Teredinibacter turnerae T7901 uid59267

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|254784278|ref|YP_003071706.1| antioxidant, AhpC/TSA family protein [Teredinibacter turnerae T7901]
    MTLQHIIDAIEASPRPLQAKLDALKEAFETQLAPPEVVSIMQRATQALVDSRQAESALKAGNRVPQFNLPDSNGEPYSLQ
    HLLNKGPLVLTFYRGIW
    CPYCNFDLRALEESRLDLESRGAQLVAVSQQTAANSRKSKEANHLGFPILVDTKGDLGHQFGL
    RWQVPEDLKAVHKQLGADLEVFNGESSWTLPMPARYVIDQDGVIVYSEVNPDYTRRPDPSELLAVLDGLKKVKSRV

    >gi|254784381|ref|YP_003071809.1| methylated-DNA-(protein)-cysteine S-methyltransferase [Teredinibacter turnerae T7901]
    MNDKRFQSPEARWQAIQMRDSHADGHFVYGVRTSGIYCAPSATARQPKRENVEFFDTAAAAEAAGYVASRRERGARPEAA
    SERAAAVARACRLIERGEASTPLGELAANVGMSPYHFHRTFKAETGLTPKAYSSAFRANKLREQLQQAKGSITDAIYDAG
    FNANSRFYESANQLLGMPAKEYRDGGAGAAIRFAIGQCSLGAILVAQSERGICAILLGDDPERLAQQLQDQFPSADLIGG
    DTQFEQRVAEIVGFVEAPSIGLNLPLDVRGTAFQERVWQALRQIPPGTTASYTDIANQIGAPKAVRAVAQACAANRIAVA
    IP
    CHRVVRRDGNLSGYRWGVERKKELLRRESEE

    >gi|254784464|ref|YP_003071892.1| thioredoxin [Teredinibacter turnerae T7901]
    MSDAIVHTSDASFEQDVLTADGPVLVDFWAAWCGPCKMIAPVLDELAQEYEGKIKICKMDVDANKETPAKFNIRGIPTLI
    IFKNGSAEGTKVGALSKAQLKEFIDANV

    >gi|254784645|ref|YP_003072073.1| response regulator receiver [Teredinibacter turnerae T7901]
    MEKSSAATPARHSAQSTWRTLLVYGILALIIYFGHQYLQTALGERALAAVPLEKLTLEEALSASRASDKPVLLDLAAIWC
    PSCRKLDQQVLSDPAVVEVIRNKYVFTRVEFESATGETVQQKYQVKGFPTLLVVDGNGNLIRQLPLSFEPQEFIRSL

    >gi|254784658|ref|YP_003072086.1| putative thiol-disulfide isomerase and thioredoxin [Teredinibacter turnerae T7901]
    MSLTESTMMALGTSAPDFSLPSTEGITVSLSDFNSSKLLVVVFMCNHCPYVIHISSALAELAEETMPMGVSFVGINSNDT
    QAYPADSFEKMREEKAFRGYPFAYLWDETQEVARAYDAACTPDIFVFDADRTLVYRGEFDGSRPDRISSGNYDSAKNPST
    GETLRQVLQDLLNGKGAPTKQYPSMGCNIKWRDS

    >gi|254784672|ref|YP_003072100.1| glutathione peroxidase subfamily protein [Teredinibacter turnerae T7901]
    MSAVQNIPVNRIDGEQQTLADYQGKVLLVVNVASKCGLTPQYEGLQKLYADKQGDGLEILGFPANNFMGQEPGSNEEIQE
    FCSLNFNVSFPMFEKISVLGDDKHPLYDALTDAQPSAEGDGPFREKLKGHGVERDNPADILWNFEKFVVGRSGEVVARFA
    PDVTADDPRLVACIEAELAKS

    >gi|254784832|ref|YP_003072260.1| ada protein - regulator of adaptive response and methylated-DNA-[protein]-cysteine S-methyltransferase [Teredinibacter turnerae T7901]
    MSSAEREQLTAMPIRDAATIDRYYRALVARDPDFLGSFYVGVKTTSIFCIATCRARKPKQENVVFYTDLDEVLRDRFRPC
    KVCRPTENAHQAPPDVATAMRWVLAQPKQKVSDTQLRARGLSPEKIRRWFKAHYGMTYQQFQRMYRINMAVEELKLGQSV
    TASAMDSGYESLSGFGYTYKKLIGHSPASRVNASPILLHRITTPIGPMFVAASSRGICLLEFVDRRMLETEFKDLQRLCK
    APIIAGTNAHIHQAEQEIAQYFVGERTQFSVPLDTPGTEFQQKVWRGLIDIPYGSTASYQQQACRIAVPSAVRAVARANG
    HNRVAIIIP
    CHRVIGADGKLVGYGGGLERKRWLLEHENKFCS

    >gi|254784902|ref|YP_003072330.1| putative pyridine nucleotide-disulphide oxidoreductase [Teredinibacter turnerae T7901]
    MNKPIAYDMLVIGSGPAGQKAAVEAARSGASVALIEKTRKLGGACVQRGTIPSKTLRENALRVRNMRMNAQLSNFKLAED
    TELATLITRLNNVLNAHDEYMRKQLERTKVNLIHGRARFLSPQDVEVESVRGEKQTYSSGHILIATGSHPRKPPDIPVDH
    EHLFDSDSILSMMYLPKSLTVLGGGVIASEYASIFQALGVSVTMIDKYPHPLGFLDNDLTQTFLNDFTQMGGTWKGNTKV
    TRCYWNGMDAVITECDNGTEVRSEKLLCAAGRVANVKELEIGNAGLELNDRGLIDVDDQLETQVRGIYAAGDVIGPPSLA
    SASMEQGRRAACNSLEITSGLVHSVIPAGIYSIPELSSVGISETHAREKFGDVFVGIARFDEIARGQISGALNGMLKIVC
    DTDGKTILGIMIVGEGATELIHIGQMALINNSPVDIFVETVFNFPTLAEAYRAAALEIIHQRKSKASRIKAGF

    >gi|254784928|ref|YP_003072356.1| glutaredoxin family protein [Teredinibacter turnerae T7901]
    MDIMETIKKQLQDNPVILYMKGSPNAPQCGFSMRASQALMECGKRFAYVDVLSNPEIRQQLPVYANWPTFPQLWVNGELV
    GGCDIISEMHEQGELKSLIDSAAAEDTPAGE

    >gi|254784983|ref|YP_003072411.1| peroxiredoxin [Teredinibacter turnerae T7901]
    MTQSIINTKILPFEATAYHRGEFVPVSDKDLAGKWAVVMFYPADFTFVCPTELGDMADHYAKLQEMGVEVYSVSTDTHFT
    HKAWHDSSETIGKIEFPMIGDPTGKISRNFGVMIEEDGLALRGTFVINPEGEIKVAEIHDLGIGRSAKELVRKIQAAQYV
    AEHDGEVCPAAWQPGEETLAPSLDLVGKI

    >gi|254784984|ref|YP_003072412.1| alkyl hydroperoxide reductase, F subunit [Teredinibacter turnerae T7901]
    MLDATLKSQLQTYLNNLQSPVELVSYADDSVKGQEVYALVKDIAELSDKVSHTEGSDSNERVPSMVVRSVKTGSEIRFAG
    VPMGHEFTSLVLALLHSGGHPIKLDADIIEQVRALEGEFRFETYVSLS
    CQNCPDVVQALNMMAAINPQIHNVMIDGAVFK
    EEADARNILAVPAVYLNGEPFAQGRLTLKDILQKVDKNSGKREAEKISAKAPFEVLVVGGGPAGASAAIYAARKGIRTGI
    VAERFGGQVMDTMAIENFISVKATEGPKLVAGLEEHVREYDVDIMTGARVVSVTPADVVGGYARVELSNGAHVLSRSVIV
    ATGARWREMNVPGEKEYRGRGVAY
    CPHCDGPLFKGKRVAVVGGGNSGIEAAIDLAGIVEHVTVLEFGKQLRADEVLQRKA
    RSLPNVEIITEAQTTEVVGNGERVTALTYTDRATDESHTLELAGVFVQIGLVPNAEFLQHTAQLTPRGELIVNERGEASE
    IGLFGCGDVTNSPYKQIIIAMGSGATAALSAFDYLIRTPQPFAEQKVA

    >gi|254785027|ref|YP_003072455.1| antioxidant, AhpC/Tsa family [Teredinibacter turnerae T7901]
    MGVLVGKSAPDFTAPAVLGSGEIVDTYSFAEATKGKKAVVFFYPLDFTFVCPSELLAFDHRMAEFEKRGVVVIGVSIDSH
    FSHNAWRNTPVNEGGIGPVKYTLVADMTHEICKAYDVESEGGVAFRGSFLIDEEGLVRHQVVNDLPLGRNVDEMLRMVDA
    LAFHQEHGEVCPAGWKDGDSGMDASPAGVAKYLSENADKL

    >gi|254785169|ref|YP_003072597.1| transcriptional regulator, Spx/MsgR family [Teredinibacter turnerae T7901]
    MTTLYGIKNCNTVKKARKWLEGNSVAYTFHDFREHGLTEQQVNEWLEVLAPEVLINKRSTTWKQMSDSDKAKVDAGDIAA
    IAAANPTLIKRPVLATGDSLQVGFKDSDYAGLLL

    >gi|254785289|ref|YP_003072717.1| methionine-R-sulfoxide reductase domain protein [Teredinibacter turnerae T7901]
    MSDHNLKDDDYWRSKLTDEEFRICREKGTEMPFSGKYVDTTEAGTYLCRCCNTPLFKSLAKFDAGCGWPSFFEPLEKGVI
    TEEMDTSLGMVRTEIMCEACGCHLGHVFTDGPQPTGLRY
    CVNSASIQFEEEKNQS

    >gi|254785313|ref|YP_003072742.1| protein-disulfide isomerase DsbC [Teredinibacter turnerae T7901]
    MVALLGLSLAGLISCKSEAESSQASAKDPAPAASATQVSATQAEENIRKSLMVANENLRIRKIQPSVIPGMYEVQIMGKG
    IIYMEENGQYFIDGQMLHLDGKKIVNVTDESMTGLRKDLLATVNKDDAIVFSPKGEVKASISVFTDVD
    CGYCQKLHREVP
    ALNDMGIEVRYLAYPRAGLNSMSYQKIASAWCADDPRKALTALKNREDIAMNVCEGNPVASEYELGQQMGVTGTPAIVLD
    SGVLIPGYMPAKNLAERIGVTSGS

    >gi|254785624|ref|YP_003073053.1| glutaredoxin family protein [Teredinibacter turnerae T7901]
    MATTEEKIREQISSNSILLYMKGTPEAPECGFSGATVTALKKTGHDFAYVNVLANPFIRERLPKVSNWPTFPQLFVKGEL
    VGGCDIVLQMVEDGSLDLLLDEVEEKAS

    >gi|254785625|ref|YP_003073054.1| hypothetical protein TERTU_1516 [Teredinibacter turnerae T7901]
    MNHFKRISVDEADQILARFPEALLLDIRDERSFQESHHPRAQLLTDANLRKIMKNTDKTCPVLIYCYHGNSSQDIARMFA
    DFGFKQTYSVDGGYSAWSHHISSEFQVGEKLQNWLDSKGYDGGDINARIDDCNRTAIMIAARSADSEIVRELVNAGANPN
    LADCEGNNALWYACMSQCIACVKLMLKADAEVDNHNIHGFTPLNYSVGMDDIFNLLANYFCDDSLLRLHATGGDEQNHNL
    IATPAVAL

    >gi|254785627|ref|YP_003073056.1| nitrogenase-associated protein [Teredinibacter turnerae T7901]
    MQTLVFFEKPGCISNAKQKKLLSAAGIPFTTENILEYAWDPLSLAPFFSGTPVVEWINPNAPAVKDGEIDPTQVTEHEAL
    AMMVNSPILIRRPLIQVGNLKWAGFDLPYIAEILGVSGDYASTQGIESCSHPQKGECD

    >gi|254785632|ref|YP_003073061.1| electron transport complex, RnfABCDGE type, A subunit [Teredinibacter turnerae T7901]
    MEYISLLIGTVLVNNVVLVRFLGLCPFMGVSGKLNTSIGMSAATTFVMTLASGCSWLLEAYVLQPLDIGFLRILSYILVI
    AGVVQFTETAIKKFSPALYRSLGIYLPLITTN
    CAVLGVPLISVREQQSFLQALVFGLGSALGFCLIMVIFAGIRERLLLA
    QVPKAFAGPPVALVTAGLLAMTFLGFSGLVKGV

    >gi|254785637|ref|YP_003073066.1| electron transport complex, RnfABCDGE type, E subunit [Teredinibacter turnerae T7901]
    MNQELSEQSPDSHDDCSSCASTNGEAVKRYRDYFSFGIWENNIALVQLLGLCPVMAVTTSATNGLGMGIATTAVLIISSV
    LVSALRHTIPAQVRNPVMIAIIAGTVTLVDLAMNAWMHELYKVLGLFIALIVTN
    CAILGRTEAFAMKQPPMAALADGVGM
    GLGFTWALVLLGGAREILGSGTLFAHASSLLGSHFEWLEITFVEVDSGVLLAILPPGGFIVLGIMIALKRVVDERIAAAG
    KSDEGGDLVAIQS

    >gi|254785676|ref|YP_003073105.1| rhodanese/ankyrin domain protein [Teredinibacter turnerae T7901]
    MSYYAEITPQEAQEKVITDGSALILDARDAYSYKESHIDGAMQAHGGLVEHLIGVGDYERPVLVYCYHGNSSKDLAEVFG
    RAGFKYCYSMKGGYTAWKKRDRLYATEAYSEATNIWLVTEGFEKQALNTVIPGQVTPLILACRQNKSEVVSELLASGADT
    TCSDSDGNGALWAACYSESLECLRLLKEAGADLNQANADGVTALMYAASASKFAAVQFLVENGADVHRKSKDDFSALDLS
    ATEEILKFLKPYCR

    >gi|254785692|ref|YP_003073121.1| iron-sulfur cluster assembly accessory protein [Teredinibacter turnerae T7901]
    MISLTGKAVEAVDRFITSANKPVAGLRIQVEGGGCSGFKYTMRLEENSAANDQLVDCGGVTLLLDEASASMLDGVTVDFV
    ENLEGSGFKFENPNATGTCGCGNSFTC

    >gi|254785709|ref|YP_003073138.1| methionine-S-sulfoxide reductase domain protein [Teredinibacter turnerae T7901]
    MDLFDRMNDRMAKKQQMPTPEEALPGRTTPIVEPSTHYVLHNSIVAPFPENTETLIVGCGCFWGVERRFWTMEGIHTTAV
    GYSGGFTPNPTYEEVCTGKTGHNEVVLVVFDPAKVVLEDVLARFWEAHDPTQGMRQGNDIGTQYRSGLYVTPEQRAVAEA
    SKVKYQEVLTAEGHGQISTEIVARTEFYYAEDYHQQYLAKNPGGYCGLGGIGLKYCS

    >gi|254785822|ref|YP_003073251.1| bacterioferritin comigratory protein [Teredinibacter turnerae T7901]
    MAMPKIGNKAPAFTLKNQEGESVKLSSFAGEKNVVVYFYPKAMTPGCTTQACGIRDAQAEFEALDTVVLAISPDPFERLK
    KFEDKHQLNFILLSDEDHAVAEKYGVWGLKKFMGKEFMGILRTTFIIGKDGKLKHVMDKVKTKTHDQDVIKIIRETLN

    >gi|254785939|ref|YP_003073368.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Teredinibacter turnerae T7901]
    MKRLKLFIPLVIFAVLALFLLRGLSLDPSHLPSALVGKPVPEFSLPVVGEQEPSVSNASLQGEPYLLNVWATWCPSCRVE
    HPYLNKLAEQGVRIVGLDYKDEDDAALEWLSHFGNPYESVIADRDGSLGLDLGVYGAPETFLVDKNGIIQYRHVGVVDER
    VWRSKLAPIFNQP

    >gi|254785987|ref|YP_003073416.1| phage shock protein E [Teredinibacter turnerae T7901]
    MAEQNAKTQYWIDVRSADEYAGGHYSAAVNIPHTEIAARIGEVTDDKNADIHVYCRSGRRSGIAKETLEKMGYTQVTNEG
    GYSDVLKKMK

    >gi|254786009|ref|YP_003073438.1| NADH:ubiquinone oxidoreductase, D subunit [Teredinibacter turnerae T7901]
    MKVKELLFKPILDNNPIGLQILGICSALAVTSSMKVTLVMCIALTAVTTCSNFFVSLIRKQIPNNIRIIAQMTVIASLVI
    LVDQILKAVAYDISKQLSVFVGLIITN
    CIVMGRAEAFAMKNPPLASALDGFGNGLGYSAMLIALAIVRELFGSGSLLGID
    ILQTVNNGGWYVPNGLLLLPPSAFFLIGLYIWAIRSYKKEQVEKPDFKIAPNTKAREAV

    >gi|254786010|ref|YP_003073439.1| NADH:ubiquinone oxidoreductase, E subunit [Teredinibacter turnerae T7901]
    MADLIALFVRSVFIENMALAFFLGMCTFLAVSKKVDAAIGLGVAVVVVQTVTVPVNNLLYTYFLADGALAWAGLPNVDLS
    FLGLITYIGVIAALVQIMEMFLDRYVPALYNALGVFLPLITVN
    CAIMGGSLFMVERDYNFAESVVFGTGSGFGWALAITA
    LAGIREKMKYSDVPEGLQGLGITFIVVGLMSLGFMSFGGISL

    >gi|254786014|ref|YP_003073443.1| soluble pyridine nucleotide transhydrogenase [Teredinibacter turnerae T7901]
    MSDFEYDLLVIGAGPAGESAAMAGVKNGLRVGVVEAHNMLGGNCAHRGTIPSKALRNAVKQAIAYHSHPLFRHIHDSQPL
    TYPRILEAASQVIPKQVELHTEYFTRNRIRVHEGVASFLAKDKVEVIDSQGARDVVAAKDILIATGSRPYRPTDIDFDHP
    RVYDSDTILEMKHTPRTLIVFGAGVIGCEYASIFSGLGLKVDLINGRERLLSFLDDEISDALSYHLRNNGVMVRHSESHD
    RLECDDHGVTLYLKSGKRIRADALLWCNGRTGNTDSLNLEKIGLAANHRGQIKVDKAYRTEIENIYAAGDVIGWPSLASA
    SFDQGRSVVAAIQNREVRFVENAPTGIYTIPEISSVGRTESELTAAQIPYEVGRAFFKDTARAQISGEDVGMLKILFHVD
    THEILGIHCFGAEASEIVHIGQAIMQQPGEANNISYFATSTFNYPTMAEAYRVAALNGLNRVNRR

    >gi|254786024|ref|YP_003073453.1| thioredoxin-disulfide reductase [Teredinibacter turnerae T7901]
    MSDAKHFPLIILGSGPAGYTAAIYAARANLKPVVITGMQQGGQLTTTTEVENWPGGSHDLQGPDLMVQMQQHAERFNTEI
    IFDHIHECDLNSTPKKLVGNETYTCDALIIATGASAQYLGLPSEAAFQGKGVSA
    CATCDGFFYRDQKVAVVGGGNTAVEE
    ALYLANIASEVTLIHRRDSLRSEKILQDRLLEKAENGNVKLMWNQTLDEVLGDDSGVNGLRLKSTQDGSTQEIDVAGVFI
    AIGHKPNTDIFEGQLDMHNGYIKIKSGLEGAATSTNVPGVFAAGDVADHIYRQAVTSAGAGCMAALDAEKYLDNLV

    >gi|254786031|ref|YP_003073460.1| glutathione-disulfide reductase [Teredinibacter turnerae T7901]
    MSEDVMDFDLFVIGAGSGGVRASRIAAQLGAKVAVAEDLYLGGTCVNVGCVPKKLFVYGSHFKEDFEAARGFGWSYDNLE
    FDWQTLRDNKTQEIERLNGVYGRILEGSGVEIIRGRATIAGPNLVAVDGETYTAKNILVATGSWPREPRYPGAEYVTNSN
    DFFFLHHLPKRVIVEGGGYIAVEFAGILNALGCDTELVYRGEMFLRHFDGDVRRFAAEQIAEKGVKLSFSTDIKAVEKLS
    NGTLQVTLNAKAEGAAEQVQTRVVDCVISAIGRTPKTRNIGLEALGVNLKPNGAIEVDDNFATNVPGVYAVGDVIDRFQL
    TPVALAEGMALARNLFADQPIAMNYKHIPTAVFCQPNIGTVGYSEEDARESGHEVEVYQSTFKPMKHTLSGLQEKTLMKL
    VVDKQTRKVLGAHMVGPDAGEIIQGIAIAIKVGATKEDFDATVGIHPTAAEEFVTMRSPRA

    >gi|254786446|ref|YP_003073875.1| cyclic nucleotide-binding domain protein [Teredinibacter turnerae T7901]
    MIFTSGASVHEPYYACETSIDTLHEHAVATARTLVPLNALQPRFLTDLAPHIAVQALSAGDLLFAEGSVDHQHIYLLFGE
    VELFNGVGLPERVRAEATSAPLAHQQPRPCSAVATSDTTVVRIDSDLLDRSLSWSQISQYLMSELALQRDLDEDIEWMQT
    VVNSNLFLKVPPVNVEQIFARLTPMVVHAGERILRQGEIGDCCYFIKEGEAVVGVYNEVTGTVENVAKIGPGRCFGEDAL
    VYEKPRNASITMTTDGVLMRLEQADFDLLLHEASVDEVAANELGGLPEFPTLIDVRTDEEYATGHLACSGNIPLSLLSMK
    KRLLSPGNRYVFY
    CNSGRRSRAAAYLLGKEGYNVMSLAGGIDGANLGDQLVAGENYVLRDGHLVSGQ

    >gi|254786520|ref|YP_003073949.1| dihydrolipoyl dehydrogenase [Teredinibacter turnerae T7901]
    MSNKYDVIVIGSGPAGYVAAIRAAQLGLKTACIEKWKDKQGNGVNGGTCLNVGCIPSKALLDSSHKYHEAKSAYAAHGIG
    VNDVSIDVPSMIARKEKIVKQMSTGITGLFKANKVTPLFGTGKLLANRKVQFVSKDGNEEILEAENVILASGSLPVNIPV
    APVDGDVIVDSTGALEFTEVPERLGVIGAGVIGLELGSVWKRLGSNVILLEAMESFLAMMDQQVAKEAQKIYKKQGLDIR
    LGCRVTGSEVVEKDGKKEVIVTYSDKDGNEATETFDKLIVCVGRRPFTDGLLSDDSGVKLDERGSIYVNDLCSTSAPGVW
    AIGDVVRGPMLAHKGSEEGVMVAERIAGQKTVMNYDIIPNVIYTHPEIASVGRTEEQIKADGEEYNVGVFPFLAIGRAVA
    ADESDGIVKMIADAKTDRVLGCHIVGPSAPDLVQQVAIAMEFGSSAEDIGMTIFGHPTFSEAVKEAALAVNGHAIHMPNR
    KKK

    >gi|254786621|ref|YP_003074050.1| glutathione peroxidase [Teredinibacter turnerae T7901]
    MKLTTIAGLAFVVASLSNTASAVESCPAFLNQDMKRLHSSETVNLCSLYKEKPLLLVNTASHCGYTKQFKGLEALYKKYK
    DDGFEIVGFASDDFKQAAKSEEEAATVCYKNYGVTFTMLAPTHVRGKDANPVFAHLNSETEKPGWNFNKYLVSADGKTVK
    HYGSSTKPMDSALEKDLKKMLK

    >gi|254786624|ref|YP_003074053.1| iron-sulfur cluster assembly accessory family protein [Teredinibacter turnerae T7901]
    MTVETFSIADTVSVTPAAAEHFHMRLQKSGKTGIRISLKEAGCTGFKYVIDEVNEGDGSDLRVQLSNGVSLFIDGSHLSG
    IQGTQIDYVKEGLNRNLVLNNPNVKDACGCGESFSV

    >gi|254786725|ref|YP_003074154.1| thioredoxin [Teredinibacter turnerae T7901]
    MNEFVVEVTTENAQAVLIEESFKRPVLIDFWADWCEPCKTLMPMLEKIAMEYQGDLLLAKVNADDQQMIAAQFGVRSLPT
    VMVMKDGQPVDGFAGAQPEVQVRELLAKYLPKPWEKTLAQAAELIGEADWAGAYALLKDAYAESNGQANIAIAMAECLIE
    LKRLDDAESLLANIKMVDQDAEYHNAMAKLELARTAGKAPELQALEIKYQTNPDDLDTAYLLAVQYSQEGFHKDALELLY
    GLLRQDLNAKDGEVKKIFGDVLAVLGKGDPLAVEYQRKMYTLLY

    >gi|254786752|ref|YP_003074181.1| rhodanese domain protein [Teredinibacter turnerae T7901]
    MSDYLVAALYKFVSLPNYESLREPLIDFCQSREIKGTLLLAAEGINGTVAGTPEAIQALLEELRRQPGLDALEHKESVAT
    EQPFYRLKIKLKKEIVTMGVEGIDPNLVVGTYVAPAEWNALISDPDVTVIDTRNDYEYEIGTFRGAVNPNTQSFRQLPQY
    VAENLDPNKHKKVAMF
    CTGGIRCEKSTALMKQMGFEEVYHLQGGILKYLEEVPEGNSLWDGECFVFDNRVSVKHGLEEGS
    YELCHGCRFPINETDKQSDKYIKGVACPRCYDEQTPEQRSRFLERQKQMELASRKGELHIGDRADIAKSRTTQGAPSADG
    E

    >gi|254786869|ref|YP_003074298.1| redoxin domain protein [Teredinibacter turnerae T7901]
    MLSGKNVFRALSGIVAGCFLSASVAAVEIGKPAPGLVLTTLSNHDDAGFTLADYRGKVVYLDFWASWCGPCRASFPVLNE
    LRTKYQAEGFEVVGVNLDENTADANGFLKKFPVSFPLATDPKGAAAQIFQIKGMPSAVIIDKKGVARAEIVGFHKDEPQK
    IEQLVSQLLKEPS

    >gi|254786924|ref|YP_003074353.1| electron transport complex, RnfABCDGE type, A subunit [Teredinibacter turnerae T7901]
    MTEFAVIMLSTVLVNNFVLVQFLGLCPFMGVSNKLETAIGMGTATTFVLTLASVCSYMVHSWVLVPLELTYLKTISFILV
    IAAVVQFAKMFIEKTSPLLYRVLGVFLPLITTN
    CAVLGVALQNTNKNHNFLESTFYGFGAAVGFSLVLILFAAMRERLAV
    ADVPVAFKGAAIGMITAGLMSLAFMGFAGLV

    >gi|254786929|ref|YP_003074358.1| electron transport complex, RnfABCDGE type, E subunit [Teredinibacter turnerae T7901]
    MASYRELTINGLWKNNPALVQLLGLCPLLAVTGSVVNALGLGLATMLVLVGSNIAVSLIRNAVSDAVKLPAFVMIIAAFT
    TCTELLMQAYTYELYQILGIFIPLIVTN
    CSILGRADAFACKNPVLPSAVDGLMMGAGFLCVLVVIGALREVLGAGTLFAN
    MHLLFGEGARSWTLHVFGDSYPGFLVAVLPPGAFLIAGLLIAIKNMIDSHFEKRAAARKSVVSKGSKRVRTTGQIA

    >gi|254786941|ref|YP_003074370.1| copper-exporting ATPase [Teredinibacter turnerae T7901]
    MTQCFHCGLPADGNITAKIDDHPQLFCCEACRLVALTISEGGLSSYYRFRDELAEKPRALNNDFLGYDLPEVQLDFVHRD
    ADNLAVARLSIQGIS
    CAACAWLIEKHLGEQRGVSQVRVNATTRRCTLRWNPETAPLSTLLNEIQRIGYQPLPDRLESNQQ
    QRKAERHQAFMRLGVAGIGMMQVGMVAVALYSGDHYGIEQNWQSFLRWVSLVIATPVVFFSAAPFFLSAARALRAKHLNM
    DVPVSLAIGLAYTASAFATLTETGDVYFDSVSMFTFFLLLGRFLEMRARHSSAFASENLRQLLPLTVTRMDEAGSKVSVP
    LNALRPGDQVWVNAGDMIPADGVLTNAQASVDESILTGESLPQIKKRGDSLCAGTLNRESALQMHVVQTGANTQLAAIEQ
    LVEQAALQKPRQIAFADLIAGRFVAAVLVLSVIVAFVWWHIEPERALWVVLSVLVVTCPCALSLATPAALTAGLNRARQL
    GVLVSGPQVMESLARLTHVVFDKTGTLTEGHLRLLGTVSPGAGAQTGEAESLSIIAALEQYAQHPIADVFRAFDRGLVAT
    DVSVSEGEGVCGCVNGTHYRFGRPEFAAPGVAYPDEDAQVLWQLLAAETEADGQAIPLRWIMLGDCLRESAINAVTELGE
    LNRNVTLLSGDRYSVVADVAKAAGIADWAGEARPADKLHWLNQQQAQGARVLMVGDGINDVPVLSAADISMAMGSATRLA
    QSKADGILLNGNLTAIPAIIVLSARVQKIIRQNLTWALVYNLVALPAAATGILPPWLAAIGMSASSLVVVLNAMRT

    >gi|254786957|ref|YP_003074386.1| arsenate reductase (glutaredoxin) [Teredinibacter turnerae T7901]
    MTDNIRIFHNPRCSKSRQTLALIEESGVEPTVIKYLETPPTPEELRDLLTKLDMPARDLLRKGEDAYKENNLSDPQLSDD
    ALIEAMVKFPKLIERPIVAKGDKAIIGRPPERVNTLL

    >gi|254787009|ref|YP_003074438.1| HesB/YadR/YfhF-like iron-sulfur cluster assembly accessory family protein [Teredinibacter turnerae T7901]
    MMSGVEEFVPEPLLVTQNAVSKVKDLIDEEGNPELKLRVYVTGGGCSGFQYGFAFDEVSGDDDAQIEKSGVTVLVDSMSY
    PYLVGATLDYQEGLQGSRFTVENPNASSTCGCGSSFSI

    >gi|254787024|ref|YP_003074453.1| C-type cytochrome biogenesis protein [Teredinibacter turnerae T7901]
    MTRYFFKASAATQFSLRYFLSLSLLFVAFQAYGDTYNFGASSNNDDFLSVDQAYQANVELHNNSLETDWTIAPGYYLYQH
    RFKMEAYNTEQREELELQFAPGLRKYDDYYQKELEVYYDNTTFKSAPPSIKPPYELLLVSQGCADAGLCYPPRKQYFQVD
    TDGIVVETPESTIESSASTAVTQKPSAQEQTPASPSQPFNPLILLGALLGGLILNLMPCVFPVLSLKALSFASNNHQDGK
    QHLHGWAYTLGVVISFLIAASIILVARHTGEALGWGFQLQQPLFVVILVYLFLVMGLSLFGAFHFGTSLMGAGQGLTTGD
    GLGASFFTGVLAAVVASPCTAPFMATALGVALTQPAPLALLVFACLGFGMALPFLALSYSPALARYLPSPGPWMDVLKQV
    LAFPLLATCVWLLWVLGNQSGVTGTAMALLGALFLYFALWLTQFEPRSTILRWINRGLVLVSLLAVAHFSWHLTDYKATS
    SGTYDKWQTFSMERLNELREQGEPVFVNLTADW
    CITCKVNERVAFSSQDFFNHALDKDVNLLIGDWTNANPEIEALLAEF
    NRSGIPLYLMFPAGGGDAEILPQLLTPKAVINAIDRAVE

    >gi|254787066|ref|YP_003074495.1| OsmC family protein [Teredinibacter turnerae T7901]
    MQATVKWVDGAQFLAESGSGHSVVMDGPPDHGGRNMGVRPMEMLLMGLGGCASFDVMSILQKARQKVVDCRTELTAERAD
    ATPAVFTKIHLKFIVTGIDLKEAQVKRAVSLSAEKYCSASIMMEAAGVEISHEFEIVSA

    >gi|254787143|ref|YP_003074572.1| putative glutaredoxin [Teredinibacter turnerae T7901]
    MATDKFENLTTADVTLYHRPACGFCSRVMYALKDMNLDIPKEDIWQNSQARTDLYKGGGKNQVPALRIRQPNGDYVWMYE
    SLDIIDFLQQHFSE

    >gi|254787313|ref|YP_003074742.1| selenide, water dikinase [Teredinibacter turnerae T7901]
    MPDSIKLTEYSHGAGCGCKISPATLEKIIGNTSSDFTDPFLLVGNSTKDDAAAYDLGNGDVILSTTDFFMPIADDPLDFG
    RIAATNAISDIYAMGGDPIMAIAILGWPVNILPADVAAQVIEGGRQVCHAAGIQLAGGHSIDSPEPIFGLAVTGRVAKAN
    LRRNASANAGDQLYLTKPLGIGILTTAQKQKKLAEEDAFIARDLMCVLNKVGSRLATIDGVSALTDVTGFGLAGHLSEIC
    VASGLVAQLSFDAIPVIPQAKHYLNQGCIPGGTQRNFDSYGEDLSPLNEQQKQILCDPQTSGGLLIAVNPDAVDAVEACL
    KANNTPIHRIGELTPWNSGPRVVIDS

    >gi|254787411|ref|YP_003074840.1| membrane associated glutaredoxin [Teredinibacter turnerae T7901]
    MQSHCQKQNTQQDATMKSKAVLYRMSTPEHICPYGLKSRALLKRKGFELEDHLLKTREATDAFKAEHNVETTPQTFIDGE
    RIGGYSDLKAYFGEPLPNDDEPSYTPVIAIFATAFLMALGLQLSNPEPFTATGVAQTFIALSMCILAIQKLRDLRAFSMQ
    FITYDLLAMHWVRYAYVYAFVEAYAGIGMLASLPAMLVGPPAIFIGLLGAISVIKAVYIDERELKCACVGGNSRVPLGAV
    SLTENLLMLCMGVWVFLQ

    >gi|254787425|ref|YP_003074854.1| alkylhydroperoxidase AhpD family core domain protein [Teredinibacter turnerae T7901]
    MSRINVVKNDTANVEQAALFEAINSKLGVVPNVMRVIANSPSALRAFLGLHAIAEEGELEPKTRERIALGVAEQNACEYC
    VSAHTAIGRKVGLSSAEIEANRAGGSQDAKAAEAVKFARSVAKNTGEVTTAELMAIREAGFSDAEIIEIITHVALNLFTN
    MIGKTSRVEIDFPKVQLLGAA

    >gi|254787468|ref|YP_003074897.1| hypothetical protein TERTU_3570 [Teredinibacter turnerae T7901]
    MATTELPLLIEPQDLAAFLAENPQPDTPICIVDLSSEQSYQSGHIPGAVHLPAQALICGYPPAAGKLPGDEQLNRVFSHL
    GLTPDTHFIVYDDEGGGWAGRFIWTLDVIGHQQYSYVNGGILAWRGEGLPVETQENLAQPTDVNVQIHEQPIAEIPYILG
    ELGNQGFVIWDARSPEEYRGEKILAQKGGHIPGAINCEWTSLMDPDNHFRVLTDAEERLGILGIRKGQSIVTH
    CQSHHRS
    GFTYLVGKILGFSIKGYHGSWSEWGNHPDTPVEEASL

    >gi|254787676|ref|YP_003075105.1| disulfide bond formation protein DsbB family protein [Teredinibacter turnerae T7901]
    MNILLNAAPRLWPWLTVIAVCVGLEAGALYFQEIVGLYPCELCIYTRVWLTGMALVALIGIFVRGFTWPRRLALLALFGL
    TLALCRTTWKLLGIDYGFGNDGA
    CSLVANFPSWAPLDQWWPMLFMIQDACSATPEVMFGLSMADGLAGVCVGFVACLLLA
    ILGEFKSRDEATD

    >gi|254787710|ref|YP_003075139.1| ThiF domain containing protein [Teredinibacter turnerae T7901]
    MNDDQLLRYSRHILLPQVDVSGQERFLAARVLIIGLGGLGSPVSLYLCAAGIGELVLVDDDLVDASNLQRQVVHRESTIG
    LAKVDSAAGQLRDINSECKLTLIRHRLDEQQLTAEVAAADIVLDCCDNFGTRQLVNRVCRQTQTPLVSGAAVRMEGQLVV
    FDFRDPAVACYECLYQLTGDEDLS
    CAQNGVLSPVVGIIGCHQALEALRLLAGIGPVISGRLGLFDGGRNEWRYLNLRKDP
    ECPCCGSRK

    >gi|254787769|ref|YP_003075198.1| hypothetical protein TERTU_3905 [Teredinibacter turnerae T7901]
    MAKIIVPDRVAKIVKLDTNEFDVPAANTVEDALVAVCEQVDALKAHFFHPNGEFKNHFMLVINDEHGSLSQSVASDSTVE
    ILLATSGGIDLTPAELSKEEVERYSRHLLLPNVGRKGQGRLKAARVLIIGTGGLGSPIALYLAAAGVGTLGLIDFDVVEE
    SNLQRQIVHGHTTIGELKVESAKTRLLDINKHLNIQTHTCALSPDNAFDIIADYDLVIDGSDNFATRYLVNDACVLLEKP
    LVSGSIHQFDGQISVFNHDGGPCYRCVFPESPPAELAPN
    CSAGGVIGVLPGVVGTIQATEAVKILLDMGESLAGKLLRFD
    ALGMNFRSVKVKKDPHCKACANKEAIKQFTYTPQTCSDSSSELTMLTEHNYIQTTDLAHMMQDPAMMQDSVLLDVRDMQE
    LEICVLPEVINIPLGELEDQLFRLDKSQTHYII
    CLAGRRAERAADLMLKHGFSKVYVLREGMVGWTRDIDTSMPIY

    >gi|254787799|ref|YP_003075228.1| thiol-disulfide isomerase and thioredoxins/Thiol-disulfide oxidoreductase resA [Teredinibacter turnerae T7901]
    MIRNRNWLATIALTFAAATCCIGLSGNALAKSAGGAAKDFTLKANNGKNVRLSDLRGQVVMLNFWASWCGPCRQEMPLLD
    ALYKKYSPAGFTLLGVNVEADPKEADALLKELPVSFPVLYDTTSKVSEAYKVDAMPSSVLIDCDGKVSYIHKGYKPGDEK
    EYKKRVKELIRSCSM

    >gi|254787814|ref|YP_003075243.1| putative thiol-disulfide oxidoreductase [Teredinibacter turnerae T7901]
    MFRLSLFVCVIACCIVARPSSADVHRLQEGDVAPDWMMTDIEGHNYSLYQELDSGRQVVMVFWSTWCKFCKVMLPEMNLF
    KQSLDDDTRIFALNIWESGDPVAYFDTRNIDIPLMLRADDIADRYKIDSTPGLVFIGTDKRIRYIRSSRENLSDTMRHLQ
    LLVIKDRAKHASNSGG

    >gi|254787886|ref|YP_003075315.1| 4-carboxymuconolactone decarboxylase family protein [Teredinibacter turnerae T7901]
    MSDRYETTRTRIRTYARELQKAQPETMNAFYAMSKAALKEGALSEKVKEFVALGIGIARQCEGCIAFHVKNLKELGASRE
    ELTEVLAMSVYMGGGPGLMHAAEAMEAFDALEAEDR

    >gi|254787957|ref|YP_003075386.1| rhodanese domain protein [Teredinibacter turnerae T7901]
    MKTAHDLVAEAKAEINELSLEESVLALKDADFVIDVREPDEFRAGHLPGAINIPRGLLEFKLSADAPLETREAKFIIYCK
    TSGRAALAASSMKSMGYQQVKSIAGGYDAWLAAGNETVAPELPGFE

    >gi|254788002|ref|YP_003075431.1| hypothetical protein TERTU_4165 [Teredinibacter turnerae T7901]
    MQISNSYLQLGDDFYLPSTPRQPSNPQLFLWNQGLAESLGVADFLAQEQEDPAGFFSGGRLLPNSKPVALAYAGHQFGHF
    NPRLGDGRAHLLGELRGDTDMVFDVQLKGSGATPFSRGGDGLCGLGPAVREFIMSEAMAALGVPTSRTLAVVTTGDEVYR
    GDAVPGAVVCRVAASHLRVGTFEYFYAQGNKDAIERLCDYAISRHFPELASSEGPEKYSGFLRAVFSRQVELVCEWLRVG
    FVHGVMNTDNTTISGETIDYGPCAMISTYNPNTVFSSIDAMGRYRFGHQPSIAHWNMARLTECFLPLLDQDSKQATAIGE
    SLLGEFPQNFEQRYHHMLASKTGVRLQGDSDKALCEDFLQLLRKQGLDYTNSFDSLTRSLIDPQHEDRCASQWPEWYQAW
    SARIEQQGRPREVVAEGMRRHNPVVIPRNHHMEAVIDECIKNGSPDAAKSWLKVLRRPYQDLPTTPNYQDPPADGDRSYQ
    TF
    CGT

    >gi|254788307|ref|YP_003075736.1| putative thiol-disulfide isomerase and thioredoxin [Teredinibacter turnerae T7901]
    MKNLVLILCLLLTNFANAETGYDPKANPDKDLKAALVSAKEKDKLVLVIFGADWCPDCRSLNKKITEPPLAKTIDNNFSV
    IHVDVGRWDNNIEFASRFGKPIEKGIPSIAILDKDQGIYYVAQGGEFATARNAKVNSLNDWFEALLKAIDNQELEKRPMS
    K

    >gi|254788354|ref|YP_003075783.1| rhodanese domain protein [Teredinibacter turnerae T7901]
    MANSPLVSTGWLASNMLNKELVLLDVSFDKVIGLEPLTYKTPKHIPNSHKLDLENTLCDNTRAGVHNFPRPDQVSAIAQK
    LGITSESTIVLYDNQGIYSAPRGWWIFKSMGFEKVFVVDGGLPKWLEEGRPVVSEYLSATGKTEVYGQAQENRVCDSDFV
    LANLDNPALKVIDARSAERFAGSVAEPRPGVRSGHIPGAVSLPFARVLHNRRYKSEDALKAIFAELEVESSEQLVFS
    CGS
    GVTACILILAAEIAGLRNQCLYDGSWAEWGASDSLPIATST

    >gi|254788442|ref|YP_003075871.1| thiol:disulfide interchange protein DsbA precursor [Teredinibacter turnerae T7901]
    MRHIAALIALVLFLGACGDKDASVASVTPSLIARAEAADSPAGNFVQVQYQEGREYTVLAEPVKTVSGDKIEVTEFFSYG
    CIHCFHFETAVHAWEKNTMPAGVEFVQTPAVFNKAWEHYARTFYAAKALGVWDKAHPVVFDTIHVKRKRLGTVDEMAELF
    TTFGVKEDDFKKAYSSFGVTSQVQAGDARARAAGLRGTPELMVDGRYKITTGSAGGHEQMFQVANFLIDKIKRERK