Syntrophothermus lipocalidus DSM 12680 uid49527

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|297616246|ref|YP_003701405.1| hypothetical protein Slip_0033 [Syntrophothermus lipocalidus DSM 12680]
    MQREKLLFAVTGVVIGGLAVLLVLSGNPANMGMCIACFLRDITGSLGLHRAGVVQYMRPEILGLSLGAFVTALGAREFRS
    RGGSAPFVRFFLGMFMMIGALMFLGCPLRDILRISGGDLNAVVGLFGFVSGVLWGVFFLRQGFNLGAARLEPTTQAGGYL
    FVALVTVMLFLLVAGINFNPEAGGPLFFSKEGPGSMHAPIWIALAAGLVIGFLAQRARLCLSGGFRDFFLIRETGMLLAY
    GGILVTALILNIVFGKFNLGFANQPVAHTNHIFNFLGLFLLGQCAVFLGG
    CPLRQIVMASEGDMDAAVAVAGMVAGAAVA
    HNFMLAASPKGPTGFGEIAVIAGILIVSLIGWAYREEV

    >gi|297616540|ref|YP_003701699.1| thioredoxin [Syntrophothermus lipocalidus DSM 12680]
    MSAVQQFGVNDFDAEVLKSDIPVLVDFWAAWCGPCRMVGPVVEEIAQDFAGRLKVGKVNVDENRTLAAKYGIMSIPTLII
    FKNGQEEERLIGYQSKGELAAAIEKVLG

    >gi|297616904|ref|YP_003702063.1| Thioredoxin domain protein [Syntrophothermus lipocalidus DSM 12680]
    MSAIIDVGTSEFVEEVLTSQLPVLVVFRAPWCGFCQLMNRVLEAIARDYDGRLKVVRVNADENRNLAAWYEVYAVPETIL
    FVDGHEQQRITGYRERDELARMINRVIFHA

    >gi|297616986|ref|YP_003702145.1| heavy metal translocating P-type ATPase [Syntrophothermus lipocalidus DSM 12680]
    MDKAVTIPDAAFSADIYVRGIDCPDCAARVEQAVKGLPGVINAKVLVRSSKLAFLYDPALIEVEQVVSKVSELGYTTTKA
    EGCSNTGALAEGITSTIRIFGLD
    CGDCAAKLETGLRRIPGVKRAVVNLALSKVEVDHSGPLPEILKTIEAMGYTAKLEDR
    RLKSGFDGQNTATSKYALPTVLSGTMVAIGLFFGLLGLPDSIVSAAYLVAILFGGYLPARNGWAIIRSARELDMNVLVVI
    AVAGAVAIGRLEEAAAVVFLFSLGNTLQGYTFERTRSSIRALMELAPDEAVVRRDGREEVLSVQDIRIGDVVIVRPGERV
    PVDGRILEGTTFVNQAAITGESVPVEKKPGDEVLAGSINGMGALEVEVTRAAQDNTVSRIIRLVEQAQTQRAPSQQTVDR
    FARYYTPIVITAAILVAIVPPLGLHQPFNKWLYEALAMLLVACPCALVISTPVAVVAALGNAARNGVLIKGGGYLEEAGT
    LSVVAFDKTGTLTVGEPRVTDVVPLTATAQEVIQVAAAIEARSEHPLGEAITKYAKDAGIDAPAVSGFRSVPGRGAQGNI
    GDKRYHIGSERFIAELGISLAAARKDIARLQSCGKTVIIVGDDKRVLGLIATADTLREHSRAAVSKLKQLGIRKTVMLTG
    DNESTASAVGREVGIDEFRADLLPEGKLDVIRDLLAKYGKVAMVGDGVNDAPAMAASTVGIAMGAAGTDAALETADIALM
    ADDLLKLPYTVKLSRKAVSIIRQNIAFSLLLKGIILLLVIPGWLTMWLAVAGDTGTSLLVTLNSMRLLRARD

    >gi|297617032|ref|YP_003702191.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Syntrophothermus lipocalidus DSM 12680]
    MSKKVVIVGGVAGGASAAARLRRLDEEAHIVMFERGEYISYANCGLPYYVGGVIRDRKKLLVQTPEAMRRRFNIDVRTLS
    EVVRILPGEKEVEVKNLATGEAYRESYDYLVLSPGASPVVPDIPGANLENVFTIRNVPDSDAIKAHIETRKPSTAVVVGG
    GFIGLEMAEVLMACGTKVTLVEADTQVMRALDPEMAAIVHCYLRDNGVDLRLGDKLVSIKGSSGVEEVELASGKTLPAEL
    VILGIGVRPEVWLAKEAGLEIGPTGGILVDEYLRTSDPFIYAIGDAIQVKDYVTGQDVLIPLAGPANRQGRLVADTIAGQ
    PTPYKGSQGTAIVKIMDMVVAVTGSNEKTLNRLGREHLACHTHPAPHATYYPGGTPMAMKLIFSPGDGKVLGAQIVGYEG
    VDKRIDVLATAIRAGMTVFDLQDLQLAYAPPFSSAKDPVNMIGYVAGNMVQGNVEIAHWHEVDKRLAQGALLLDVRTKRE
    VEDGAVPGALNIPVDNLRERLSELPKDKEILVY
    CQVGLRSYIAYRILRQHGFTAKSISGGYRTYHMVGKDKACFESGNA

    >gi|297617561|ref|YP_003702720.1| fumarate reductase/succinate dehydrogenase flavoprotein domain protein [Syntrophothermus lipocalidus DSM 12680]
    MPEVLIIGGGVAGLEAALTLAEHEIESVIIEKELRLGGKASLYNCKAVDGVCQACGACLAGQRVRAVEEQELVKALVAAR
    VAGMRNLQDGLEVDVETPNGRLTFQVRGIIVAAGIDTFSPALRAEFGYSHLPGVVTALEIEGIIRESPEILGESPRLAFI
    QCFGSREVGAGVPYCSRVCCLYVPKLAGLVKGELPGSRVDIYFMDRQRYEALYRPKTSFCTHIRAMPSKVHLMGSKELEV
    IYDDPETRKPTARRYDWVVLCPALVPGKDLPSLASLLELGTGRGGFLQVGAGGTTNRDRVLAAGACTGPMSIIESIASGR
    AAAGKMASELRRQR

    >gi|297617827|ref|YP_003702986.1| copper-translocating P-type ATPase [Syntrophothermus lipocalidus DSM 12680]
    MDRVTFKVKGMSCAACAARIEKGLARLPGVSEARVNLATEEAWVEFEPSQVDFEDIVKRVEKLGYSVSASNKGATYLAAD
    DESELEEYKRRLVFAAVLSLPFLVIMAGHLLGLRLPGLLTSWLTQAVLATPIQFGAGFPFYRGAYLALRGRAANMDVLVA
    LGTSTAYLYSLVSSWLIPGSHVYFEVSALLITLVLLGKYLERRAKGRTSEAISKLASLQPNMARVIRDGREIEVPVAGLK
    AGDVAVVRPGERIPADGVVIEGYSTVNESMLTGESVPVDKQVGDTVVGGTVNEFGHLRVQVVHAGEDTVLARIIRAVKEA
    QASKAPIQRLADVVAGYFVPVVITIAVVTFAGWFWWGDPGNLEHALVNATAVLVIACPCAMGLATPTSIMVGTGKAAEMG
    ILIRGGEPLERASKVDTIVLDKTGTVTKGVLQVTDIEMVPEVGIEEKTLLGMAAALEVMSEHPVAQAIASAVIERTKQTL
    ASDIRDFVAVPGKGVVAKVDGKTVMIGTSRFLAEAEVDILQLGETLERLQAEGKTTAVVAIEGIASAVFGIADTIKEHSS
    EAVQRLKDMGIEVWMITGDSRRTAESVAEQVGIEREKVLPEVLPEEKAREVRRLQAQGRRVAFVGDGINDAPALASADVG
    IAMGTGTDIAMEAADITLVKGDLCGCPRALVLSRATMRNIKQNLFWAFIYNLIGIPVAAFGFLNPVFAGGAMALSSVSVV
    TNALRLKRVKVY

    >gi|297617833|ref|YP_003702992.1| methylated-DNA/protein-cysteinemethyltransferase [Syntrophothermus lipocalidus DSM 12680]
    MRYSVFETAWGWVGLAGHSARISFLVLPLPSPEAVVTQIIEKTGPDLVRDQGLFVSVTEKVEGYFAGTVVEDWGIQVDFS
    LYPEFTRRVLQQVSCIPYGQTRTYSDIARAVGQPGAARAVGQALKRNLCPLIIP
    CHRVVARHGFGGFTAPGGVELKKRLL
    EMERATAR

    >gi|297618226|ref|YP_003703385.1| 4Fe-4S ferredoxin iron-sulfur binding domain protein [Syntrophothermus lipocalidus DSM 12680]
    MKRVGVFVCDCGTNIAGVIDTERVAKEALTMPGVVFATNYKYMCSDPGQDLIKKSIKEHRLEQVVVASCSPRMHENTFRK
    AIADGGLNPYLFEMVNIREQDSWVHSDKGQATKKAIDLIRMAVFKVLKNKPLTSGTIPITKRALVIGGGIAGMQSALDIA
    DAGYEVILVEREATIGGRMVQLDKTFPTLDCSA
    CISTPKMVAVAQHPNIKMYTYSEVEAVNGYIGNFTVTIRRKAKYVDW
    DKCNGCGTCETKCPSRNLKSEFDLGLGTRTAIYKAFPQAVPNKPVIDAANCRKFKTGKCGVCDKLCPTGAINFEDKDEIV
    TENVGAIVMATGFDLFDWTQTYGEYGYGQYPDVITGLHFERLVNASGPTGGKIKRPSDGKIPESVAFIKCVGSRDDTKGK
    TYCSRACCMYTAKHAMQVLEKIPGAEAYVFYMDVRTAGKSYEEFYQRSLKAGAKYIRGRVSKIYPRGDRLVLKSEDTLLG
    RPIEVEVDMVVLATAMVPARGAEEIAKLVGFSTDKDGFFQEAHPKLQPVETFTGGVYLAGACQGPKDIPDTVAQASAAAV
    KVCALFSKSELATQPMVSEVDASKCSGCELCVPICPYKAISMKAVQERSHGHVIERKVASVNEGLCQGCGACVGACRSGA
    LNLKGFTDEQIVAEVDALCL

    >gi|297618327|ref|YP_003703486.1| Methyltransferase type 11 [Syntrophothermus lipocalidus DSM 12680]
    MEKDVRQEVREFYGRLAEQAKAGAPASCCSGGSCCTPIANAIVLYDLDNLEDLPREAVNFSLGCANPLLLADLKEGEVVL
    DLGSGGGLDVLAASKYVGPSGTVYGLDMTDEMLDLANRNKEQMGVTNVEFLKGFIEDIPLPDESCDVVMSNCVINLSHDK
    EKALAEAYRVLKPQGRLCIADIVSVKPVPESARELASLWVS
    CIAGALDVKEYENILGKVGFKDIEVQPAIVYQGKVLEDI
    AGNSLKNLSESEARELDGAFASAYVKARK

    >gi|297618332|ref|YP_003703491.1| dihydrolipoamide dehydrogenase [Syntrophothermus lipocalidus DSM 12680]
    MGEQVFDVVFIGGGPAGYQGAIRAAQLGMKVAVVESRELGGVCLNRGCIPTKAIRASVEVLSRARRAKAYGIEIETARPD
    IKAIIARKNKVVGLLRGGISQLFRSRSIEHLEGTGTLLSPREVEVETANGIIRLKAGKIVIATGSRPSIPSPFTGLTGEN
    KGVLTTDDILEVSRVPASLLIVGAGAVGVEMASIMAELGSSVTLLEMKDRILPGEDLEMASYMTRMLKRQKVKVLTGLSV
    NEAAVGDKVTVMLSNGQKWEGDAVLMAAGRVPNVESIGLRAVGLAENGRPLAVNEHMETGISGIFAAGDVVGGWLLAHVA
    FAEGITAAENAAGLTSRMDYRVVPRCVFAFPEYAAVGLSEEEAKEQFPATAFSFPFKSLGMAQALGEWEGMVKLVVHEKN
    GQILGGHVIGPHAADLVAEIALAMRHQIPAKGIVDTIHTHPTLSEAVLETAQAACGQAIHMLPGEHTNK

    >gi|297618475|ref|YP_003703634.1| thioredoxin reductase [Syntrophothermus lipocalidus DSM 12680]
    MFSIVEIRDFRVNLTEDLSLEIVEGGASEMDRYEVVIIGGGPAGLTAGIYVARSRLRALLLEAAFPGGNAALTDQIDNYP
    GFPFGISGPELADRFRQQAERLGLEIRIAEAKKIALEGDLKRIDTDKGSLVADIVIVAAGVRRRELGVPGETELVGKGVS
    Y
    CATCDGPFFENRRVAVVGGGDSAVEEALYLSGLAERVYLVHRRDTLRANRMAQEKLLANNRIELKLNRVVERLEGEKML
    KALVLKDTVTGDLERLEVDGAFVSIGMKPALEFLGNLVELKEGYIVTDENMHTSVPGILAAGDIRYKTDRQIATAVGDGA
    IAGMEAVRLLENRR

    >gi|297618495|ref|YP_003703654.1| selenide, water dikinase [Syntrophothermus lipocalidus DSM 12680]
    MAGEARLTQMVRAAGCAAKIEPGALDGILNGLYSPSDPRLLVGFEKFDDAGVYLLRDDLALVQTVDFFTPMVDDPYWFGQ
    VAAANALSDVYAMGGQPLTAMNIVCFPACGDIEVLREILRGGIDKLKEAGTVLVGGHSVDDNEPKYGLSVTGIVHPNQII
    RNDTVKPGDIIFLTKPLGSGVIATAIKAEMAEKSVQVECIKWMTTLNRAAKDAALAAGVSAGTDVTGFGLVGHLFEMAKG
    SGVAVEVYADQLGFMTGAREYAAVGLIPGGAYANREYLGQRVVFEEGIDPEIKDLMYSPETSGGLLLAVGEDRKADLVRA
    LDREGLPLFLVGRAIPSESPRVEVKGGR

    >gi|297616733|ref|YP_003701892.1| hydrogenase, Fe-only [Syntrophothermus lipocalidus DSM 12680]
    MVSVVINGSKVDVPEDFTVMQAAAQAGFMIPSLCSHPDLKVKENCNVCVVEVNGELKNACAEKVSPGMEVKTFTPRVIEA
    KRENLKKILKVHPQDCLQ
    CARNQNCELQALTATLTVRSFEHKPLQLTKDTSTPSIVRDPSKCTLCGRCVEVCNDIQTVGA
    LEIKDGVVQTVDGKPLIETKCVMCGQCALACPVGAITEKEEIDRFLEAIADPEKIVVTQIAPAVRVAVAEEVGMETGSLD
    MLTFVAGLRQLGFDYVFHTNFTADLTIMEEGNELLKRLKEGGTLPMLTSCSPGWINFIETFYPEQLPHLSTCKSPQQMFG
    ALVKTYWADKMGIDPAKIFSVSIMPCTAKKYEATRPEMRDSGYQDVDLVLTTREVGRLFRMCGVGFDKLQPSNFDSLMGA
    YTGAAVIFGASGGVMEAALRTVYEVVTGKTLEDVNFTAVRGFEGMKEAEVDLDGTKVKVAVANSLGCARKIMEEIKAGTS
    PYHFIEIMCCPGGCIGGGGQPIPSTVAKRVERIKGIYIEDEGLPLRKSHENPEVKLLYEDFLHEPLGHKSHELLHTHYTP
    KNK