Thermanaerovibrio acidaminovorans DSM 6589

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269791721|ref|YP_003316625.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Thermanaerovibrio acidaminovorans DSM 6589]
    MAGSDSKRVVVVGGVACGAKAASRLRRLKPHWDVTIIERSDTLSYAACGMPFFLEGAVPDFKELLSTPAGVIRDANFFRN
    VKGIQVLTNHLALEVDRAAKVVRAVDSSTGERKEIPYDKLVLATGASPVVPDLPGVDLAGVSPLWTPRNALEIRCALDSG
    NVSRAVVVGAGLVGLEAAEAMAKRGIKVTVVELLDRPLAALLDGEFGAALAKAIRSYGVEFVPCCRVMGFEGEGGSLRRV
    ITDKGDFDAQLALVSVGVRPNSQLAADSGLEIGPTGGIKVDSHMMTSDPDVYAGGDCVETFNTVTGRPVRQPMGSTANRH
    GRVIADNLVGMGTCFNGVIGTAVMRFFNHTVGRTGLSEQAAREAGFDPVGVTVTDPDRPHFMAGSAPVVLRILADRNSRR
    VLGAQLIGTGQVDKRLDTLACAVYGGMTVDMLADMDHAYAPPFSSALDVLTHGANHLRNRLDGLVETVRPSEVAALVEQG
    AVLLDVRGPGEVEAQGQLPFDGILAIPLGQLDKRIQELPRGRKVIAY
    CKVSVRGWDAVSILRKHGFQDVAVLEGGVVGWP
    FNLRK

    >gi|269791767|ref|YP_003316671.1| NADH dehydrogenase (quinone) [Thermanaerovibrio acidaminovorans DSM 6589]
    MAVKMHILVCGGTGCISSQSDRLAEALKEALAKRGLAEEVKVVLSGCFGFCEQGPIVKVAPDNTFYVKVTPEDADEIVAE
    HILKGRKVTRLLYKDPKTAHEVSDSKHMDFYKKQMRIALRNCGFIDPENVNEYIARDGYEALGKVLTSMKPQDVIAEVKK
    SGLRGRGGGGFPTGLKWEIASRFSADQKYVICNADEGDPGAFMDRSILEGDPHSVIEAMAICGYAIGATKGMVYIRAEYP
    LAVKRLQKAIEDAREVGLLGKDILGSGFDFDVELRYGAGAFVCGEETALIQSLEGNRGEPVSKPPFPAERGFYGKPSNVN
    NVETFACVPPIILKGADWFASIGTEKSKGTKVFALAGKVNNVGLVEVPMGITLREVIYDIGGGIRDGRKFKAVQTGGPSG
    GCLTEKHLDTPIDFDTLLEAGSMMGSGGMIVMDEDNCMVSVAKFYLEFTVEESCGKCTPCRVGNRRMLEMLDKICQGKAT
    RDDLNRLRELALIIKDTSL
    CGLGQTAPNPVLSTLDNFFDEYLAHVEEKRCPAGKCKDLVRYVIDPEKCKGCTLCAKVCPA
    DAISGKVREPHVIDQDKCVKCGACYTACKFGAISRS

    >gi|269791771|ref|YP_003316675.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Thermanaerovibrio acidaminovorans DSM 6589]
    MDRTVEVLIAGGGPGGRVSYMALWNMGVRSIAMVADEPPTVICSLPYSVGRRLIPNGPCAVAVDLENSHRLPKEIAQDVI
    WGSVRSVDHALRTARVETRDGEVTVRYRKLILAQGAAPWIPDVPGVLAGEGSSGPTVMVGDRLLPRDALAPNVKVLRGLQ
    DAKDLDQMAKSAKRAVVVGSGAIGLEVAEALHQRGLSVTVVEVLPHAVAALDEDMAAVLENKLLQNGIDLKVGLTVSEVL
    RDGILLSDGSKLEAELVVFASGVRPRLDLARSLGLKVDRGVVVDGRMMTSLEDVYAVGDMAQLTDAATGLPLLPLIGTLA
    MRQAMVAAMNVAGMPAQLPPVTTWGVSQVFDLHWGSVGWTVEAARRCGVEAVGVRIPVRSRDPFMEGRDGAWKITVAMGG
    PGVTPGQIIGFQVLTEGDNPVHLAERFIDVVASRSTVQDLFARYFIHSPSHNSVDDPYLGLMMEARRLMEQPRG

    >gi|269791791|ref|YP_003316695.1| hypothetical protein Taci_0173 [Thermanaerovibrio acidaminovorans DSM 6589]
    MNFKNRRLWAVLAVIMVLSAALLMKVFERRREAVEGLTFEVSARSEIERALSSGLPVMIDFGSEYCGPCRAMESELIWAE
    ALVRGKGIILFADVWKDSSLAEGFPLRVIPTQFFFNRDGTPLAVPKDDQLGLFEYRDGSGRHVYTIHEGPLTSHQILGLF
    RLMGVDVE

    >gi|269791794|ref|YP_003316698.1| redox-active disulfide protein 2 [Thermanaerovibrio acidaminovorans DSM 6589]
    MEIQILGTGCPKCKKLTEMAEQAARELGLEFTIRKVSDINEIMEFGVMSTPGLAVDGKVLTAGQLPTYERVKDLLSRL

    >gi|269791865|ref|YP_003316769.1| hypothetical protein Taci_0249 [Thermanaerovibrio acidaminovorans DSM 6589]
    MNKAGGLLTSRLGPVITGVAVGVLAPLLVHLGNPGNMGICVACFTRDIAGGLGLHRAAVVQYLRPEIPGILLGALGASLV
    FGEMRPRAGSSPIIRFFLGFFAMVGALIFLGCPWRAYLRLAAGDLTAVAGIAGLIAGIALGIYFLWNGFNLGRSRPATRA
    TGYVMPVAMLGLLALLVASPLMGRTPDGDPTGPIFFSAQGPGAMHASVAISLVAGLLIGWMAQRSRFCTVGAFRDLMMLK
    DPHLFWGIGALVVTAVITNLALGQFKLGMEGQPVAHANHLWNFLGMVLSGLAFTLAGG
    CPGRQVIMAGEGDSDASVFVLG
    MLVGAAFAHNFTLASTPKGPSPYVMGAWALGMAFCVAVGFLNRNENV

    >gi|269791960|ref|YP_003316864.1| electron transport complex, RnfABCDGE type, E subunit [Thermanaerovibrio acidaminovorans DSM 6589]
    MASFIERIRGGLAKENPVFVQAIGLCPTLAVTTSAVNGLGMGVAATAVLMGSNVVISMLRRFIPNQIRIPAFIVVIAGFV
    TIIQFLVSAYAPVLDKSLGIFIPLIVVN
    CIILARAEAFAFKNGVIPSLFDGIGMGLGFTVALMILGSIREIIGAGTLFGF
    HVLPGYVQPALVMILAPGGFLTMGLIMGFLNYRRDLARRRRPGGTDLIDADSDADRLEKQTACAGCQICSVLRTEDDGR

    >gi|269791961|ref|YP_003316865.1| electron transport complex, RnfABCDGE type, A subunit [Thermanaerovibrio acidaminovorans DSM 6589]
    MSLIAIFLGAVFVHNIILSQFLGCCPFLGVSSRLETAKGMGMAVIFVVFMASLITWLLYHFVLVPMGLQYLYTLSFILVI
    ASLVQLVEMALKKLNPALYKSLGIFLPLITTN
    CAVLGVAVINMNKGYGLISSMVNAVGASVGFLLALILMAGLRERIDAS
    DTMPRCMRGLPIALVTASLMAVAFMGFAGLI

    >gi|269791966|ref|YP_003316870.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Thermanaerovibrio acidaminovorans DSM 6589]
    MAKRRVLIVGADAAGMSAASQLRRLDRDVEILAFERGSYTSYSACGIPYLVAGLIKDPRRLISRTPEEFASSGIEVRTLS
    EVVQVDPEARRVTVQHRGGTYQEDYDQLLIATGAKPLRPQVEGIDSPGVFGVNTLDSGIELMRAVEDRRPRRAVIIGGGY
    IGLEVAEALNCHRGIQVTVVERARTVMGTLDPDMGELVGKALEDVGIQLRAQEALSSVESSGGWVKGVWTDRGFIEADLV
    VLGLGVVPNSDLAERSRIPLGVRNSIQVDLTMRTAVDGVWAAGDCAQNYHMLTKRPFYVAMGTSANKMGRVAGMNLAGRH
    QEFQGVLGTAVCKICKYEVGRTGLSEREAAELGLDFVAASAADETRAGYYPGSGDITVKLLALRGSGAIVGGQIVGIEGA
    AKRIDVIATAIRGGLTAEDLVAMDLSYAPPFSPVWDPVQVAARVLLKHL

    >gi|269792113|ref|YP_003317017.1| Methyltransferase type 11 [Thermanaerovibrio acidaminovorans DSM 6589]
    MGDIRDEVRRKYAEAIAGGCCCASGGCCSGGGPDVITGGNYRPEDLPPLLRDMDVPTFGCGNPIAIGSLKPGEVVLDLGS
    GAGLDVMLAALKVGPSGRVYGLDMTDEMLARAEENRRRAGLENVIFIKGHMEEIPLPDRSVDVVISNCVVNLSPDKGRVF
    REAFRVLRHGGRLAISDVVLLRPLPEAVLRSVSAWTG
    CIAGALPVEEAERQVRIAGFEDVDVRVVKVYSFSPSEARGLFP
    HLSDDELPLVDGAAGSALITGRKG

    >gi|269792224|ref|YP_003317128.1| heavy metal translocating P-type ATPase [Thermanaerovibrio acidaminovorans DSM 6589]
    MQEGVRRTYRVSGMTCATCARMLQRSLSRVEGVIFASVDLATETALVISSDDVPEGVLLKAAESAGYPMVPFDQAPDVEE
    GRYRRVIRDLAASLGLSLPVWINMVHHMVLHGGGLIPRWLEVVLGFGAVFLGGRGIFRGAYIAVSHLHANMDVLIGLGAA
    AGWITGLVNLLAPEVPSFLPVGTMMVALHLLGRFIESHLRDRASKKVKGLLNLKARTARVVRDGVEEILPEEMLREGDLV
    RLLPGERVPADGVVLEGESALDESFITGESKAVHKRPGDQLTSGSVNLNGVLLMEAQRVGDDSFVSQMVRMVRESQGART
    PIQALADRVTMYFVPGVLLLALVSALAWHLGFPIMDGLRTRVAGLVGLGGGQVPWPWLYAAMATLVIACPCALGLATPMA
    LAVATGEASSLGVLIRDGEAFQELGKVDVVVFDKTGTVTHGRPRVVDHSLPPWALSAVLSLEARSSHPIAKGVCAFLTDL
    GVQQVPVEDQAEEPGRGVVGTVDGVRWFVGRPDGDRWDSWSREGLTVVEVRRDREVVGALALRDPLREDAKRVIEELVSR
    GIRPMMATGDSQEVASRVAAELGLQDWSFRMRPQDKLQLVNRLQSQGMRVAMVGDGINDAASLKGANVGIAMGSGLDLAI
    ESADLVLVRGGLYGVVGAVDVSRSLTRIIAQNLAGAFIYNVLFIPMAMVGLMHPMLAELAMLCSSITVIINSLRIRARR

    >gi|269792230|ref|YP_003317134.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Thermanaerovibrio acidaminovorans DSM 6589]
    MTEQIKVGDQVRDFTLKDQDGNDVTLSSLRGKKVLLSFHPLAWTPICRDQMKALDDLYDRFVAKGVEPLGLSVDPIPSKK
    AWADSMGIRSLKLLSDFWPHGAVADSLGLFIEKHGFSGRANVLVDEEGRVQWVKVYELKTLPDFEEVLNLL

    >gi|269792346|ref|YP_003317250.1| methylated-DNA/protein-cysteinemethyltransferase [Thermanaerovibrio acidaminovorans DSM 6589]
    MSTDRMSKCHIETPLGTLEITESGGSITSVRLANPLPGEEALPPTGSVLGSAALQLKQYFAGERREFSLPLRLLGTPFQV
    RVWRRLISIPYGRTATYGELARDMGMPRGARAVGGACGRNPLLILIP
    CHRAVGARSLGGFSAPGGLKTKELLLQIERNRS
    GG

    >gi|269792403|ref|YP_003317307.1| glutaredoxin-like protein, YruB-family [Thermanaerovibrio acidaminovorans DSM 6589]
    MMQVKVFSTKTCPWCVKAKDYLKSLNVSYEDVDVSANREAAMEMVRATKQMGVPVIQIGEKYIVGFDQGAIEKSLREAGI
    I

    >gi|269792422|ref|YP_003317326.1| selenide, water dikinase [Thermanaerovibrio acidaminovorans DSM 6589]
    MRLTERAKTSGCAAKIGPAELDTILRGLPSRRDPNLLSGWDNGEDAALWRIGEGRLAILTVDFITPIVDDPLTFGEIAAA
    NSLSDVFAMGGSPKVALNLVAFPTSCEPLEVLSQILEGGARKVMEAGACLAGGHSVQDEEPKYGLSVYGEVDEGGLWRVT
    GAREGDSLILTKPVGSGIITTASKGGVAEGDWLDQAVQWMRMLNNVPGRMDRSLLGNVRAATDVTGFGLLGHCMDMLSHR
    ELDLVIHHDQVPFIDGAFQMASMGMVPAGAYSNRGHVEHRVLMSPNVPLAVQDILFDPQTSGGLLLAVAPGSEKEVLSQL
    WELGFHRAATVGRFIKGEGKVLVE

    >gi|269792434|ref|YP_003317338.1| thioredoxin reductase [Thermanaerovibrio acidaminovorans DSM 6589]
    MERRELVILGAGPAGLTAAIYGRRAGLDVLIIERGMPGGQITITDEIENWPGVQHASGQELADSFRRHAEKFSPEFRDAT
    VTSLEVRDGRKVVVTDKGEVEAEAVIIATGANFKRLGCPGEAEYTGRGVSY
    CAVCDGAFFEGEEVAVIGGGNTAVEEACY
    LTQFASKVYIVHRRDSFRADKVPVERAMSNPKIVPIFDSVVEAIEGGDMVERLVLWNVKTQEVSTLPVSGVFIFVGTAPN
    SGFASSLVETSPGGWIKTNSRMETSVEGIFAAGDVRDTFLRQVVTAAGDGAVAAMSAYSYITEQLHLQKILLEPPRVNAL
    FYSSIDQEQVRLVGRVEEWASSKNVQVTLVDGYRNLRMMEKLGVRELPTAMVLKEGREVSRASVTSEEDLGLFLEL

    >gi|269792746|ref|YP_003317650.1| selenoprotein B, glycine/betaine/sarcosine/D- proline reductase family [Thermanaerovibrio acidaminovorans DSM 6589]
    MAYRIVHYLNQFFGGLGGEDKADITPVKKDGPVGPGAALKAALGSEAEVVGTVICGDGYFAEHMDEATDQILEMIKSFSP
    DGVVLGPAFNAGRYGTACGAVGEAVAKRLGIPVVGGMYPENPGVEMYRKSFPIVRTSDNARGIKDAVPAMARIVLKLLKG
    EPLGSPEEEGYIERGIRVNLFRDEVGAERAVEMLVRKLKGEQYTTEYPMPVFDRVPPAAAIKDLKNATIALVTSGGIVPK
    GNPDHIEASSATKYGEYSIEGVSSVTAEGYATAHGGYDPTYANSDPNRVLPVDVLRQMESQGVFKRLYPYFYTTVGNGTP
    VANAKRFGQEIASKLKKDGVDAVILTST
    CGTCTRCGATMVKEIERAGIPVVHVCTIVPISLTVGANRIVPAVAIPHPLGD
    PTKTHEEEVAIRRRLVEAALRALQTEVSDQTVFANN

    >gi|269792747|ref|YP_003317651.1| glycine reductase complex selenoprotein A [Thermanaerovibrio acidaminovorans DSM 6589]
    MGKLAGKKLILLGERDGVPGPAMEACLKDCGAEIAFAVTECFVCTAAGAMDLQNQQRVKDIAEKFGAENVVVVLGSSDAE
    GAEIYAETVTAGDPTYAGPLAGVSLGLPVYHIFDPEIKSEADPAQWEEQVSMMEMVLDPEALTEAVRKMREAHSQYTL

    >gi|269792749|ref|YP_003317653.1| Thioredoxin domain protein [Thermanaerovibrio acidaminovorans DSM 6589]
    MVEVNKDNYEAEVLQSSLPVVVDFWGPSCGPCLALMPEVVKMGEEFEGKVKFCKLNAAENRRLCASLKVMGLPTFLFYKG
    GELVDRITGAEVTLEAIRDRANKLIG

    >gi|269793187|ref|YP_003318091.1| UBA/THIF-type NAD/FAD binding protein [Thermanaerovibrio acidaminovorans DSM 6589]
    MSEIRYLSLAEVEEFAASRGIPRREAELALLAQGACPERYRRNVGTLGLEGQRRLLESQVAVVGCGGIGGYVVEMLARVG
    VGRLRLADGDVFCENNLNRQLLCREGDLGLPKVRAAAIRVREVNRAVEVEEFFGYVDEANVMDFIAGCSVVVDGLDNGST
    RRTLSRACLEAGIPLVHGAIGGFYAQVGVSLGGPLGRFIAAMPDRGEEV
    CLGNPPFTPALAASLEVCEAVKLLTGVSEVL
    ADQLLWADLKGHCFMRLNP

    >gi|269791653|ref|YP_003316557.1| DSBA oxidoreductase [Thermanaerovibrio acidaminovorans DSM 6589]
    MEVFFDFACPYCYLVWSFLGRLGMLEGDLKWSPWMIRPDVPQGGLRRRWPLLDELRRLGSDAEVPFAELEIIPNTRRALL
    AYLWADQRGLSREALKATFLGFFAQGRDIGDPRELCALYAEGGLPDPSQAFEDVALMERLGQLDVRAEAIGVEVVPSFVE
    GDRVVLSWRTSFVMKDLAEFMRGRGI