMNQFGVEVYVVEMMPNILPSLDKKVSSAVKFAAQKRGIKIYTSSTVEKVE
    EEGENSVVTIRSGDDIKKISVDKVFVSIGRKLNTSIGPIVDLLEFDKKAIKVDEHMRTNIEGVWAVGDVTGKMMLAHVAS
    SQGEVAVDNIFGKSRTLDYYKIPAAVFTEPEIGYFGYTEEEAKEKFGEIKVGRFDFKHNGRAKTYGETEGFAKIISTEDG
    EVVGAWVVGSGASELVHIISTACQSGAKAEELKDVVYAHPTKSETIMEAFKDIFKEAIHKI

    >gi|20806791|ref|NP_621962.1| putative peroxiredoxin [Thermoanaerobacter tengcongensis MB4]
    MEEIRMKLLGEKFPSMEVMTTHGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKAEEFKQLNTELIGLSVDQVFS
    HIKWVEWIKDNTGVQIPFPVIADELGRVSNQLGMIHPGKGTNTVRAVFIVDDKGVIRLIMYYPQEVGRNVDEILRALKAL
    QTADQYGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKAKEIEAFDWWFVHKPLK

    >gi|20806820|ref|NP_621991.1| hypothetical protein TTE0299 [Thermoanaerobacter tengcongensis MB4]
    MANLDMKDLERIMGEMGKEIPEVMRAFNQLHHAATKNGALSAKEKELIALGIAVAIRCSYCILAHVNSALQAGATKEEIM
    ETLGVAVLMSGGPGVAYATEAIKVLEQAVK

    >gi|20806821|ref|NP_621992.1| hypothetical protein TTE0300 [Thermoanaerobacter tengcongensis MB4]
    MAIETFKAVSRKLPEGLAVESEVRGFKIVLDEPKELGGTNKGMNPVEALLCALGSCQTIVASAFAKAKGIDLQDFWVELE
    GDLDTDGFMGKPGVRPGFQEIRFKMHIKSNSPKEKIEEFVKFIENTCPVGDSLANPVRLVLSDVVIE

    >gi|20807505|ref|NP_622676.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter tengcongensis MB4]
    MKNKSLIFTIVAIALIGALIFVLNSYTKTAEPTPSKVENQTKSNSSNEERKVGNEIGDIAPDFTLKDLNGNTVTLSSLRG
    KKVILNFWATT
    CPYCKIEMPALDKFIRAHKDDTVLLAIDLGESEAKVRQYLEGKGYQFTVLLDSDLSTAYDYKIQFIPVS
    YFIDKNGVIRAISNGAMTYDEIEEYYKALSE

    >gi|20807605|ref|NP_622776.1| rhodanese-related sulfurtransferase [Thermoanaerobacter tengcongensis MB4]
    MQIEMVTKEELLTMLNNLDVIVLNVLPRDWYEQAHIKGSISIPLEELPNHLNCLSKDKLIVTYCASYECTSCIEAAELLA
    NYGFNVKVYRGGTKEWIEAGLPWESST

    >gi|20807685|ref|NP_622856.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter tengcongensis MB4]
    MAEVVITSKNWEEEVVNSDVPVLIDFWAEWCMPCRLVAPIIEELAKEYEGKIKVGKVNVDEEDELAMKFRIMSIPTIGLF
    KNGKMVGKLIGARPKADFVKFIEKYLNEDTFQKEESLEVEITYDNWEEEVVNSDVPVLIDFWAEW
    CAPCRLVAPIVEELA
    HEYKGRLKVGKVNVDEEQELAMKFRIMSIPTIGLFKKGKMVDKIIGARPKADFVRFIEKHLNN

    >gi|20808004|ref|NP_623175.1| peroxiredoxin [Thermoanaerobacter tengcongensis MB4]
    MVEVGKKAPDFVLPDADGRQVSLSDFLGKNVVLYFYPKDNTPGCTKEAVAFRDSIKTIEDKNAVVIGISLDDEASHRKFI
    EKYSLPFVLLSDKEAKVSTEYGVYKEKNMYGKKKMGIERSTFIIDSKGIVRKIFRKVKVDGHVDQVLKALDEIKEGV

    >gi|20808100|ref|NP_623271.1| dihydrolipoamide dehydrogenase/glutathione oxidoreductase and related enzyme [Thermoanaerobacter tengcongensis MB4]
    MNYDVIVVGGGPGGYTAAIRLSELGKKVALIEEDSLGGTCLNRGCIPTKVYAHAAELVTRIKEAKDFGITAEYTLDIAKL
    RQKKERVVKRLVGGVGYLMNLHHIDVINGKGTFIDKNTVEVNGAKYTAENFIIATGSKVFLPPIEGIDLEGVMTSDKALE
    LEKIPEKIVIIGAGIIGLEFANIYASLGSKVIMIEMLPQLLPMLDRDVVGVMEKALKKQKIELHLNSKVEKIERGLRVIY
    TENGNQESVECDAVLVAVGRVPNVNGVDALNLEMNGRGIKVDSHMRTSIENIYAIGDVTGGIQLAHVASYQGIVAAHNIA
    GEEKEADLTAVPNCLYTNPEVAWVGLNESQAREKYGEVKIGTFPYTALGRAMTMGESDGFVKIIAEGKYGRVVGMEIIGA
    GATEIIHEGVLAIKEEFTLEELADSIHAHPTLSESIKEAAEDALGMPINKG

    >gi|20808143|ref|NP_623314.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter tengcongensis MB4]
    MKELTSIENVENLIRENGMVFFYFSTEDCGICSSLLPKLDKMLESYPKVESFHISIDKMPAASGKFSVFTVPTIIVYVDG
    REAIREARFISMDVLEEKLSKYYSLFFEEST

    >gi|20808289|ref|NP_623460.1| Thiol-disulfide isomerase and thioredoxins [Thermoanaerobacter tengcongensis MB4]
    MVIEVNKDNFDEVVKKEEKLVLIDFWGPKCEQCLALMPEVEKLEQKYADKVKFCKLDASQNRRLCISLKVLGLPTFQLYK
    NGEKVDEISKDVTIEKIEEMIKRHI

    >gi|20808290|ref|NP_623461.1| thioredoxin reductase [Thermoanaerobacter tengcongensis MB4]
    MSTLYDCLIIGGGPAGLSAAIYASRGKLNTVVFERSKIGGQAAITDDIENYPGSVEEATGPKIVKRMREQAESFGTCFVM
    EEVKKVELSEKIKKVITTKGCYEGKTVIIATGAEHMKLNVPGEEEFIGKGVSY
    CATCDADFFTDLDVVVVGGGDSAVQEA
    LYLTKFAKNVTIIHRRDKLRANKCLQDKAFKNPKIKFLWDSVVERIEGDGIVEKVIVRNVKTGELKEVKTDGVFIFIGMK
    PSTEIFKGLIEMDERGYILTDENMRTNIEGVFAAGDCRAKLLRQIVTAAADGAIAAVAAERYIEELEC

    >gi|20808293|ref|NP_623464.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Thermoanaerobacter tengcongensis MB4]
    METDVLVIGGSAGGILAALSVKKTYKDKKVTVIRMAERVMVPCGIPYIFGTLKDTSKNVIPDSMLTNAGVELVIDEVVSI
    DRQNKKVSTRKNGDISYKKLILATGSLPIVPTFIPGYDLDNVFTIKKDEEYLKFVQQKINEAEDVVVVGGGFIGVEMAEQ
    VQLLGKNVTIIEVADKLLWQAFDPEFSDMAEAKLKEHGIKVLTGTKVTKFIGEKEVKEVEIHTGERIKADVVIVAMGVKP
    NTKLAEEAGIKLNEKGAITVDEYMRTNDPDIFAVGDCAEKKCFFTRKNVPILLASIAANEAKIAGVNAFELRLVRENKGT
    ISAFSTKIYNTAFAAAGLTETQARAEGFDIVIGEFNTIDKHPGTLPNTMNVKIKLIFSRYSGVILGAQLAGGDNVGEMIN
    ILSLAIQKGTTASELTTFQVATHPLLTSSPVSYPISSAALDALSKI

    >gi|20808403|ref|NP_623574.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Thermoanaerobacter tengcongensis MB4]
    MLNYDIVIIGGGPAGLGAAVEAYEKGVKNVVILERDKYLGGILQQCIHNGFGLQEFKEELTGPEYAQRFIDKVEEYGIDV
    MLDTMVLEITPDRIVKAVNSEKGVFQIKAKAIILAMGCRERPRGAIMIPGTRPAGIMTAGTAQRYVNMEGYMPGKEIVIL
    GSGDVGLIMARRLTLEGAKVKAVVEIMPYSSGLTRNIVQCLEDFDIPLLLSHTVVEIHGKDRVEGVTIAKVDENREPIME
    TAQYISCDTLILSVGLIPENELSKQAGIELDPVTGGPVVNEMLETSVPGIFACGNVLQVHDLVDNVTAEARMAANSAIRF
    IREGGFKKSNISVKAGKGIRYVVPQRINVDNIDKRIKFRMRPTDVYNNAILAVKSGDRYLLRQKRIRLTPGEMIDVNLSK
    EILKNADEKEGIVFLVEEG

    >gi|20808569|ref|NP_623740.1| peroxiredoxin [Thermoanaerobacter tengcongensis MB4]
    METEAIENIPRVCLPQIGAPAPDFKANSTFGPIKLSDYRGKWVVLFSHPGDFTPVCTTEFIAFTQVYTSFVERNVQLIGL
    SVDSNPSHLAWVENIYKTTGVEIPFPIIEDKDMRIAKLYGMISPAETSTSAVRAVFIIDDKQILRLILYYPLEIGRNIQE
    IIRIIDALQTVDKYKVLAPANWYPGMPVIVPPPKTYPELKQRLKNVEGYTCTDWYLCYKKV

    >gi|20808597|ref|NP_623768.1| thioredoxin reductase [Thermoanaerobacter tengcongensis MB4]
    MYDLIILGGGPAGLTAGLYAARSRLKTVLIEKTYLGGQIVNTYQLENYPGYEEITGADLVAKMEAQVRKHGLEIVLEDVE
    SLDITGEIKRVKTANNKVYEAKAIILAMGATPRKLGVPNEDRFIGAGISF
    CATCDGAFYRDAVVAVIGGGNTAVEDALYL
    TKFAKKVYIIHRRDQLRATKIEQEKAFANEKIEFIWNTVVVDVEGEYGVERIRLKNVKTGEESTLNVDGVFVAIGYDPNT
    ELVKGIVELDEYGYIITDDDMKTNIPGVFAAGDIRHKLLRQVITAAGDGATAAYAAEKYIESLKK

    >gi|20808818|ref|NP_623989.1| cation transport ATPase [Thermoanaerobacter tengcongensis MB4]
    MAEKANLKITGMSCAACATKIEKGLKSLDGVLDANVNLAVEKATVIYDPDKINICDIEKKIEDIGYGVIKDKVELALMGM
    S
    CASCAAKIEKTLKNLPGVSNASVNFAAETAIVEYDSNEIDTEKMIKAIKDIGYDAKEKTGVGIDTEKEIKEREINTLRK
    LVIYSAILTVPLVISMVLRMFKISGGILDNPWLQVFLSSPVQFIVGFRYYKGAWNNLKNMTANMDTLVAMGTSAAYFYSL
    YNVFTKPSHEIHNYLYFEASAVIITLVTLGKLLEAIAKGKTSEAIKNLMGLQAKTARVIRDGQELDIPIEEVKVGDIVVV
    RPGEKIPVDGKIVEGSSTIDESMITGESIPVEKGVGDEVIGATINKTGTFKFEATKVGKDTVLSQIIKMVEDAQGSKAPI
    QQIADKISGIFVPTVIAIAATTFLIWYFGYGDFNAGIINAVSVLVIACPCALGLAVPTSVMVGTGKGAENGILIKGGEHL
    QRAGKITAIVFDKTGTITKGEPEVTDIVTFGDFTEDEILKIAGIAEKNSEHPLGQAIVNKAKEKFKILEDPEKFEAVPGY
    GICITINEKEFYIGNRRLMDRQNIDITSIEDKVEELELQGKTAMILASHDRVYGIIAVADTVKSDSAKAIQKLQAMGIEV
    YMITGDNKRTAEAIAKQVGIKNVLAEVLPEHKALEIMKLQKMGKVVAMVGDGINDAPALATADVGIAIGTGTDVAIETSD
    ITLLSGNLMGIVTAIKLSKATMRNIYQNLFWAFVYNTIGIPFAAMGLLTPAIAGGAMAFSSVSVVTNALRLRRFKV

    >gi|20808873|ref|NP_624044.1| methylated DNA-protein cysteine methyltransferase [Thermoanaerobacter tengcongensis MB4]
    MIVKFFLCKFTFYFKNDKGEFYMIYKRFNSPVGVLTVFSSGKGICKIEFENEKFPLEDFEEGTDFYIEECIKELDLYFQK
    RLKNFDVKLDLQGTKFQMAVWEETLKIPYGSVVTYGEIARRIGKPKAARAVGQALNKNSIPIIIP
    CHRVIGSDGNLTGFG
    GGIEIKKFLLKHEGVKIGG

    >gi|20809019|ref|NP_624190.1| glutaredoxin-like protein [Thermoanaerobacter tengcongensis MB4]
    MEHFEEIRSKEDDIFMLMFYSNSSQKSLEALEVMKKFSEDNPKVPVYVVNASEVKDIHPQFGIKVVPSVILFKEKEPWQF
    VFGLQSKEYYEKLLVVSPTKSSDGKERKPLRVTVYVSPS
    CPWCNATKAYLRQHNIPFREIDVTKNPAAAAELVRRTGQRG
    VPQTDINGTIVVGFDKAKLNQLLGITEQ

    >gi|20809045|ref|NP_624216.1| uncharacterized NAD(FAD)-dependent dehydrogenase [Thermoanaerobacter tengcongensis MB4]
    MPKRYVIIGGDAAGMSAASQIRRMDKEGEVLVFEKEGVISYAQCGLPYWVGGVVSEKKKLIARTAEEFLNRYNIDVKLYH
    EVVKIDPSKKEIKVFRREEKDEIAVPYDVLLIGTGSTAIVPPWEGRNLPGVFTLKTMGDAEKLLDWLSSHTPTKAVVIGG
    GYIGLETAEALHSRGFKVTVLDLAPQLIPTFDKEIAEIAQDALTRHGVEVHLNEEVVGLEGDEKGVKAVVTKNGKFEADL
    VIISIGVRPVSELAKEAGIELGPKNAILVNERLETSIPDIYAAGDCATHFNRIKNAPDYIPLGTTANKQGRIAGINMAGG
    DAKFAGVVGTAIVKVFDRTIARSGLGERDCEALGIPYQVVLIKARPVSHYYPWEDEILTIKLCYHKDNRKLLGGQIAGGL
    GGVDKRIDVLATALFHEMTIDELQALDLAYAPPYNSVWDPLQQASTVAQRG