Syntrophomonas wolfei Goettingen uid58179

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|114566014|ref|YP_753168.1| thioredoxin [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MADIKIFNQDNWEKEVMQSDLPVLVDFWAPWCGPCKMVGPVVESLAAENAGKINIGKVNVDENQDLAARFGIRGIPTLAF
    FQGGSEVKRIVGAQNKAQLQKAIDEVSGS

    >gi|114566825|ref|YP_753979.1| thioredoxin-disulfide reductase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MQNEFYDITILGCGPAGLSAAINATIRNKKVLIIGAEICSPPLHKAQKIDNYLGVPGVRGEELLARFMEHALDMGIEIIS
    TKAEAINEAEGVYNILVKEEMVKSKAIIIATGIPYKPTLPREEDMLGRGLGY
    CATCDGPIYRGKDVLLIAHSSEAESEAN
    YMAEICRKVYYLPLYQETMELDPRIEIINGKPGEIIGSDFVQGLKLKDGSEIRVEGLFVLGGETAPDRLIPGLEISNKHI
    KVNRQQETNLPGVFAAGDCTGPPYQVAKSVGEGQVAGLNASKYVGRK

    >gi|114567118|ref|YP_754272.1| methylated-DNA--protein-cysteine methyltransferase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MKWLVFDTSWGWAAVLSDNRLIKQTILPSAVGLNEFKASLESNGIESRLIGENDVTLPLINNIRRYFQGQLIENWEAQWD
    INSLPVFTQKVLKHVSNIPYGMTKTYGEVARELEKPRAARAVGRALSLNPLPLLIP
    CHRVLAQNGGLGGFTAPGGVETKK
    ALLALENEVITRRKPD

    >gi|114567188|ref|YP_754342.1| ferrichrome-binding periplasmic protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MRKSMALLLIMVFLITVFCTGCGQQSATSAPEAVPAEKTITDMAGNMVVVPANPERIAFHWANQYEIMMILGAADDIVAI
    HPNVKKFVWLVKYKPEVLNLPTPFADPVNFEELLKTDPDLVFEFEH
    CADTIEKCKEVGLTVAVLSKAKSIKNIRENIMFI
    GQTLGNEHYEKAKKYDAYFSEKLKMVNSIIAGIPDGQKPTVACIITDASLRVGGTDTIMDEWIEIAGGKNIAREIPGYKV
    VDNEQLLKWNPDVIITPSNRAKNLIVNSPVFKELTAVKNDRVYVNPHGFFDWQYPSAEEALQIQWAAKTLHPDLFPNIDM
    RKEVKYYHQQFLGFSLSEEEIDTILFPEIYEAT

    >gi|114567194|ref|YP_754348.1| periplasmic binding protein [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MKKKELVILAMLALLIISGMLITGCGKEKAADTTATTRTIVDMAGREVTLPAEIHSLATIGPGPVLNSLIFAVGEGGKIV
    NGLPDFARSERWKYQHKFAPNISEQPMVQTSDFQPNVEEMLKLKPDVVFTMEARGS
    CEQIAEVLTNAGLPTVCLVWTEPD
    EVKQAINMIGEVLNQETRAQEYSKYFDDTIARVSKVVDSIPEDKRPRVLHCNIQSMTAPHTITEWWVSQAGGKSVTKEVR
    VSENIEFSVEQLLKWDPQVIIVSSPDQVNLLCNDSRFKEVSAVKSKQVFPTPVGAHIWGNRTSEQPLMLLWAAKTFHPEA
    FKNLNLEEELIQFYKHFFNYSMNVEEAQEILGGGPKVDPGKKK

    >gi|114567212|ref|YP_754366.1| copper ion-binding [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MEEVILNVEGMSCNHCKMAVEKSLQSLSGVKKADVDLAAKTVKVAYEPGKLTLKDFEEAVAEAGFELVK

    >gi|114567213|ref|YP_754367.1| cation transport ATPases [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MEEIKSTIKIGGMSCAACSARVEKKLNNLPGVKQAQVNLLSNKATTFYDPEIIKLSDLEEAIRQIGYEVLPEEDGNYINA
    TLAIEGMS
    CAACSARIDKKLNSTPGVVNASVNLLTNLAKVKYDPQLISIDEVEKVVDKLGYPTHWIEQREHPIDSPDKNT
    EIKKLKFLLGASAILAFPLILNMVLMLFDIRVSFLHNPYWQLALATPVQFIIGYRFYRSAFLALRSGGSNMDVLVVLGTT
    AAYFYSLYNISQGEMHNIYFEASATIITLILLGKYLEERAKNKTSEAIRVLGSLQPRSARVVRQGEEMDLPIEEVRTGDL
    VVIRPGERIPVDGIVEEGHSAVDESMLTGESLPVEKRPGDPVVGASINKNGSLKFVVTRTGQDTTLAQIIRIVEEAQGSK
    APVQKIADQVSGIFVPAVMGVALLTFILQYWIKADITIAVTTAVAVLVIACPCALGLATPTAIMVGTGKGAENGLLIKGG
    GFLELLHKVDVVVLDKTGTITRGKPALTDIIALGSYEGDEVLRWAGILEKHSEHPLGEAIYASAREHYGNLPDPEDFKNY
    PGQGVMGKSANQALAIGNRSFMHSQAIDTAGAEEQARLLEEAGKTAMYLAIDGKLAGLLAVADTIKENALAAIQALKDMG
    LEVYMISGDNQRTAQAIARQVGIETVLAEVLPEKKAEEVEKIRQSGKIAAMVGDGINDAPALATADIGIAIGSGTDVAME
    TAGIVLMSGDLRGISAAIKLSRQTMRIIKQNLFWAFFYNSIGIPFAALGFLSPVIAGAAMAFSSVSVVSNSLRLRRFEP

    >gi|114567348|ref|YP_754502.1| NADH oxidase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MRIIIIGNGAAGNQAAQTIQNYDPEAEITILGAESIPFYSACALPDYLAGWIKRDQLFLRSSLDRHRVEIRLGQAVEDIK
    PDRQAVSAGGELLLYDRLIIASGSRPVLPNIPGTGLPGNFVIKSVYDIDRILSYNPRRIAVIGSGNIGIEAAEALASRGC
    QVSIIEMMPRIMPRLFDQQPAMLIRNILEENGIEIHTGEKAREVIGKNRVEGLITDCRRISCDAVIWAAGVRQNTELARA
    AGIEIGGLGGIKVDSQMKTSHPAIYACGDCVETSDLLTGKPALCLLWSCAKAQAEIAARNCLGEEIVYPGALKLIAEEAY
    GKPCMAAGLLEEELDRTGLKIIEKETENAYHRILIKNERIMGIQAVGSMEAMGPLLYFMKKMIRPSEIKRIVNSPALLKN
    MPWMLAIDKYLQ

    >gi|114567416|ref|YP_754570.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MNNKLLIIGGVAAGMSAASKARRIDSELEITAITDDQYVSYAGCGLPYFIGGKIPEQAQLIARRPEDFAQQNISVKTRVR
    ARLIRPEQKCVVTENLETGQLSEESYDRLLVCTGARPYIPSLEAINLEGIFVLRTIHDSLAIKAYMHQHIPKRALIVGGG
    YIGLEMVENLLEYGCEVILLERSSHLLPNMDEDMALILTSYLQSRGVEVRTSENLTGFAGDSRVREAFTDKGSLPVDFVL
    LSMGVVPNSELAAAAGVELGIRNAIRVNDKMESNLPGIYAAGDCATTKHLVSGQEVYIPMGTTANKQGKVAGENAAGGSA
    RFAGVLGTGIARAMEMELSRTGLCENECRQLGIDFISRRVKSRTAAHYCPVSGEIHVKILAEKPSGHILGAQIVGFAGAA
    KRIDMLATAITMRATVESLIDMDLAYSPPFSPVWDPVLVALNQF

    >gi|114567491|ref|YP_754645.1| hypothetical protein Swol_1978 [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MNDLLVIGGGPGGYVAAIRARQLGMKVALVEKDKLGGTCLNRGCIPTKTYYRHAEIMRSLQRLDEFCIQLDAEPARLDMA
    GTRARKDAVVEQMAGGVADLLQAHGVEVIRGEAVVEEPGRVRVGEESIRAERLLIATGSESIRPAALPGAALPGVLTCEE
    LLERSAIPGRLLIIGGGVIGMEFACIFQAFGSQVTVLESLPRALAFLDQEIARRMSVLFKRQGIEIKTGAKVESINTQDD
    HLLITASDKKGNVQYEADLVLLAVGRSPVTAGLNLEKLGVETEQGFIKVNQDYESSVGGIYAIGDVIGPPMLAHVASEEG
    RVAVERMAGMDSRLNYEAIPHCIFTFPEIAAVGLTQEEAAPRGIDCKIGKFQFAANGKAVAMGESEGLIKVICSPDDTVL
    GVHIIGPHASDLILEASLLVNLGMKVEEALHMVHPHPTLGETLYEALLDVQGRAIHLKPPRK

    >gi|114567595|ref|YP_754749.1| cadmium-transporting ATPase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MGYEVREEKEAFEGRADSQASFAGVSPLDFPDSKSSVIRLEGLDCADCAAKLERTILAMSGVKDARVNFAAAKVKISHQI
    PLSEILKVIEKMGYRGREEGGAGAEEKISLWKSNKYYLSTLLSGMLLLIAVSQQIMQISETWVHASYLLAIVLGGYLPAR
    AGLALLLTSWEADMNLLMILAASGAVAIGQLAEAAVVVFLFSLGNALQGYSMDKTRNSVRALMDLAPPEALVRRNGREQV
    MPVESIVVGDIFIVRPGEKIAMDGVILKGSSALNEASITGESIPVDKGPGERIYAGTINSWGALEVEVERLAEDNTINRI
    IAMIEEAEEQRAPSQQFVDRFARYYTPAVILAAILVALLPPLLLGQPGEKWFYEALAMLLVACPCALIISTPVAIVSALG
    AAARNGVLVKGGVHLEEMGSIKVLAFDKTGTLTRGKPRITDIISTRGLDENEVLRRAASLESRSEHPLAETVVEQARKLG
    LELAEVSNFRAMSGRGAAAEIEGKSCYVGNQRLFSEVGIAIQGQEELIAELEGAGKTLILLGDEKELLGIIALADELREN
    SREAIRQLKKKGIKKSIILSGDNERAARAMALSVNVDEYQAGLLPEDKVQAIRALLEKYEKVAMVGDGVNDAPAMAISTV
    GIAMGVAGSDAALETADIALMADDLSRLPYTVELGRRTLRIIRQNIVFSLLLKALILSLVIPGWLTLWLAVAGDMGTSLL
    VTLNGMRLTRVKAES

    >gi|114567598|ref|YP_754752.1| hypothetical protein Swol_2089 [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MDRTKWYVLTVGLLIGAIAVTLVKLGNPPNMGFCIACFERDIAGAIGLHRAGVVQYMRPEIIGLVLGALLASLFAGEFKS
    RGGSATFVRFILGVFMMIGALVFLGCPLRDVLRMAGGDYNAVVGFIGFIFGVGTGVFFLKRGFNLGRAEYSHSQAGGLVL
    PLIMAFFLFLLLKATVFNPDAGGPLFFSAEGPGSMYAPLAFSLGAGLLVGILAQRVRLCLSGGIRDFMLIRDNTLLLGFI
    GIFIGALLLNIALGFFKTGFAPQPVAHTMHLWNFLGLYLVGMTATLLGG
    CPLRQLILSGEGDTDAAAVVVGMIVGAAFCH
    NFMLASGAMKAAAAGVAASPGGPGIYGQLACIVGIIVVAAIGFAFQED

    >gi|114567977|ref|YP_755131.1| thioredoxin-disulfide reductase [Syntrophomonas wolfei subsp. wolfei str. Goettingen]
    MYDVVIIGSGPAGLTAAIYTSRAKLKTLVLESSVFGGNAALIDHIDNYPGFPFGVSGADLMENFRLQAERFGAELRMEEV
    MDLKNASGAIKTVVTNMQEYQTKSVIIAMGAKRRELEVDGEKEYLGRGVSY
    CATCDGAFFQGTTVAVVGGGDSAVKEALY
    LTGIASKVYLIHRREGFRANQTALEKMMNNEKIELKLNRVVKRVEGDALMKSLLLKNLKTGEEERLEVEGLFVSIGLVAR
    TELFGGMLESREGYIVTSDNMMSSIPGIFAAGDVRAKKERQVATAVGEGALAGIAVSEYLQE