Thermoanaerobacter mathranii A3 uid49481

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297543628|ref|YP_003675930.1| protein of unknown function DUF395 YeeE/YedE [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MEAVKKSKKKKANQFPYGVALLVVIVIIGIILSKQSTKLAVYWAFGIAFGFVLQKARFCFTASLRDPVLTGSTSLTRAVI
    VAFMIATIGFAAIQYNAYLRGEAIPGNIAPVGIHTVIGATMFGIGMVIAGG
    CASGTLMRVGEGFMMQWLSIIFFIIGSLW
    GARDFGWWTKVSIAKSPKVFLPDVFGWGVAFFGQLILLGLLFILAEWYEYKRFNAKN

    >gi|297543630|ref|YP_003675932.1| protein of unknown function DUF395 YeeE/YedE [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MNFQEHPFFKKIIKDAWSYWTGAVLLGLLNIALFAFSGHPWGITTTFSYWGAWIFRALGGHPETWTYFQNPSHAKALTQS
    VFTNTGSVQDIGIILGAFLATLLASQFKIKKIKSHKQVVAAILGGLLMGYGARIAFG
    CNIGAFFSGVSSMSLHGWVYTVF
    ILIGAWIGSKLLVKYFM

    >gi|297543631|ref|YP_003675933.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MEKKKEYYDVVVIGGGPAGMTAAIYCGRARLKTLLIEKSLVGGLATYTSEIENYPGFPEPIAGLELMKLFEQQTKRFGVQ
    IKLTDVKGLRIEEDYKVVSTFRVDYYAKAVIIATGGKPRLTGAKGEENFLYDKGISF
    CATCDAAYYTDKKVMIIGSGDAA
    IEEGIFLTKFAREVHVSVIHDEGIMDANKVAQEKALKNEKMIFHWNTMVEAFEGNERLERVVLKNLKTGELIPVDVDGCF
    LFIGYVPNTEIFKGLINMTPKGYIITNENMETNIDGVYAVGDVRDKFLRQVATAVGDGAIAGVMAEKYIEETDYFTNEIL
    KAKETVLAYVYNAVEAKDREYLMKVEEFHKKYADKLKMCRIDIYKSDRLAKRLYCEKVPCIAVVKEGKVAKHIYDLEDFE
    KELLSCI

    >gi|297543665|ref|YP_003675967.1| electron transport complex, RnfABCDGE type, E subunit [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MKLSKIFSNGLVKENPIYVQALGMCSVLAVTTSAINGLAMGLAVTAVLVGSNSVVSLLRKVIPDKIRIPAFIVVIATFVT
    VVEMFMKAYTPALYNALGIFIPLIVVN
    CIILGRAEAFASKNNLLTSVMDGLGMGAGYTLAVLILGSIREILGSGSLFGIQ
    LFGASFEPALIFIMPPGAFIVLGILIGLFNHARRRKEVSETGTKEEVLDEYIYNID

    >gi|297543666|ref|YP_003675968.1| electron transport complex, RnfABCDGE type, A subunit [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MNIFIILINTIFVNNYVFARFLGICPFLGVSNKTETATGMGMAVTFVITLSSVITYIIHHAILVPLNLEYLQTIVFILVI
    ASLVQFVEIFLKKTSPNLYGALGIYLPLITTN
    CIVLGVALLNIQEGYTLIETIFNALGASIGFAIALLLMAGIREKLEII
    DVPKVLEGVPIALITAGLISIAFLGFNGLV

    >gi|297543799|ref|YP_003676101.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MEEIRMKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFS
    HIKWVEWIKDNTNIAIPFPVIADDLGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKAL
    QTADQYGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK

    >gi|297543824|ref|YP_003676126.1| dihydrolipoamide dehydrogenase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MDIEIKVPAFSDTMKSGRITKWYVEEGQYVEKGACLCDIAVNKVNFEVYSDYEGIISKIVCHPGSTVEPGDVIAIVTQSE
    EVKPSVTQKEIKYEYKEYDLAVIGAGPGGYVAAIKAAKKGAKVALFEKDKLGGT
    CLNRGCIPTKAYARIAEVYDILKRAG
    EFGFDVKVNSFDYTQVVKRKDGIVGELVEGINALLKANGVDLFYAEAKVDKEKNVLFGENKIKAKNIIIATGSSPAELPI
    EGINSKNVMNSDTILEMTSLPQSLCIIGGGVIGMEFAFIMNQFGIKVSVVEMMPDILPTLDKEVSSFIRAIAQKRGIRIY
    TSSTVERIDEEENGGSIVTVKNGENIKRIYADKVFVSIGRKLNTDIGPITELLEFEGRAIKVDKHMRTNVEGVYAIGDVT
    GKMMLAHVASAQGEVAVDNIFGESSTLDYMKIPAAVFTEPEIGYFGYTEEEARNKFQEVKVGRFNFEHNGRAKTYGETEG
    FAKVISNEKGEVVGAWVVGSGASELIHILSTACQEGVNAEALKKVVYAHPTRSETIMEAVKDIFGESIHKV

    >gi|297543825|ref|YP_003676127.1| OsmC family protein [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MAIETFKAVSRKLPEGLAVESEVRGFKIILDEPKELGGTNKGMNPVEALLCALGSCQTIVASVFAKAKGINLQDFWVELE
    GDLDTDGFMGKAGVRPGFQEIRFKMHIKTDAPKEKVEEFAKFIEKTCPVGDSLANPVKLVLSDVIVE

    >gi|297544386|ref|YP_003676688.1| redox-active disulfide protein 2 [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MNIKILGMGCAKCKALEENTKAALQELGIEGEVEKVQDLNKIIEYVMITPALVINEEVKVAGRVATKDEIKKYIEEYTK

    >gi|297544474|ref|YP_003676776.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MKNKSLIFTIIAVIVIGVLIFVLNNYTKSAQPFHSQVAENNISSNNEDQNTSSNANSNSTEQSEPKIGNQVGDIAPDFTL
    KDLDGNTVTLSSLRGKKVILNFWATT
    CPYCKIEMPALNQFIKNHKGDTVLLAIDLGESPSKVKQYLEGKGYEFTVLLDTD
    LSTIYDYQVQFIPMSYFIDRNGVIRAISNGAMTYDEIEEYYKSISQ

    >gi|297544518|ref|YP_003676820.1| thioredoxin [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MAEVVITLENFEEEVVNSDVPVLVDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVDEENELAMKFRIMSIPTIGLF
    KNGKMVDKIIGARPKGDFVKFIEKHLNN

    >gi|297544915|ref|YP_003677217.1| dihydrolipoamide dehydrogenase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MKEGFLRLSVEINKKINQASIQTKRRIKMDYDVIVLGGGPGGYTAAIRLSELGKKVAVVEEDSLGGTCLNRGCIPTKVYS
    HAAELINAIKDAKDFGIMTQYTLDIAKLRQKKDRVVKRLVGGVGYLMNLYHIDVIKGRGRFVDENTIEVDKRYTAKNFII
    ATGSKVFLPPIEGINLKGVITSDKALELEKIPEKIVIIGAGIIGLEFANIYSALGSQVVIIEMLPQLLPMLDRDIANTME
    KILRHKKIELHLNSKVEKIEEGLKVIYTTEGNTQVVECDTVLVAVGRAANVNGIEALNLDTDKKGIKVDSHMRTSIKNIY
    AIGDVTGGIQLAHVASYQGIVAAHNIAGEEKEADLDAVPNCLYTNPEIAWVGLNEVQAREKLKDVKIGTFPYTALGRAMT
    MGQNDGFVKIIAETKYNRVVGMEIIGAGATEIIHEGVLAIKEEFTLEELADTIHAHPTLSESIKEAAEDALGMPINKG

    >gi|297544953|ref|YP_003677255.1| Thioredoxin domain protein [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MVKIIDIENIEQIIKENDIVFLYFSTQDCGICTSLLPKLEKMLANYPKIKSFHIPIDEIPLASGKFSVFTVPTVIVYVDG
    KEAIREARFISMDTLEEKISKYYSFFFGETA

    >gi|297545059|ref|YP_003677361.1| copper-translocating P-type ATPase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MAKKANLKITGMSCAACATKIEKGLKSLDGVLDANVNLTVEKATVIYDSDKIDIRDIEKKIQDIGYGVIKDKVELALMGM
    S
    CASCAAKIEKKLKNLPGVSNASVNFATETAIVEYDSNEIDTEKMIKAIKDIGYDAKEKTGVGIDTEKEIKEREINTLRK
    LVIYSAILTVPLVISMVLRMFKISGGILDNPWLQVFLSSPVQFIVGFRYYKGAWNNLKNMTANMDTLVAMGTSAAYFYSL
    YNVFTKPSHEIHNYLYFEASAVIITLVTLGKLLEAIAKGKTSEAIKNLMGLQAKTARVIRDGQELDIPIEEVKVGDIVVV
    RPGEKIPVDGKIIEGSSAVDESMITGESIPVEKGVGDEVIGATINKTGTFKFEATKVGKDTVLSQIIKMVEDAQGSKAPI
    QQIADKISGIFVPAVIGIAATTFLIWYFGYGDFNAGIINAVSVLVIACPCALGLAVPTSVMVGTGKGAENGILIKGGEHL
    QRAGKITAIVLDKTGTITKGEPEVTDIVAFGDFTEDEILKIAGIAEKNSEHPLGQAIVNKAKEKFKTLEEPEKFEAIPGY
    GICITINEKEFYIGNRRLMDRQNIDITSIEDKVTELESQGKTAMILASRDRVYGIIAVADTVKSDSAKAIQKLQAMNIEV
    YMITGDNKKTAEAIAKQVGIKNVLAEVLPENKAEEVAKLQKMEKVVAMVGDGINDAPALATADVGIAIGTGTDVAIETSD
    ITLISGNLMGIVTAIKLSKATMKNIYQNLFWAFIYNTIGIPFAAMGFLTPAIAGGAMAFSSVSVVLNALRLRRFRGDNS

    >gi|297545062|ref|YP_003677364.1| copper ion binding protein [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MGWFGPKGETIILNVKGMTCNHCKMSVESALKKLNGVSKAVVDLDKGNVTVTYDPSKVSIDDMKKAIIDTGYEV

    >gi|297545074|ref|YP_003677376.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MIETDVLVIGGSAGGILTALSAKKTYRDKKVTVVRMTEKVMVPCGIPYIFGTLKDTSKNVIADTMLTNAGIDIIIDEVVS
    IDRENKKVNAKKSGEIYYKKLILATGSLPIVPTFIPGHDLENVLTIKKDEEYLKFVQQKINEAQDIVVIGGGFIGVEMAE
    QVQLLGKNVTIIEVADKLLWQAFDPEYSDMVEATLKDHGITVKTNTKVTKLVGDTKVKEVELDTGEKIKADVVILAMGVK
    PNTKLAEEAGIKLNEKGAIVVDEYMRTNDPDIFAVGDCAEKKCFFTRKNVPILLASTAANEAKIAGVNVFQLRLVRENKG
    TISAFSTKIYNTAFAAAGLTERQAKAEGFDIVVGKFNTMDKHPGTLPNAKNVNIKLIFSRYSGVILGAQIAGGENVGEMI
    NILSLAIQKGTTASELNTFQVATHPLLTSSPVSYPINSAALDAMSKI

    >gi|297545187|ref|YP_003677489.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MLNYDIVIIGGGPAGLGAAVEAYEKGVKNIVIIEKDKYLGGILQQCIHNGFGLQEFKEELTGPEYAQRFIDKVEEYGINV
    MLETMVLEITPERIVKAVNSRDGVFQIKAGAIILAMGCRERPRGAIMIPGTRPAGILTAGTAQRYVNMEGYLPGKEIVIL
    GSGDVGLIMARRFTLEGAKVKAVVELMPYSSGLTRNIVQCLEDFNIPLLLSHTVIEIHGKDRVEGVTIAKVDENREPIMD
    TAQYISCDTLILSVGLIPENELSKQAGVELDPITGGPIVNEMLETSVPGIFACGNVLQVHDLVDNVTAEARLAANSAIRF
    IREGEFGKSSINVKAGNGIRYVVPQKINVDNIEKRIKFRMRPVSVYTNATLAVKSGDKYLLRQKRQRLTPGEMIDVNLSK
    DILKNSNLEEGIVFLVEEG

    >gi|297545286|ref|YP_003677588.1| thioredoxin reductase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MYDLIILGGGPAGLTAGLYAARSRLKTVLIEKTYLGGQIVNTYQLENYPGYEEISGADLVAKMEAQVRKHGLEIVNEDVE
    SLDITGDVKKVKTSNKTYEAKAIILAMGATPKKLGVPNEDRFIGAGISF
    CATCDGAFYRDATVAVIGGGNTAVEDALYLT
    KFAKKVYIIHRRNELRATKIEQEKAFANEKIEFIWDTIVVDVEGEYGVERLKLKNVKTGEESTLNVDGVFVAIGYAPNTE
    LVKGIVDLDNYGYIMTDDDMRTNIPGVFAAGDIRHKSLRQVITAAGDGATAAYVAEKYIDSLKK

    >gi|297545421|ref|YP_003677723.1| Heavy metal transport/detoxification protein [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MGLFGAKGGTIVINVKGMTCNHCKMSVENALKKLNGVFKLC

    >gi|297545490|ref|YP_003677792.1| methylated-DNA/protein-cysteine methyltransferase [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MIYKKFVSPIGILTIFSSGKGICRIDFENEKSSLEGFKEGSDSYIEECMHQLGLYFCKELKKFNLQIDLQGTDFQKAVWR
    EISKIPYGEVKTYGEIAKLIGKPKAARAVGQALNKNPIPIIIP
    CHRVIGSKGDLVGFGGGIEIKKFLLRHEGVEV

    >gi|297545584|ref|YP_003677886.1| glutaredoxin-like protein, YruB-family [Thermoanaerobacter mathranii subsp. mathranii str. A3]
    MLEFIKDAKHFEEIKNKEELFMLMFYSNSSQKSLEALEVIKKFSEDNPKVPVYVVNASEIRDIHPQYGIKVVPSVILFKD
    KEPWQFVFGLQNKEYYEKLLVVAPSKVSDGKGQKVHRVTVYTTPS
    CPWCNATKAYLRQHNIPFREIDVSKNPSAAAELVR
    RSGQRGVPQTDIDGTIVVGFDKAKLNQLLGITDQ