Thermoanaerobacter pseudethanolicus ATCC 33223 uid58339

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|167036545|ref|YP_001664123.1| YruB family glutaredoxin-like protein [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MLEFIKDTQHFEEVKNKEEFFMLMFYSNSSQKSLEALEVMKKFSEDNPKVPVYVVNASEIRDIHPQYGIKVVPSVILFKD
    KEPWQFVFGLQSKEYYEKLLVVAPSKASDGKGLKAHRVTIYTTPS
    CPWCNATKAYLRQHNIPFREIDVSKNPSAAAELVR
    RSGQRGVPQTDIDGTIVVGFDKAKLNRLLGITEQ

    >gi|167036637|ref|YP_001664215.1| methylated-DNA--protein-cysteine methyltransferase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MLYKKFISPVGVLTIFSSGKGICRIDFENEKSSLEGFKEGSDFYIEECIRQLDLYFQKKLKNFDVRLDLQGTEFQKAVWK
    EILKIPYGEVKTYGEIARLIGKPKAARAVGQALNKNPIPIIIP
    CHRVIGSSEDLTGFGGGIEIKKFLLRHEGVEVH

    >gi|167036705|ref|YP_001664283.1| heavy metal translocating P-type ATPase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MQNNNKSFILKGLDCASCAAKIEEGVKRIEGVTYANCDFVNSKLSVEIDDSYELEKTIKELKKLVKNIEPNVEIIEYENE
    KIKDDNELLRRGIRYGISAILFTVALIFNLSVYVKFTLFFISYIIVGGEVILTAGKKILKGQVFDEHFLMSIATIGAFVI
    GEYPESVAVMLFYQIGELLQDIAVDRSKRSIKELMNIRPDYANLKIGYEIKRVSPQEVRPGDVIIVKPGEKIPLDGKVIE
    GESMVDTSALTGESVLKEVYKGADVLSGFINKNGLLTIEVTREFAESTVSKILGLIEEASSKKAPTEKFMTKFAKYYTPI
    VVFLALIIAVIPPLIIPAATFKEFIYRALIFLVISCPCALVLSIPLTFFAGIGAASKNGILVKGSNYLEALSNVETVVFD
    KTGTLTKGVFKVTKIKSVNGMSRDALLEYAAYAESFSNHPIAESILKAYGKEVDRSKIKKYEEISGNGVRANIEGKEVLV
    GNAKLMKMGNIDCVTGDSTGTIIHVAIDNKYCGYILISDEVKEDSPKAIESLRKMGIKRIVMLTGDNKAISDKIAASLRI
    DEVYSELFPNEKVGILEKLYANNKKGKLIFVGDGINDAPVLARADVGVAMGGIGSDVAIEAADVVLMTDEPSKLVTAIKI
    SKKTKLIVWENILLALGVKIVVLALGALGVPTMWEAVFADVGVALLAVLNALRVLTGAV

    >gi|167036709|ref|YP_001664287.1| copper-translocating P-type ATPase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MAEKANLKITGMSCAACATKIEKGLKSLDGVLDANVNLAIEKATVIYDPDKINICDMEKKIEDIGYGVIKDKVELALMGM
    S
    CASCAAKIEKTLKNLPGVSNASVNFATETATVEYDSNEIDTEKMIKAIKDIGYDAKEKTGVGIDTEKEIKEREINTLRK
    LVIYSAILTVPLVLSMFLVMFKVPGGILENPWLQVFLSSPVQFIVGLRYYKGAWNNLKNMTANMDTLVAMGTSAAYFYSL
    YNVFTKPSHEIHNYLYFEASAVIITLVTLGKLLEATAKGKTSEAIKNLMGLQAKTARVIRDGQELDIPIEEVKVGDIVVV
    RPGEKIPVDGKIVEGSSTIDESMITGESIPVEKGVGDEVIGATINKTGTFKFEATKVGKDTVLSQIIKMVEDAQGSKAPI
    QQIADKISGIFVPTVMGIAATTFLIWYFGYGDFNAGIINAVSVLVIACPCALGLAVPTSVMVGTGKGAENGILIKGGEHL
    QRAGKITTIVLDKTGTITKGEPEVTDIEAFGNFTEEEILKIAGIAEKNSEHPLGQAIVNKAKEKFKILEVPEKFEAIPGY
    GICITINEKEFYIGNRRLMDRQNIDITPIEDKLVNLEIQGKTSMILASKDCVYGIIAVADTVKSDSAKAIKELQAMGIEV
    YMITGDNKRTAEAIAKQVGIKNVLAEVLPEDKAEEVAKLQKMGKVVAMVGDGINDAPALATADVGIAIGTGTDVAIETSD
    ITLISGNLMGIVTAIKLSKATMRNIYQNLFWAFIYNTIGIPFAAMGFLTPAIAGGAMAFSSVSVVLNALRLRRFREG

    >gi|167036870|ref|YP_001664448.1| thioredoxin reductase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MYDLIILGGGPAGLTAGLYAARSRLKTVLIEKTYLGGQIVNTYQLENYPGYEEISGADLIAKMEAQVRKHGLEIVNEDVE
    SLDITGDVKKVKTSNKTYEAKAIILAMGATPKKLGVPNEDRFIGAGISF
    CATCDGAFYRDATVAVIGGGNTAVEDALYLT
    KFAKKVYIIHRRNELRATKIEQEKAFANEKIEFIWDTVVVDVEGEYGVERLKLKNVKTGEESTLNVDGVFVAIGYAPNTE
    LVKGIVDLDEYGYIMTDDDMRTNIPGVFAAGDIRHKSLRQVITAAGDGAIAAYVAEKYIDSLKK

    >gi|167036961|ref|YP_001664539.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MLNYDIVIIGGGPAGLGAAVEAYEKGVKNIVIIERDKYLGGILEQCIHNGFGLQEFKEELTGPEYAQRFIDKVEEYDINV
    MLETMVLEITPDRIVKAVNSKEGVFTIKAGAIILAMGCRERPRGAIMIPGTRPAGILTAGTAQRYVNMEGYLPGKEIVIL
    GSGDVGLIMARRLTLEGAKVKAVVELMPYSSGLTRNIVQCLEDFNIPLLLSHTVIEIHGKDRVEGVTIAKVDENREPIME
    TAQYISCDTLILSVGLIPENELSQKAGIELDPITGGPIVNEMLETSVPGIFACGNVLQVHDLVDNVTAEARLAANSAIRF
    IREGEFGKSNIAVKAGNGIRYVVPQKINVDNIEKRIKFRMRPVNVYNNAMLAVKSGDKYLLRQKRQRLTPGEMIDVNLSK
    DILKNANLEEGIVFLVEEG

    >gi|167037068|ref|YP_001664646.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    METDVLVIGGSAGGILAALSAKKTYKDKKVTVVRMGERVMVPCGIPYIFGTLKDTSKNVIPDAMLTNAGIDLIIDEVLSI
    DRENKKVNAKKSGEISYKKLILATGSLPIVPTFIPGHDLENVFTIKKDEEYLKFVQQKINEAQDVVVIGGGFIGVEMAEQ
    VQLLGKNVTIIEVADKLLWQAFDHEYSDMAEATLKEHGITIKTNTKVTKLVGDTKVKEVELDTGEKIKADVVILAMGVKP
    NTKLAEAAGIKLNEKGAITVDEYMRTNDPDIFAVGDCAEKKCFFTRKNVPILLASTAANEAKIAGVNVFQLRLVRENKGT
    ISAFSTKIYNTAFAAAGLTETQAKAEGFDIVIGEFSTMDKHPGTLPNAKSVKIKLIFSRYSGVILGAQIAGGENVGEMIN
    ILSLAIQKGTTASELNTFQVATHPLLTSSPVSYPINSAALDAMSKI

    >gi|167037164|ref|YP_001664742.1| redox-active disulfide protein 2 [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MDIKILGMGCAKCKALEENTKAALQELGIEAEVEKVQDLNKIIEYVMITPALVINEEVKVAGRVATKDEIKKYIEEYTK

    >gi|167037176|ref|YP_001664754.1| thioredoxin domain-containing protein [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MEKIIDIENIEQIIKENDMVFLYFSTQDCGICTSLLPKLEGMLVNYPKIKSFHIPIDEIPLASGKFSVFTVPTVIVYVDG
    KEAIREARFISMDTLEEKISKYYSLFFEETA

    >gi|167037200|ref|YP_001664778.1| dihydrolipoamide dehydrogenase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MMKEGFLRLSVEINKKINQASIHSKRRIKMDYDVIVLGGGPGGYTAAIRLSELGKKVAVVEEYSLGGTCLNRGCIPTKVY
    SHAAELINAIKDAKDFGIMAQYAVDIAKLRQKKERVVKRLVGGVGYLMNLHHIDVIKGRGRFVDENTIEVDKRYTAENFI
    IATGSKVFLPPIEGINLEGVITSDKALELERIPEKIVIIGAGIIGLEFANIYSALGSKVVIIEMLPQLLPMLDRDIADTM
    EKILRHKKFELHLNSKVEKIEEGLKVVYTTEGNTQVVECDTVLVAVGRVANVNGIEALNLDMDKKGIKVDSHMRTSIKNI
    YAIGDVTGGIQLAHVASYQGIVAAHNIAGEEKEADLSIVPNCLYTNPEIAWAGLNEVQAREKFGDVKIGTFPYTALGRAM
    TMGQNDGFVKIIAEAKYNRVVGMEIIGAGATEIIHEGVLAIKEEFTLEELADAIHAHPTLSESVKEAAEDALGMPINKG

    >gi|167037310|ref|YP_001664888.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MVELNKKAPDFTLNTHDGKQVSLSDFLGKKVVLYFYPKDNTPGCTKEAVSFRDNIKSIEEKNAVIIGISLDDEISHKKFI
    EKFNLPFILLSDKDANVSTKYGVYKEKNMYGKKKMGIERSTFIIDSEGIVRKIFRRVKVDGHVEEVLKVLDEI

    >gi|167037407|ref|YP_001664985.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MKNKSLIFTIIAVIVIGALIFVLNNYTKSVQPAPSQVAENNSPSNNEDQNTSSNVNSNTTEQSEPKIGNQVGDIAPDFTL
    KDLDGNTVTLSSLRGKKVILNFWATT
    CPYCIIEMPALNQFIKSHKDDTVLLAIDLGESPSKVKQYLEGKGYEFTVLLDTD
    LSTIYDYQVQFIPMSYFIDKNGIIRAISNGAMTYDEIEEYYKSISR

    >gi|167037408|ref|YP_001664986.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MKPVNVTDETFAEEVYNSNKPVLVDFWAKWCRPCLMMAPVLEEFAEEYADKMKVAKLDVDENPVIASKYRIMSIPTMGVF
    VNGKMVDKVIGFMPKEHLVEKLSKYLK

    >gi|167037452|ref|YP_001665030.1| thioredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MAELVITLENFEQEVVNSDVPVLIDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVDEENELAMKFRIMSIPTIGLF
    KNGKMVDKIIGARPKADFVRFIEKHLNGGATQSEESDEVEITYDNFEEEVVNSDVPVLIDFWAEW
    CAPCRLVAPIIDELA
    KEYKGKIKVGKVNVDEENELAMQFRIMSIPTIGLFKNGKMVDKIIGARPKADFVKFIEKHLNN

    >gi|167038369|ref|YP_001665947.1| OsmC family protein [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MAIETFKAVSRKLPEGLAVESEVRGFKIILDEPKELGGTNKGMNPVEALLCALGSCQTIVAAAFAQAKGINLQGFWVELE
    GDLDTDGFMGKAGVRPGFQEIRFKMHIKTDAPKEKVEEFAKFIENTCPVGDSLANPVKLVLSDVIVE

    >gi|167038370|ref|YP_001665948.1| dihydrolipoamide dehydrogenase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MEIEIKIPALSDTMKSGRITKWYVEEGQYVEKDSCLCDIAVNKVNFEVYSDYEGIISKIVCPAGSTVEPGDVIAIVTQSE
    EVKPSATQKEIKYEYKEYDLAVIGAGPGGYVAAIKAAKKGAKVALFEKDKLGGT
    CLNRGCIPTKAYARIAEVYDILKRSG
    EFGFDVKVNSFDYAKIVKRKNDIVGELTEGINALLKANGVDLFYAEAKVDKEKNVLFGENKIKAKNIIIATGSSPAELPI
    EGINSKNVMNSDVILEITSLPQSLCIIGGGVIGMEFAFIMNQFGVKVSVVEMMPDILPILDKEVSSFIRAVAQRRGIKIY
    TSSTVERIDEEENGGSIVTVKNGENIKRIYADKVFVSIGRKLNTDIGPIVELLDFEGKAIKVDEYMRTNVEGVYAVGDVT
    GKMMLAHVASAQGEVAVDNIFGESNTLDYMKIPAAVFTEPEIGYFGYTEEEARKKFKDIKVGRFNFEHNGRAKTYGETEG
    FAKVISNEKGEVVGVWVVGSGASELIHILSTACQEGVDAEALKKAVYAHPTRSETIMEAVKDIFGESVHKV

    >gi|167038390|ref|YP_001665968.1| putative peroxiredoxin [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFSHIKWV
    EWIKDNTNIAIPFPVIADDLGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKALQTADQ
    YGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK

    >gi|167038501|ref|YP_001666079.1| electron transport complex, RnfABCDGE type, A subunit [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MNIFIILINTIFVNNYVFARFLGICPFLGVSNKTETATGMGMAVTFVITLSSVITYIIHHAILVPLNLEYLQTIVFILVI
    ASLVQFVEIFLKKTSPNLYSALGIYLPLITTN
    CIVLGVAILNIQEGYTLFETIFNALGASIGFAIALLLMAGIREKLEII
    DVPKALEGVPITLITAGLISIAFLGFNGLV

    >gi|167038502|ref|YP_001666080.1| electron transport complex, RnfABCDGE type, E subunit [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MKLSKVFYNGLVKENPIFVQALGMCSVLAVTTSAINGLAMGLAVTAVLVGSNLVVSLLRKVIPDKIRIPAFIVVIATFVT
    VVEMFMKAYTPDLYNALGIFIPLIVVN
    CIILGRAEAFASKNSLLHSIVDGLGMGAGYTLAVLILGSIREILGSGSLFGIQ
    LFGASFEPALIFIMPPGAFIVLGILIGIFNYVRKRKEASETGVREEVLDEYIYNID

    >gi|167038536|ref|YP_001666114.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MEKKREYYDVVVIGGGPAGMTAAIYCGRARLKTLLIEKSLVGGLATYTSEIENYPGFPEGIGGLELMKLFEQQTKRFGVQ
    IKLTDVKGLRIEEDYKVVSTFRVDYYAKAVIIATGGKPRLTGAKGEENFLYDKGISF
    CATCDAAYYTDKKVMIIGSGDAA
    IEEGIFLTKFAREVHVSVLHDEGIMDANKVAQEKALKNEKMIFHWNTMVEAFEGNERLERVVLKNLKTGELIPVDVDGCF
    LFIGYVPNTEIFKGLIDMTPKGYIITNENMETNIDGVYAVGDVRDKFLKQVATAVGDGAIAGVMAEKYIEETDYFTNEIL
    KAKETVLAYVYNAVEAKDREYLMKVEEFHKKYADKLKMCRIDTYKSDRLAKRLYCEKVPCIAVLKEGKVVKHIYNLEDFE
    KELLSCI

    >gi|167038537|ref|YP_001666115.1| protein of unknown function DUF395, YeeE/YedE [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MKSQEHPLSPLFKKIIKDPWSYWIGAALLALLNIALFAFSGHPWGVTTTFSYWGAWIFKALGGHPETWTYFQNPSHAKAL
    TESVFTNAGSVQNIGIIIGAFLATLLASQFKIKKIKSYRQVIAAILGGLLMGYGARIAFG
    CNAGAYFSGIPSMSLYGWVW
    AVFGLIGAWIGSKLLVKYFM

    >gi|167038539|ref|YP_001666117.1| protein of unknown function DUF395, YeeE/YedE [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MQSPQLAVRWAFGIAFGFVLQKSRFCFTASFRDPILTGSTSITRAVIVGLMIATIGFAAIQYNAYLRGEPIPGNISPVGI
    HTAIGATMFGIGMVIAGG
    CASGTLMRVGEGYMMQWLSLIFFIIGSLWGARDFGWWTEMFIAKSPKVFLPDVFGWGVAFFG
    QLILLGLLFILAEWYEHKRFNA

    >gi|167038631|ref|YP_001666209.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermoanaerobacter pseudethanolicus ATCC 33223]
    MAKRYVIVGGDAAGMSAASQIRRQDPEGEIIVFEKEGVISYAQCGLPYFVGGVVAEKKKLIARTAEDFHSRYNIDVRLYH
    EVLQFKPQDKQVRVYRRQEKEEIIVPYDVLLIGTGSAAIVPPWEGRDLPGVFTLKTMGDAEKLLAWLEEHTPTKAVVIGG
    GYIGLETAEALHTRGFKVTVLDLAPQLIPTFDAPIAEIVQDTLKRHGVEVYLNEEVVGLEGDEKGVRAVVTKNGSFPADL
    VIISIGVRPVSELAREAGIELGPRNAILVNERLQTNISDIFAAGDCATHFHRIKNAPDYVPLGTTANKQGRIAGVNMAGG
    YARFAGIVGTAIVKVFDRTIARSGLSEKECDALGVPYQTVSIKARPISHYYPWEDEVLTLRLHFHRDNRKLLGGQIAGGG
    GVDKRIDVLATALFHGMTIDDLQALDLAYAPPYNSVWDPLQQAATVVQRGKE