Thermoanaerobacter italicus Ab9 uid46241

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|289577339|ref|YP_003475966.1| protein of unknown function DUF395 YeeE/YedE [Thermoanaerobacter italicus Ab9]
    MEAVKKSKKKKANQFPYGVVLLVVIVIIGIILSKQSTKLAVYWAFGIAFGFVLQKARFCFTASLRDPVLTGSTSLTRAVI
    VAFMIATIGFAAIQYNAYLRGEAIPGNIAPVGIHTVIGATMFGIGMVIAGG
    CASGTLMRVGEGFMMQWLSIIFFIIGSLW
    GAKDFGWWTKVSIAKSPKVFLPDVFGWGVAFFGQLILLGLLFILAEWYEYKRFNAKN

    >gi|289577341|ref|YP_003475968.1| protein of unknown function DUF395 YeeE/YedE [Thermoanaerobacter italicus Ab9]
    MNFQEHPFFKKIIKDAWSYWTGAVLLGLLNIALFAFSGHPWGITTTFSYWGAWIFRALGGHPETWTYFQNPSHAKALTQS
    VFTNTGSVQDIGIILGAFLATLLASQFKIKKIKSHKQVVAAILGGLLMGYGARIAFG
    CNIGAFFSGVSSMSLHGWVYTVF
    ILIGAWIGSKLLVKYFM

    >gi|289577342|ref|YP_003475969.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thermoanaerobacter italicus Ab9]
    MEKKKEYYDVVVIGGGPAGMTAAIYCGRARLKTLLIEKSLVGGLATYTSEIENYPGFPEPVAGLELMKLFEQQTKRFGVQ
    IKLTDVKGLRIEEDYKVVSTFRVDYYAKAVIIATGGKPRLTGAKGEENFLYDKGISF
    CATCDAAYYTDKKVMIIGSGDAA
    IEEGIFLTKFAREVHVSVIHDEGIMDANKVAQEKALKNEKMIFHWNTMVEAFEGNERLERVVLKNLKTGELIPVDVDGCF
    LFIGYVPNTEIFKGLIDMTPKGYIITNENMETNIDGVYAVGDVRDKFLRQVATAVGDGAIAGVMAEKYIEETDYFTNEIL
    KVKETVLAYVYNAVEAKDREYLMKVEEFHKKYANKLKMCRIDIYKSDRLAKRLYCEKVPCIAVVKEGKVAKHIYDLEDFE
    KELLSCI

    >gi|289577378|ref|YP_003476005.1| electron transport complex, RnfABCDGE type, E subunit [Thermoanaerobacter italicus Ab9]
    MKLSKIFSNGLVKENPIYVQALGMCSVLAVTTSAINGLAMGLAVTAVLVGSNSVVSLLRKVIPDKIRIPAFIVVIATFVT
    VVEMFMKAYTPALYNALGIFIPLIVVN
    CIILGRAEAFASKNNLLTSVMDGLGMGAGYTLAVLILGSIREILGSGSLFGIQ
    LFGASFEPALIFIMPPGAFIVLGILIGLFNHARRRKEVSETGTKEEVLDEYIYNID

    >gi|289577379|ref|YP_003476006.1| electron transport complex, RnfABCDGE type, A subunit [Thermoanaerobacter italicus Ab9]
    MNIFIILINTIFVNNYVFARFLGICPFLGVSNKTETATGMGMAVTFVITLSSVITYIIHHAILVPLNLEYLQTIVFILVI
    ASLVQFVEIFLKKTSPNLYGALGIYLPLITTN
    CIVLGVAILNIQEGYTLIETIFNALGASIGFAIALLLMAGIREKLEII
    DVPKVLEGVPIALITAGLISIAFLGFNGLV

    >gi|289577487|ref|YP_003476114.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacter italicus Ab9]
    MEEIRMKLLGEKFPSMEVVTTQGVKRLPEDYAGKWFVLFSHPADFTPVCTTEFVEFARKANDFKELNTELIGLSVDQVFS
    HIKWVEWIKDNTNIAIPFPVIADDLGKVSNQLGMIHPGKGTNTVRAVFIVDDKGTIRLIMYYPQEVGRNVDEILRALKAL
    QTADQYGVALPEKWPNNYLIKDHVIVPPSTDEASANERKEKIKSKEIEAFDWWFVHKPLK

    >gi|289577514|ref|YP_003476141.1| dihydrolipoamide dehydrogenase [Thermoanaerobacter italicus Ab9]
    MDIEIKVPAFSDTMKSGRITKWYVEEGQYVEKGACLCDIAVNKVNFEVYSDYEGIISKIVCHPGSTVEPGDVIAIVTQSE
    EVKPSVTQEEIKYEYKEYDLAVIGAGPGGYVAAIKAAKKGAKVALFEKDKLGGT
    CLNRGCIPTKAYARIAEVYDILKRAG
    EFGFDVKVNSFDYTQVVKRKDGIVGELVEGINALLKANGVDLFYAEAKVDKEKNVLFGENKIKAKNIIIATGSSPAELPI
    EGINSKNVMNSDTILEMTSLPQSLCIIGGGVIGMEFAFIMNQFGIKVSVVEMMPDILPTLDKEVSSFIRAIAQKRGIRIY
    TSSTVERIDEEENGGSIVTVKNGENIKRIYADKVFVSIGRKLNTDIGPITELLEFEGRAIKVDKHMRTNVEGVYAIGDVT
    GKMMLAHVASAQGEVAVDNIFGESSTLDYMKIPAAVFTEPEIGYFGYTEEEARNKFQEVKVGRFNFEHNGRAKTYGETEG
    FAKVISNEKGEVVGAWVVGSGASELIHILSTACQEGVNAEALKKVVYAHPTRSETIMEAVKDIFGESIHKV

    >gi|289577515|ref|YP_003476142.1| OsmC family protein [Thermoanaerobacter italicus Ab9]
    MAIETFKAVSRKLPEGLAVESEVRGFKIILDEPKELGGTNKGMNPVEALLCALGSCQTIVASVFAKAKGINLQDFWVELE
    GDLDTDGFMGKAGVRPGFQEIRFKMHIKTDAPKEKVEEFAKFIEKTCPVGDSLANPVKLVLSDVIVE

    >gi|289578113|ref|YP_003476740.1| redox-active disulfide protein 2 [Thermoanaerobacter italicus Ab9]
    MNIKILGMGCAKCKALEENTKAALQELGIEAEVEKVQDLNKIIEYVMITPALVINEEVKVAGRVATKDEIKKYIEEYTK

    >gi|289578193|ref|YP_003476820.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermoanaerobacter italicus Ab9]
    MKNKSLIFTIIAVIVIGALIFVLNNYTKSAQPFHSQVAENNISSNNEDQNTSSNANSNSTEQSEPKIGNQVGDIAPDFTL
    KDLDGNTVTLSSLRGKKVILNFWATT
    CPYCKIEMPALNQFIKNHKGDTVLLAIDLGESPSKVKQYLEGKGYEFTVLLDTD
    LSTIYDYQVQFIPMSYFIDKNGVIRAISNGAMTYDEIEEYYKSISQ

    >gi|289578238|ref|YP_003476865.1| thioredoxin [Thermoanaerobacter italicus Ab9]
    MAEVVITLENFEEEVVNSDVPVLVDFWAEWCMPCRMVAPIIDELAKEYEGKIKVGKINVDEENELAMKFRIMSIPTIGLF
    KNGKMVDKIIGARPKGDFVKFIEKHLNN

    >gi|289578695|ref|YP_003477322.1| dihydrolipoamide dehydrogenase [Thermoanaerobacter italicus Ab9]
    MDYDVIVLGGGPGGYTAAIRLSELGKKVAVVEEDSLGGTCLNRGCIPTKVYSHAAELINAIKDAKDFGIMTQYTLDIAKL
    RQKKDRVVKRLVGGVGYLMNLYHIDVIKGRGRFVDENTIEVDKRYTAKNFIIATGSKVFLPPIEGINLKGVITSDKALEL
    EKIPEKIVIIGAGIIGLEFANIYSALGSQVVIIEMLPQLLPMLDRDIANTMEKILRHKKIELHLNSKVEKIEEGLKVVYT
    TEGNTQVVECDTVLVAVGRAANVNGIEALNLDMDKKGIKVDSHMRTSIKNIYAIGDVTGGIQLAHVASYQGIVAAHNIAG
    EEKEADLDAVPNCLYTNPEIAWVGLNEVQAREKLKDVKIGTFPYTALGRAMTMGQNDGFVKIIAEAKYNRVVGMEIIGAG
    ATEIIHEGVLAIKEEFTLEELADTIHAHPTLSESIKEAAEDALGMPINKG

    >gi|289578719|ref|YP_003477346.1| Thioredoxin domain protein [Thermoanaerobacter italicus Ab9]
    MVKIIDIENIEQIIKENDIVLLYFSTQDCGICTSLLPKLEEMLANYPKIKSFHIPIDEIPLASGKFSVFTVPTVIVYVDG
    KEAIREARFISMDTLEEKISKYYSFFFGETA

    >gi|289578839|ref|YP_003477466.1| copper-translocating P-type ATPase [Thermoanaerobacter italicus Ab9]
    MAKKANLKITGMSCAACATRIEKGLKSLDGVLDANVNLAVEKATVIYEPDKINIRDMEKKIQDIGYGVIKDKVELALMGM
    S
    CASCAAKIEKTLKNLPGVSNASVNFATETANVEYDSNEIDIEKMIKAIKDIGYDAKEKTGVGIDTEKVIKEREINTLRK
    LVTYSAILTVPLVISMILRMFKISAGILDNPWLQIFLSSPVQFIVGFKYYKGAWNNLKNMTANMDTLVAMGTSAAYFYSL
    YNVFTKPSHEIHNYLYFEASAVIITLVTLGKLLEAIAKGKTSEAIKNLMGLQAKTARVIRDGQELDIPIEEVKVGDIVVV
    RPGEKIPVDGKIIEGSSAVDESMITGESIPVEKGVGDEVIGATINKTGTFKFEATKVGKDTVLSQIIKMVEEAQGSKAPI
    QQIADKISGIFVPAVIGIAATTFLIWYFGYGDFNAGIINAVSVLVIACPCALGLAVPTSVMVGTGKGAENGILIKGGEHL
    QRAGKITAIVLDKTGTITKGEPEVTDIVAFGDFTEDEILKIAGIAEKNSEHPLGQAIVNKAKEKFKTLEEPEKFEAIPGY
    GICITINEKEFYIGNRRLMDRQNIDITSIEDKATELESQGKTAMILASCDRVYGIIAVADTVKSDSAKAIQKLQAMGIEV
    YMITGDNKRTAEAIAKQVGIKNVLAEVLPENKAEEVAKLQKMGKVVAMVGDGINDAPALATADVGIAIGTGTDVAIETSD
    ITLISGNLMGIVTAIKLSKATMKNIYQNLFWAFIYNTIGIPFAAMGFLTPAIAGGAMAFSSVSVVLNALRLRRFRGNNS

    >gi|289578858|ref|YP_003477485.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thermoanaerobacter italicus Ab9]
    MIETDVLVIGGSAGGILTALSAKKTYRDKKVTVVRMTEKVMVPCGIPYIFGTLKDTSKNVIADTMLTNAGIDIIIDEVVS
    IDRENKKVNAKKSGEISYKKLILATGSLPIVPTFIPGHDLENVLTIKKDEEYLKFVQQKINEAQDIVVIGGGFIGVEMAE
    QVQLLGKNVTIIEVADKLLWQAFDPEYSDMVEATLKDHGITVKTNTKVTKLVGDTKVKEAELDTGEKIKADVVILAMGVK
    PNTKLAEEAGIKLNERGAIVVDEYMRTNDPDIFAVGDCAEKKCFFTRKNVPILLASTAANEAKIAGVNVFQLRLVRENKG
    TISAFSTKIYNTAFAAAGLTERQAKAEGFDIVVGKFNTMDKHPGTLPNAKNVNIKLIFSRYSGVILGAQIAGGENVGEMI
    NILSLAIQKGTTASELNTFQVATHPLLTSSPVSYPINSAALDAMSKI

    >gi|289578977|ref|YP_003477604.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Thermoanaerobacter italicus Ab9]
    MLNYDIVIIGGGPAGLGAAVEAYEKGVKNIVIIERDKYLGGILQQCIHNGFGLQEFKEELTGPEYAQRFIDKVEEYGINV
    MLETMVLEITPERIVKAVNSRDGVFQIKAGAIILAMGCRERPRGAIMIPGTRPAGILTAGTAQRYVNMEGYLPGKEIVIL
    GSGDVGLIMARRFTLEGAKVKAVVELMPYSSGLTRNIVQCLEDFNIPLLLSHTVIEIHGKDRVEGVTIAKVDENREPIME
    TAQYISCDTLILSVGLIPENELSQKAGIELDPITGGPIVNEMLETSVPGIFACGNVLQVHDLVDNVTAEARLAANSAIRF
    IREGEFGKSSINVKAGNGIRYVVPQKINVDNIEKRIKFRMRPVSVYNNATLAVKSGDKYLLRQKRQRLTPGEMIDVNLSK
    DILKNTNLEEGIVFLVEEG

    >gi|289579099|ref|YP_003477726.1| thioredoxin reductase [Thermoanaerobacter italicus Ab9]
    MYDLIILGGGPAGLTAGLYAARSRLKTVLIEKTYLGGQIVNTYQLENYPGYEEISGADLVAKMEAQVRKHGLEIVNEDVE
    SLDITGDVKKVKTSNKTYEAKAIILAMGATPKKLGVPNEDRFIGAGISF
    CATCDGAFYRDATVAVIGGGNTAVEDALYLT
    KFAKKVYIIHRRNELRATKIEQEKAFANEKIEFIWDTIVVDVEGEYGVERLKLKNVKTGEESTLNVDGVFVAIGYAPNTE
    LVKGIVDLDNYGYIMTDDDMRTNIPGVFAAGDIRHKSLRQVITAAGDGATAAYVAEKYIDSLKK

    >gi|289579242|ref|YP_003477869.1| Heavy metal transport/detoxification protein [Thermoanaerobacter italicus Ab9]
    MGLFGAKGETIVINVKGMTCNHCKMSVENALKKLNGVFKLC

    >gi|289579349|ref|YP_003477976.1| methylated-DNA/protein-cysteine methyltransferase [Thermoanaerobacter italicus Ab9]
    MLYKKFISPVGVLTIFSSGKGICRIDFENEKSSLEGFKEGSDSYIEECIHQLDLYFGKELKKFNLRIDLQGTDFQKAVWR
    EISKISYGEVKTYGEIAKLIGKPKAARAVGQALNKNPIPIIIP
    CHRVIGSKGDLVGFGGGIEIKKFLLRHEGVEV

    >gi|289579440|ref|YP_003478067.1| glutaredoxin-like protein, YruB-family [Thermoanaerobacter italicus Ab9]
    MLEFIKDAKHFEEIKNKEELFMLMFYSNSSQKSLEALEVIKKFSEDNPKVPVYVVNASEIRDIHPQYGIKVVPSVILFKD
    KEPWQFVFGLQNKEYYEKLLVVAPSKVSDGKGQKVHRVTVYTTPS
    CPWCNATKAYLRQHNIPFREIDVSKNPSAAAELVR
    RSGQRGVPQTDIDGTIVVGFDKAKLNQLLGITDQ

    >gi|289578842|ref|YP_003477469.1| copper ion binding protein [Thermoanaerobacter italicus Ab9]
    MGWFGPKGETIIINVKGMTCNHCKMSVESALKKLNGVSKAVVDLDKGNVTVTYDPSKVSIDDMKKAIIDTGYEV