Syntrophus aciditrophicus SB uid58539

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|85857933|ref|YP_460135.1| NADH:ubiquinone oxidoreductase, NADH-binding subunit [Syntrophus aciditrophicus SB]
    MSTINTWDDLNKAAKRGLARLLPAKVKIVVGMATSGIASGAQAVYDALAKEIANRGLDIVLSKAGSMGMDCIEPIVDVIA
    PGKPRLSFSKMTAKMVPILIDRVVNGDLNGIQPAYRMDEMELLLQGEKKAYFSGSVPVDCSGIPQINELPFYRKQVKIAL
    RNCGMIDPENMDEYIARGGYTALHKALTTMSPEDVILEVKTSGLRGRGGGGFPTGTKWESCRRAEGEIKYVICNGDEGDP
    GAYMDRSLMEGDPHSVLEGMIIGAYAIGAHEGYIYVRNEYPLAVANLQHAIGQAREAGLLGKNILGTGFEFDIKIAKGAG
    AFVCGESTALMASLEGKAGEPRAKYIHTVEQGLWNRPSNLNNVETWANVPVIIARGGQWFSGIGVKHSTGTKVFSLVGKI
    NNIGLVEVPMGIPLKDIIYEIGGGIPGGRKFKAVQTGGPSGGCIPDTMIDLPVDFDSLWEAGSMMGSGGMIVMDDKTCMV
    DIARYFIEFLVSESCGKCVPCREGIYRMNEILQDICAGKGRRGDLELLGRMAEAIKDGSL
    CALGGSAPNPVLSTIRYFRS
    EYDAHIRSKKCPAGVCKALIQYNIDKEKCTGCMACAKKCPVEAISGERKKAHEIDQAKCIKCGVCMETCKFDAITLS

    >gi|85857940|ref|YP_460142.1| rhodanese-like domain-containing protein [Syntrophus aciditrophicus SB]
    MLRLRWRNGAWRRFRPMNNRIHEDVLINALQVRWLIPLLLAAGLCLQGNTAYAAGWKIVDAATLYSWMQTEAEKVTLINV
    MSRIECLDHRIPGSLCIACEEFDKRLSEVPREGKVILY
    CESDACIRSCQAGDLAVRKGFTNIYVLKGGMPAWKQAGYALE
    SRDRIARVPIRSVKAQELENWRGIHQDALILDIRSEAAYSESFLPGAVNIPLYQLHKRYRELPERRLILIVDDQGFRSFI
    AGSYLFHKGFHDINRLFGGMKAVNAIKGKKAGKTGQ

    >gi|85857942|ref|YP_460144.1| rhodanese-related sulfurtransferase [Syntrophus aciditrophicus SB]
    MKKIKYFSLLLIVFLFLPLAAIAQEFSPVVSTDWLQQNLDNPKVIIVDIRKVEDYRAGHIPGAISMFYGTWAIKKGELDN
    QLPEDDELIDLLSSAGISPDSIVVVAGTTESGPDRVNTTRVAWTLKYAGVKTVGILDGGHTKWMVREKRAVSTEAVKPKA
    KPYRGKFDKNLLAKKDYVMSQLGKALIVDVREPEFFSGTNKLPFVAKAGRIAGAVNLPTAQVFEKYPPGEHLETCCYTLK
    DKAQLKNMASGVVGSDLSREIIVY
    CDSGRVASMWWFILHDVLGYTNVRNYDGSMQEWAKDPNAKMEP

    >gi|85857983|ref|YP_460185.1| heterodisulfide reductase, subunit A and related polyferredoxins [Syntrophus aciditrophicus SB]
    MEKEQIEQLYRSLANSKFGDVMVVGGGISGIQAALDLGTAGFKVYFVEKSPTVGGKMAHLDKTFPTNDCSMCIESPKFVE
    CKRHPNIEMITYAEVESVEGEAGDFTVTVVKKPRYIDESKCTGCTTCVEYCPAVYPDKFNQDISKNKAIHIYFAQAIPLV
    PYIDDSCLYLKEKKCQICLGVCQSNAIDFSQKPVRMDINVGAIILSPGIEAYDPRAKEEYHYNDFANVVTGLDYERLLCA
    TGPYEGEILRASDLKHPHNVAWIHCVGSRRVTPGDNSYCSAVCCTYTQKQVILTKDHDEGARCTIFHNDIRSYGKDFERF
    YQRAENLPGIRFIRSYASIVKEDPVTKNVTVRYTTPEGVKEEEFDMVVLSVGLVPPANVEKVARAFGIELNDHGFCKTSI
    SNPLETTRPGIFVSGAFIGPMDIPEGVLGASGAGSMCGEILSYRRGNLSKERVYPPERDVSQEEPKIGVYVCHCGANIGR
    IVNVPATVEYSKTLPHVVHAEESLFICSTEAAAMLAKDIQEKGLNRVIVAACTPRTHEPLFRDTLREAGINQYYYDMANI
    REHCSWVHSKEKEAATEKAQDIIRMSVARAHFLEPLQEFNLPVDKRALVVGGGIAGMISALSIANQRHEVFLVEKEKELG
    GMARRLHYTLEGMDVQAYLRDLIQKIYQHPMIHVYTNATIPEASGYVGNFITRVQSDRGLTEIKHGAIVIAIGADEYKPT
    EYLYGQDERVLTQLELEERIARGEENVVQARNVAMIQCVGCRNEDRNYCARICCSHAIKNALKLKEINPGVEISILFRDM
    RTYRYIENYYRDASEKNVKFIRYEPENPPRVEAVVEEGRPVLRVTAADPILEKALALDADFLVLSVATIPSAESEEISKK
    FKVALGPDGFCQEAHVKLRPVDFAAEGVYLCGIAHYPKHISEAVAQAYGAAGRALTLLANDTVVASGSVCEVNEKMCMAC
    GACVPACTYGAIEFKETKQGKKASVIPVLCKGCGLCNSKCPTGAIQLKHYTDTELLTQIDAAGSSELVVESAAAAVAEA

    >gi|85858088|ref|YP_460290.1| thioredoxin reductase [Syntrophus aciditrophicus SB]
    MEGNESLKLVYDIIVVGGGPAGLTAGLYAARGGLKALLLEGESSVSQITVTDLVENYPGFPEGINGYDLVERFRTQAGRF
    GLKILTEDIRAIDAGAAEHWIVSGRDSAYEALSVILATGANWRHLGVPGEAAFTGKGVSY
    CATCDGPFYRDREVVVVGGG
    DTAVQEALFLTRFARKVTIVHRRDRLRATPILQERAFAHERIDFAWDSVVEEIQGGEFVEGVRIRNLKNPEKSRIIPADG
    AFIFVGLTPNTGFVRGLVNCDENGYILADAEMKTSVKGIFACGDCISKLLRQVVTACGDAATAAFSAQLHVEALKGEDYG
    GRKA

    >gi|85858090|ref|YP_460292.1| pyridine nucleotide oxidoreductase [Syntrophus aciditrophicus SB]
    MDIARWKSGDEQAFVFPQSCGRRKGWVKYMKRRVVIIGGGAGGPSTAAEAGRRDPSLAITMIEKGEYISYAACPMPYYIG
    DVIKDEKKLIARTPEKFREGGVDVRTGVEAENVDLAAQVVTLVGGEALPFDVLVLATGTRPILPGIPGEDREGVFTLKQL
    PDAVGIKQFIRESRCRTAIIVGAGFIGMEMCEAFREAGVETTVVNRGSMPVPRWDPELGQLVVKSLLDHQIRMMADTTIQ
    AIEKGETCRLRLITDQGKIEADVILLAIGVRPSVGLAGEMGLALGKTGAVAVDFSQKTSHPAVYAVGDCCEAYHRVSRRW
    VHIPLGDIANKQGRVAGCNIGGFPTIFPGIVGAQAFKLFDLEIAATGLDEREALAAGFHPVSNLVWGDVVPLSVPGTTRL
    GLKLIADEATGLFLGAQAIGPHGAVSRINTLSAALWSGLSIDEVAYLDLAYSPPFSRAWDLIHIAAQDLMKKMVRRPPR

    >gi|85858097|ref|YP_460299.1| thymidylate kinase [Syntrophus aciditrophicus SB]
    MTDSTRSTGSFRNRLQQEKSPYLLQHASNPVDWYPWGEEAFEKARREDKPIFLSIGYSTCHWCHVMAHESFENEEVARLL
    NESFISIKVDREERPDIDKLYMAVCQLLTGGGGWPLTILMTPDRRPFYAGTYIPRESRSGMVGMLVLIPGLSEVWRKERN
    RILETAGEITTALQGMDQGGPGELPLDRVLHEAYDDLRRRFDARYGGFDSAPKFPMAQHSFFLLRYGRRQENSQALAIVE
    KTLQSMRRGGIYDAVGFGFHRYSTDAQWRLPHFEKMLYDQALLAMAYTEAFQAAGQSLYKKTAREILTYVLRDMTAPEGG
    FYSAEDADTAGEEGAFYLWTAEELRQVLPTEEAELMIRVYAIPEGGKPSVLHCSSSYPELSVDLDLPEERLLERLESARQ
    KLFLQRAKRIRPLRDDKILTDWNGLMIAAMARAAAVFEEPVYLQAAREAVRFILENLRDPRGRLLHRWREGEAAMPAVLD
    DYAFLIWGLIEAYEATFDANLLQTALSLDEELTAHFWDNASGGYFYTPDDGESLLVRQKESYDGAIPSGNSVAMLNLLRL
    SRLTGQAGLEERAVATAQAFADSIRSLSAAHTSFMVALDYLAGPSAEVVIAGSPEGTDTRDMLRELRRAFLPHVTVLLIP
    DEGEKGMLAGVAEFTGGMTRIDGRATAYVCRNFSCRKPTTDPAEMTTLLRE

    >gi|85858102|ref|YP_460304.1| peptide methionine sulfoxide reductase [Syntrophus aciditrophicus SB]
    MKKFFLLIAILVLTWGCEGNNASLERRNKMTEQGETTQVATFAGGCFWCLQADFEKIPGIVKVVSGYAGGTEDRPTYENY
    SRTGHVEAVQITFDPRKITYGQLLDVFWRHIDPTDRGGQFVDRGAHYRSVIFYHDDVQKKAAEKSKEDLQNSGRFDKPIV
    TDIVPFTRFYEAEAYHQDFAEKNPGRYKLYRFHSGRDSFQEKVWRKEAGKTPSGSGAPYRRPDDATLKKTLTPLQYHVSR
    QEGTEPPFRNEYWDNKKEGIYVDVISGEPLFSSRDKYDSGTGWPSFSKPLEPDNIVEREDHSLSMRRTEVRSRHADSHLG
    HVFPDGPRPSGLRY
    CMNSAALRFIPKEDLEKEGYGKYAELFK

    >gi|85858562|ref|YP_460764.1| pyridine nucleotide-disulphide oxidoreductase family protein [Syntrophus aciditrophicus SB]
    MQTLKRDLVIIGGGPAGLSAAVSARENGCDDVLLLERDRILGGILNQCIHDGFGLHRFGEALTGPEYAQRYIDEYEKLKG
    DVLLETIVLNMDEQRNLLVSSRHGFTKIEAGAVILAMGCRERTAGAISLPGTRPAGIYTAGAAQNFINLQNIMVGKRVVI
    MGSGDIGLIMARRMTLEGARVEGVFEILPYASGLPRNIQQCLNDYDIPLHLSTSVVDIHGKERLTGVTVACMDETLKPIP
    GTERHVPCDTLLLSVGLIPENELSRAARIAMEPRTSGPQVDDTLMTSIPGVFSCGNVLHVHDLADWVSEEAALAGRSAVS
    YLEKNIAPPEKKIPISAGNGVRYVLPQTVSGLMDFTLSLRVASPSRNRVITVMDGGREVARKKIVRLHPAEMIHIKIKEE
    KISEADKLEVSVA

    >gi|85858671|ref|YP_460873.1| 6-o-methylguanine DNA methyltransferase [Syntrophus aciditrophicus SB]
    MIMAHIRVDELMNQEATHTPAFCLRDTPFGPVAVLWSVHGGEPKIGRILLSAPEISAGQAVRALFPHSRGASCEEIGLIL
    DQIAAFLGGEDSRFSLDSLRLDLCTAFQKRVLLADYAIPRGRISTYGLIAKHLDNPKGARAVGTALANNPFPLVVP
    CHRA
    IRSDGSLGGFQYGLEMKRKLLEMEGIVFQDKNHVATQDFFYRDEAGRVGEKEHSGKLIVNETLNAQQRHWENTFSEAEDL
    FGIEPSEPARIAVELFLKEGKRRILELGGGQGRDALFFASQGFQVDVLDYSEQSITTIAEKARQMGLSDKVKAIRHDIRE
    PLPFEDGIFDACFSHMLYCMALTTAELERLSSEVRRVLRPAGLNIYTVRHTGDAHYGAGISRGEDLYEVGGFIVHFFTRE
    KVERLAGGYDLVGIDEFEEGDLPRKLFRVTLRKKDWVSAS

    >gi|85859498|ref|YP_461700.1| hypothetical protein SYN_01840 [Syntrophus aciditrophicus SB]
    MIKELRRYKRSATIALGITGIAVMAAYSLCSESCTYLRGSMLGLDLKHLGMLYMGSVLTAGDFGKNAVCAILLSLGLGGE
    VFLLGFQVMNGVYCPYCLTFAAVVIVLFAMHLERIRPSTAILFAAIGFSVFLSLFSGSATPAYAEETQIPSFGNGPVKVR
    IYTDYF
    CPPCHSMEPELEPIIVDLVRRRIAAVTFVDTPVHRETILYAKCFLGMVTGRSDISQILWARSALFKAAEENIRS
    LPDLEAFLGERGLKYRYVDSSQAFETFGKHLRDDRIDSTPSCVVEGPGGRKKFTGAREILRALTRLGEGT

    >gi|85859516|ref|YP_461718.1| protein-disulfide isomerase [Syntrophus aciditrophicus SB]
    MLLKKIMPAVMAMFLCAAVSHAEESITIQILHKSFPNVKAEKAGKSVIPGLYEVEAGNNVFYFEPRNGYLIFGDIITKEG
    KNLTAEKRQELLARRVKEIPLEKGIKIGGGKNVVIEFTDPD
    CPFCRKAADWLEKNREGVTRYVFLYPITRLHPGADAKAK
    YILGAKDQEKAYHEVMSGALDSIDAGKLKLTEKAGTLLEEHKQLAIKAGVFATPTLWVNGKHVPGADIPLIEKYLKGEK

    >gi|85860040|ref|YP_462242.1| thioredoxin [Syntrophus aciditrophicus SB]
    MSSQESLLHVTDANFEEEIIKSDKPALVDFWATWCGPCRAIGPLVEGLAETYKGRVKISKLNVDENPKTAADFGVRSIPT
    LILFKDGKVMDTLVGVVSKERLETFVNQSL

    >gi|85860201|ref|YP_462403.1| thioredoxin peroxidase [Syntrophus aciditrophicus SB]
    MKRYICGFSLFFAVAVLSFFNAPTAYSISDVYKGNIYNPGILKPVDSALKVKVGDVAPDFTLKAVSGETISLKDYRDRKN
    VVLSFVPAAWTPV
    CSDQWPGYNIVKDLFDQNDAILLGISVDNLPTLFSWTNHMGVLWFPVLSDFYPHGAVASSLGILRSD
    GMAERALFIIDKQGIIRYIYVRDINMRPPLDVIIKELEKLKEAS

    >gi|85860202|ref|YP_462404.1| hypothetical protein SYN_00592 [Syntrophus aciditrophicus SB]
    MKLFPREKQPLLIFKIQSPLLNKISTTFSSQKYQAEIVNSNYDVNHVKQTLFLRRGGRIMKRFWSFYLLWLALFLTIVGG
    RALAVSPPQVGGVLPEFELAVPKDAAEKNYLGLTRGLPLFGKETFKIQQIKADVVILEIFSMY
    CPHCQAEAPKVNDLYAK
    INNTPSLRGKIKIIGIGIGNNVYEVGTFKKKYKIPFPLFTDEDFSLHKKFGEVRTPYFIVIRNYPKGSYRIVYSQLGAFG
    EVDQFLSQVIKLTGIK

    >gi|85860549|ref|YP_462751.1| thioredoxin-like protein [Syntrophus aciditrophicus SB]
    MDFELPDLEKRPFRLSQHRGKPVLLIFSTTWCAYCRSELPRFRDIHERYASGGPGGRSDLHSGIPTESLILCPPEQSPLS
    RPAGRKGRGL

    >gi|85860551|ref|YP_462753.1| thiol:disulfide interchange protein [Syntrophus aciditrophicus SB]
    MEMFTNRMAAARRTKILFMALVMLLACAVSSAAAGSVEEAFKKSFPQIPAEQISETPVKGIYEVLVGNQILYYAPESDCL
    IIGAMVTKDGKNLTEEKIEKVIAAKAKDLPLDSAIKIGRGPHRVIEITDLD
    CPYCRKASAFFSGRSDVTRYVFLYPLSYH
    KDAEAKVMYVLCAVDQGKAYEEAMKGKLDDMKFKPCKDARAEETLKNHREIVSRLGLSGTPFFLIGDEAVFGADIPRIES
    LLKSK

    >gi|85860594|ref|YP_462796.1| hydroxyacylglutathione hydrolase [Syntrophus aciditrophicus SB]
    MCGHAHFEQSVCRSYLVVFARVMVPVFSSRRLSMLFQRIESEGLAQYSYLVGDSREAVVIDPRRDIDVYLEAATFQGYRI
    VAVLETHRHEDFVLGSVELAARTGAEIWHADGQWDYQYGEAVGDGQTWKIGRLKLEAIHSPGHTPGSMSYLLYDADGNPW
    MVFTGDALFAGDVGRVDFLGEDRMKKMAWLLYDTLHRRLLPLGDEVIVCAGHGAGSVCAGDISDRLWTTIGLERRYNPKL
    QFPDRDAFIRGVARKLEYAPYFREMERLNLEGPPLLGALPVPTPLTAAAFASRLESSLVVDTRMELGFGAAHVPGALSIW
    LGGLPGYAGWFLPYDRPLLLIHDCDDLSPVVRYLIRMGYECPAGYLAGGMLSWHTAGYENRTVRMVPVTDLCRLLDAGEK
    AYILDVRSEEERETYGAISGALNIHLTLLPGRMDEVPKDGTVYIF
    CASDLRSMIAASLLERAGWENMAVVLGGLIGWNST
    TCKIV

    >gi|85860597|ref|YP_462799.1| copper-exporting ATPase [Syntrophus aciditrophicus SB]
    MSDKAILHISGMTCASCVRRVEEGLREMAGVEKAAVNFATEQAVVDFDPAAVKPEQLGKKVRELGYEVVRIDQPVSGGLD
    KTTISVGGMT
    CAACVRRVENALKTVGGVKDVSVNLATARATVLHEQTWNGVAGLKQAVTDQGYEFLGVLDELQEDPIAAA
    RIREIRDLRLRFTVGAVLSVIIFMGSMQHWFPFLHAIPPRPLQMVLFVLTAPVVFWVGSRFFVGALKAARQKTSDMNTLV
    AIGALSAYLYSALATFFPRFFAEAGIMPHVYYDGAAVIVTLILLGRLLEAGAKGRTSQAIRRLVGLKPKTARVVRDGREQ
    DIPVEELLKGDLIVVRPGEKIPTDGIVRSGASAVDESMLTGESVPVNKEPGNEVFGATLNRSGSFTFEATKIGAETALAQ
    IIRLVEEAQGSKAPIQRLADRVAAVFVPTVLAIGLVTFIVWYFFIPEPVFSRALLNFVSVLVIACPCALGLATPTAVMVG
    TGLGAEHGILIKGGESLEKAYRLTIVVFDKTGTLTRGEPEVTDIVPAEGFTPQNVLQTALSIESLSEHPLAQAIVKRGKA
    EGLSPLPVENFEALSGLGTRAKIAGRSCLLGNPRLMVQEGMALQGLDRQAADLAGQGKTCVLVAEEGLVIGLIALSDVPR
    ESAGAAIAALKVAGLRVAMITGDNASTGQAIARQLEIDQVLAEVLPGDKAREIRRLQQEGQIVAMVGDGINDAPALTAAD
    IGIAIGAGTDVAIEASDITLMTGDLQAVPRAIRLSFETMKVIRQNLFWAFIYNIIGIPIAAGVLYPFFGILLNPEFAAAA
    MALSSVSVVSNSLRLRHTGLKKDKNG

    >gi|85860746|ref|YP_462948.1| rhodanese domain-containing protein [Syntrophus aciditrophicus SB]
    MFKKRSVWILATLAVFLLGITGNALAAWGTKELQTEKSAVALAREMDRGNYKLVTTEELKSWMDKKTPMLIVDTMPYEAS
    YKKQHVPGAVQMEFPIPEMTTLDDGKKAALEKLLGPDKNRLVVFYCGFVK
    CTRSHNGAMWAVKLGYKNVYRHPGGIMAWD
    QAGYPVEKVK

    >gi|85860749|ref|YP_462951.1| SAM-dependent methyltransferases [Syntrophus aciditrophicus SB]
    MMTKITDWQRIEYDSIPIYVRPDIPDWFVPNQAADEALVEFEEKGQISGDISNLLKRIEGPAGTSYFSRSGHLNLDGLKE
    CWLHITNRCNLECRHCMFQSSPRERDELEPEDCNRIIREVYALGCRLFFFTGGEPLLAEAFFSSVQEILQRPDTHIAVLT
    NLSLLPGSKDFFQTLPQERLHFQVSVDGLESNHDALRGPQSFRRLNENLAMLRELGFPITLSMTVNRSNVGEMAGIIDFA
    SSQCVSNVHFLWLFRKGNANEGFFVDPDKIFLHLKAAWERADRLGVKIDNIESIRSQVFSCPGTRYDLSNAGWQSLAIGP
    DGQVYPTPALVYTEGMRCGPVSEGLKEVWENSPVLKAVRNASLDTSEVYRANPFRYIIGGGDIDHSYLSSGQIAGDDPYG
    ELYTSIAKELIVREARQYETVGYPAFKLKMGEKLGECPVEGSAVFFTHSNCVLTLPGHDIHTQVNRFYSGAAETLQEDIL
    NPICYEESLIAHIPEEKRYRSYGCGSPVLEANIQPGESVVDLGSGTGIECFIAGRLTGPQGRVIGIDMGDAMLDVAEKTK
    VRVTESLSYDNIIFKKAFLESLPLDDRSVDLVISNCVLNLSPDKRRVFQEIFRVLKPGGRLIISDITCNQDIPLEIKYNE
    KLRGE
    CIGGALRYLDLFGLLNDLGFSHSRIVSGYPYRTVKGYDFHSITYSAVKPAENQRPVLYDFPDFESLMKEVETEPT
    CACFAAPEQPSQKPVLNDAPHRSGCLLCGAELLYFDVDRSLSCFYCGRSLPANTQCVNGHFVCDSCHSADAVGIIRQVCL
    NSREADAVVLMQTIRSHPHFRIHGPEHHSLVPAVILTALRNSGDDISDEQILTGIQRGQTIAGGACAFLGACGAAIGVGI
    AFSVLTAATPYDGEKRQTVQQVTRKALGEIASYDAPRCCQRDSWLAIQAASRILEEKLGKFLKADRALACEQFPQNKECI
    LNRCPLWPHREEDPK

    >gi|85860767|ref|YP_462969.1| hypothetical protein SYN_00354 [Syntrophus aciditrophicus SB]
    MKWKTADGGWNPYLAGALLGILAIVSVCATTQLLGKSTYLGASTTFVRAAGLLERTVAGEHVSLNEYFTKEKVRVDWQFM
    LVCGIFLGALISSLSDKSFKLESVPPTWEKRFGPSIGKRAVGAFLGGIVAMVGARMADG
    CPSGHGLSGMMQLSVSSFVAL
    AMFFCVGVIVAAIVYGRRAS

    >gi|85860782|ref|YP_462984.1| glutaredoxin-like protein [Syntrophus aciditrophicus SB]
    MKIKVLGPGCARCNQTEQLIRETVAEAGVDAEIEKVTEVMKIAQYGVFGTPAVVIDEEVKSVGKIPRKEEILAWIKEKSA
    A

    >gi|85860784|ref|YP_462986.1| glutaredoxin [Syntrophus aciditrophicus SB]
    MSERRTIMGEKIRIYGTEMCPFCRKAREAYGEKAVFINVGGDPEKLAEMLAYSGGNRTVPVIVDGDKVTVGFLGDSSSQG
    NVPLFGGG

    >gi|85860866|ref|YP_463068.1| sodium-translocating NADH-quinone reductase subunit E [Syntrophus aciditrophicus SB]
    MSTLMKRSILLSIWLVSIFLASLPVCGHAAENSFAKKTDFKDNRTIVIEFAGAVDEEWATSPANFKVNEKQNPDVLLPVE
    KVELSPDKKTVLIRFGEDIDLRAAHVVSMTPVSSEGKNMGPAILDVKKSYFGYLFSILIGAMLINNYVFTKYLGLCVFIG
    TSRKKDTAVGMGITFTIVMVVSAMISWFLYQYVLKPYRLDYLQVVVFIGLVSLTVQAVDTVLRKVNPALFKAFGVYLVLV
    IAN
    CVIIAVPLTLASNEYNAFESFMLALGAGGGFLLALFLMSASRERLELANVPPTFRGLPIAFVATGLFALAFMGFSGM
    AIF

    >gi|85860976|ref|YP_463178.1| thioredoxin [Syntrophus aciditrophicus SB]
    MSGTEDGQGLRIKNSLETGRDRASGFFMKEDDDIIIRCLNCGTKNRIPKGRFQEHPACGRCHAPLDDMIIRCLRCGTKNR
    MPENRLNDSPLCGRCGAPLIVDSSQHQPMDVMDSTFLREVLTFAGSVLVDCWAPW
    CGPCRALSSILEELALKYAGGIKIV
    KLNVDENPLTAQQFGVRNIPTMLFFRNGKLVHSLVGLLPKEEIERHLLSVMETN