Bacillus megaterium QM B1551 uid15862

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294497142|ref|YP_003560842.1| organic hydroperoxide resistance protein [Bacillus megaterium QM B1551]
    MKALYETTVVNTGGRTGEVHSLDNIFNLDVATPPALGGEATTATNPEQLFAAGYSACFNSALEFMLKKHNVEIKSSEVKA
    TVQLLPDKADQGVKIGVALEAHIEGLDLETAKKYVDLAHSY
    CPYSKAISGNVDVTVEVV

    >gi|294497173|ref|YP_003560873.1| methionine-S-sulfoxide reductase [Bacillus megaterium QM B1551]
    MEKATFAGGCFWCMVTPFEELEGIHGIVSGYMGGTVDNPTYEQVKSGTSGYYEVVQITFDPEVFPYKRLLDLYWPQIDPT
    DDGGQFQDRGSQYRTAIFYHNDSQKQAAEETKLAVAESGRFKKPIVTSILPASTFYEAEEYHQDFHKKNPKHYKEDRAKS
    GRDEFIQTNWK

    >gi|294497230|ref|YP_003560930.1| putative thioredoxin peroxidase [Bacillus megaterium QM B1551]
    MTAVVGEKAPDFVLMSTNGEQVSLASMKGKNVVLYFYPKDMTPGCTTEACDFRDQHENFEELDAVILGVSPDPIDKHHKF
    IDKHGLPFLLLADEDHSVAEEYGVWTLKKNFGKEYMGIERSTFIINKEGMLVKEYRKVRVKGHVEEALSFIKEKMA

    >gi|294497343|ref|YP_003561043.1| adenylyltransferase ThiF [Bacillus megaterium QM B1551]
    MINRYSRQELFQPIGKGGQQQIQEKHVLIVGAGALGTGNAEALARAGVKKITLIDRDYVEWSNLQRQQLYSEKDADKRIP
    KAIAAKKRLHDINHDVKVEAHVADGTPQVLEQLVEGVDVMIDATDNFDTRLVMNDLSQKYDIPWIYGACVGSYGISYTII
    PSETPCLSCLLESVPLGGLT
    CDTVGIISPAVQMVVAHQVTEVLKILVGDWNALRRELVSFDVWKNEYTSINVNVFRKSAC
    RSCGSEQTYPFLQYENQTKTAVLCGRNTVQIRPGKSAKQPLQSLGERLKEKGYKIEQNPYLLSFYVDDYRLVMFQDGRVF
    VHGTNDIVEAKSLYHRYIG

    >gi|294497481|ref|YP_003561181.1| Competence regulatory protein Spx [Bacillus megaterium QM B1551]
    MVTLYTSPSCTSCRKAKAWLEENDIGYTERNIFSEPLSIDEIKEILRMTEDGTDEIISTRSKTFQKLDVQVDAMPLQDLY
    ELIQQNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRTFQLREAQRLVNG

    >gi|294497491|ref|YP_003561191.1| hypothetical protein BMQ_0723 [Bacillus megaterium QM B1551]
    MHQLCQGSNKKPLEIYVFVDPLCPECWALEPILKKLQIEYGQLLSLKHVLGGNLQQLNIGAQQKFEHIAKSWEKTGSRSG
    MSCDGNLWLENPIDTPYAASIAIKAAGLQGKKQGIRFLRRLQEVVFLEKQNVTEESVLIQCAKHVGLDVNEFVKDLHSDY
    AAKAFQCDLKITSEMDVDEIPTLVFFNEKVEEEGIKISGYYSYETYVHIIKEMLEIDPDPACLPPLRSFLSYFQFVASKE
    VAVVYGLSLEEAEKELKKLQLQQVVERVPVKYGTFWRSTEKSC

    >gi|294497528|ref|YP_003561228.1| DSBA-like thioredoxin domain protein [Bacillus megaterium QM B1551]
    MKAHIEFYFDFVCPLCFLATKPLREVIKEQKAEIEWKPFELCPEPAQQMEQIEDFLERPWNQSIAPLAQQLHVEINMPDM
    PPVPRTHLAHEGFHFAKKHGQEIAYVDAVFKAYWEEEKDISQIEVLAEIADSLHLDQEIFTRILKDRTFEQVHKDSLVHA
    YEDAHVTKVPTLKIGSRVFQGFASKETLEKALFHERSAKDREK

    >gi|294497544|ref|YP_003561244.1| nitrate reductase, electron transfer subunit [Bacillus megaterium QM B1551]
    MTKQKLVLIGNGMAGMRCIEEILIHSPDCFDITVFGSEPHVNYNRILLSTVLQGSTKLEDINIHSLAWYKENNITLFKGE
    SVTHIDTKRKIITTDKNRETRYDKLIIATGSSPYMLPVKGSDKEGVLGFRTIED
    CQEMIKISKQYKKAAVIGGGLLGLEA
    ARGLLNLGMDVQVIHHSGFLMERQLDRAASAMLREELEKQGMSFLLNKHTDEIIGGNRAEGVRFNDSSKIAADLVVMATG
    VRPNVNLAKKSGIETNRAIIVNDYLETSIPDIYAVGECAEHRGMTYGLVAPLYEQGKVLARHLCQIKNDGYRGSVLSTQL
    KISGIDVYSVGEFKENQGAKAITISNMLDGIYKKVVFREGKIVGAVLFGDTSEAIKLSQMINEKKDLSQAEKVQLFPSQH
    EKENAVTSMPLTGIICNCNGVTKGAIIEAVQKNDLTTVDEIKNCTKASGSCGGCKPLVTDLLTYIQSDEFDEIIEQKTFC
    TCTHLSEDELVREMQQYQFETVQQVREILKFKDMKGCSLCEGGLHYYLDMMNPHYENNRHSLFTTENEQAVLLHDGTYAV
    VPQIHGGLTNVQELRNIANVAERYNISNIRLTSDQRIQLIGVKKEYLPLISEEIDRGLQQLYERTVKNVSVYIGKGTCIC
    QYEPALALSNELDKQLEYVKTPCDIKISIASCSHISENVTTSDIGLRRIDRGWEIYAGGSSAEARSGELFYVAETNEEAV
    EISCSLIQYYRETGNYLETVGSWIERVGIVHVREVLFEVDNREYLMKRLSSERSRAITYLL

    >gi|294497751|ref|YP_003561451.1| 2-cys peroxiredoxin [Bacillus megaterium QM B1551]
    MAERMVGKQAPRFEMEAVLANKEFGKVSLEENMKNGKWTVLFFYPMDFTFVCPTEITALSDHYEEFEDLDAEVVGVSTDT
    IHTHLAWINTDRKANGLGDLNYPLAADPTHAVARDYGVLIEEEGVALRGLFIINPEGELQYAVVNHNNIGRSVEETLRVL
    QALQTGGLCPANWKPGQKTL

    >gi|294497752|ref|YP_003561452.1| antioxidant, AhpC/TSA family [Bacillus megaterium QM B1551]
    MKLREQMPELTGATSWINDEVTKEDLVGDKATLIHFWSVSCHLCKEAMPEVNDLRDEYDDQLNVVAVHMPRSEDDLDMGV
    IEAMAMGHDITQPIYVDSEHKLTDAFENKYVPAYYVFDKEGQLRHFQAGGNGMPMLRKRINRVLGEE

    >gi|294497983|ref|YP_003561683.1| peptide methionine sulfoxide reductase MsrA/MsrB [Bacillus megaterium QM B1551]
    MTEQYEVATFAGGCFWCMVKPFDEQPGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDPEVFPYEKLLELYWPQ
    IDPTDAGGQFADRGDSYRTAIFYHNEHQKTLAEESKQQLEASGRFSEPIATQILPAKPFYEAEEYHQGYYKKNKFRYAMY
    RRGSGRDRFIKENWKDFGRDEQLKTTLTPIQYEVTQNDATEPPFRNEFWDHTEDGIYVDIVSGEPLFSSTDKYDAGCGWP
    SFTKAINKDEVKENMDVSHNMVRTEVRSKTANSHLGHLFDDGPQDAGGLRY
    CINSAALRFVPKEDLEKEGYGEYAVLFNK


    >gi|294498011|ref|YP_003561711.1| O6-methylguanine DNA alkyltransferase [Bacillus megaterium QM B1551]
    MYYGEMNLFSDLKIYIVASEKGVQHIWFDSDDHNEQLKKLVHDEDYHHVKEAKRQLQDYATGRTLTFDLPLDVKGTDFQK
    EVWLTLKGIPYGQTWSYSEVAESINRSKAVRAVGQANRRNPLPIILP
    CHRVIGKNGALTGYAGSQTHIKEKLLMLERNVA
    KGALELK

    >gi|294498024|ref|YP_003561724.1| NADH dehydrogenase [Bacillus megaterium QM B1551]
    MKRVVIIGGVAAGMSAASQLRRMKEKEEVEILVFEKGGDISYSACGMPYYLSGVVKEKDDLIARTKQEFEERNISVHLFH
    EVKEVNHTKKYIVVQNVKTQAEKEITYDELIIATGTTAVKPNFMSDNMPNVCTLKSLEDSERIYTYLQAHSVEKVTIIGG
    GYVGMEVAEAMKALGKEVRVIEQGKQILSILDQEMAEHLQKQLDDDILFHFEEEVEALLHSDGSVTHVQTNRQTYQTDLV
    IVNVGVRPNTQFLERNGLRMLENGAILVNEKLETNVPHVYAAGDCATSYHRVLKKDVHIALGTIANKQGRVLGYRLGGEN
    REFPGVVGTSIVKVMDYEIGKTGISEREARENSLLYKAITAEAPSHASYYPGAEKIVIKLVYHPETKEILGVQMIGKEGV
    AKRIDVFATAITCRLTTDEITMLDLSYAPPFATVWDAVQIAAQKAE

    >gi|294498093|ref|YP_003561793.1| glutaredoxin [Bacillus megaterium QM B1551]
    MRSIELYTQPACPPCEIVKQFLQHHHVSYKEFDVSKDASARKRMTTELESYSTPTIRVDQEIIRGFDLQALEKLLNIG

    >gi|294498101|ref|YP_003561801.1| putative 2-cys peroxiredoxin [Bacillus megaterium QM B1551]
    MEGSCMPERMVGKQAPRFEMEAVLSNKEFGKVSLEENIKNDKWTVLFFYPMDFTFVCPTEITALSDRYDEFEDLDAEVIG
    VSTDTIHTHLAWINTDRKDNGLGDLKYPLAADTNHVVSREYGVLIEEEGVALRGLFIISPEGELQYSVVNHNNIGRDVDE
    TLRVLQALQTGGLCPANWKPGQATLNA

    >gi|294498102|ref|YP_003561802.1| thiol-disulfide isomerase [Bacillus megaterium QM B1551]
    MKLRQPMPELTGATEWLNGEVTKEQLIGEKPTLIHFWSVSCHLCKEAMPQVNEFRDQYKDQLNVVAVHMPRSEDDLDLSK
    IKEVAAEHDITQPIFVDSEHKLTDAFENQYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLGENE

    >gi|294498116|ref|YP_003561816.1| pyruvate dehydrogenase complex E3 component, dihydrolipoamide dehydrogenase [Bacillus megaterium QM B1551]
    MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALIAAGHRFEHAKHSEDMGIIAEN
    VTVDFSKVQEFKNGVVNKLTGGVEGLLKGNKVDIVKGEAYFVDSETVRVMDENSAQTYKFKNAILATGSRPIEIPGFKFS
    ERVINSTGALALKEVPKKLVVIGGGYIGTELGTAFANFGTEVTFVEAADEILAGFEKQMSSLVKRNLKKKGNVEIYTKAM
    AKGVEETANGVQVTFEVGGESKVIDADYVLVTVGRRPNTDELGLEQVGVKMTDRGLIEIDNQTRTSVSNIFAIGDIVTGP
    PLAHKASYEGKIAAEVIAGEPAEIDYLGIPAVVFSEPELASVGYTEAQAKEEGLAVKASKFPFAANGRALALNAAEGFLK
    LITRKEDGVVVGAQIAGPSASDMIAELGLAIEAGVTAEDIALTIHAHPTLGEITMEAAEVAIGSPIHIVK

    >gi|294498282|ref|YP_003561982.1| protein disulfide isomerase [Bacillus megaterium QM B1551]
    MKIEVWSDFVCPFCYIGKRRLEQALQQFAHKDDVQVEFKSFELDPNAPVDTGKTINEALAAKYGMTIEQAKQANEGIGQQ
    AASVGLSFNFDDMKPTNTFDAHRLAKFAKAQGKEAAITEKLLYAYFTESKHLGEKETLVAVAEDAGLDREEARQILADKN
    AYANEVRSDEATAQQYGISGVPYFVVNQKYAISGAQPIETFVGALQQVWEEENPTPALKSLSPEGADDAFCADGQCAVPD
    SSKNQQ

    >gi|294498351|ref|YP_003562051.1| hypothetical protein BMQ_1585 [Bacillus megaterium QM B1551]
    MTNQKETGWNLRNSYAELPNIFFTLLDPNPVSSPKIVKFNDSLAASLGLQKEQLQSPEGVSILAGNSVPKGAFPLAQAYG
    GHQFGHFNMLGDGRAMLIGEQVTPSGEKVDLQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMHALRIPTTRSLAVVTT
    GESIVREKELPGAILTRVASSHLRFGTFQFAAKWGTVENLQALADYALERHFPHIEKNEKKYLSLLQEVIKRHATLVAKW
    QLIGFIHGVMNTDNMTISGETIDYGPCAFMDTYDPETVFSSIDVQGRYAYQNQPGITGWNLARFAEALLPLLDQDIEKAV
    EIAQSAVTEFPKFYRENWLAGMQAKLGLFNEEKEDEALFQELLTIMKTYEADYTNTFRALTFDKLENSDLFKSKEFAQWH
    ELWQKRLGRQQQSKADSQELMKNNNPAVIPRNHRVEEALDAAQKEDYSVMETLLEVLSSPYESPGQPEYCTPSAPSNQPY
    QTY
    CGT

    >gi|294498645|ref|YP_003562345.1| acetoin dehydrogenase E3 component (dihydrolipoamide dehydrogenase) [Bacillus megaterium QM B1551]
    MKPLVVIGGGPAGYVAAITAARQGKQVTLIEQKDLGGTCLNEGCMPTKSLLASAEAYEKIKKAEQFGITIPLEQVKINWD
    GVQHHKTTIVKNLVRGIGYLMKKNSIKVIKGEASFLTNHRLSVRNENHVEEIEAEQFIIAAGSEPASLPFAPFDGKWIIH
    SKQAMSLPAIPSTLLIVGGGVIGCEFASIYSQMGTTVTIVEAADQLLPGEDADIAFTLQEELEKKGVAIYTSSSLTEMQP
    EDKTALFKHKEELHELQAEYALISIGRKPRVLGLGLEQVGVHFSKQGIDVNEHMQTNIPNIYACGDVVGGIQLAHVAFHE
    GTVAALHACGKDKSVNYRAVPRCIYTHPEIASVGMTEKQARSEYGDIRVGEFSFTANGKAMIANESVGKVKVIVEPQFNE
    IIGLSIVGSHATELIGQGTIMMHGELTTDIMEDFIAAHPTLSEAIHEALLQSAGQAVHS

    >gi|294498673|ref|YP_003562373.1| copper-translocating P-type ATPase [Bacillus megaterium QM B1551]
    MGDKQKEATLQITGMTCAACSNRIEKGLKKIEGVKEANVNLALERSTIIFDPSKTSPQVFEEKIEKLGYGVVSEKAEFAI
    TGMT
    CAACSTRIEKGLNKLEGVTKASVNLALETASVEYSPSQIAPQDITQRVEKLGYGAKLKSEEKEEEQSYREKELSKQ
    KGKFWFSLILSVPLLWAMVSHFTFTSFIPLPHMLMNPWVQLALATPVQFVVGKQFYVGAFKALRNKSANMDVLVALGTSA
    AYFYSLYSSLKSLGSSAHTDQLYYETSAILITLILLGKLFEANAKGRSSEAIKKMMGLQAKTAVVVRDGAEVEIPVEEVQ
    KGEVIFIKPGEKVPVDGEIIEGQSALDESMLTGESVPVDKNVGDKVIGATLNKNGFLKIKATNIGKETALAQIIKVVEEA
    QGSKAPIQRLADYISGIFVPIVVGIALLTFFVWYIWIAPGEFAPALEKLIAVLVIACPCALGLATPTSIMAGSGRAAEFG
    ILFKGGEHLEATHKIDTILLDKTGTVTNGTPELTDVRIAQGYKENELLQLVASAERLSEHPLAQALVAGIKNKGIEIQDP
    LSFEAIPGYGVKATVQERELLVGTRKLMNQYKVNIDTALEEMTNLEQEGKTAMLIALDGKYAGMLAVADTIKATSKEAVS
    RLKEMGLEVMMITGDNRQTAQAIAMQAGIEHVIAEVLPEGKAEEVKKLQQQGKKVAMVGDGINDAPALALADIGMAIGTG
    TDVAMEAADITLMRGDLMSIADAIEMSRKTISNIKQNLFWAMGYNTLGIPIAAVGLLAPWVAGAAMAFSSVSVVLNALRL
    QRVRL

    >gi|294498736|ref|YP_003562436.1| thiosulfate sulfurtransferase [Bacillus megaterium QM B1551]
    MNIMNTIISPRELHTALQQPQQSIILLDCRFTLGKPEAGSDAYQNEHLPDAHYLDLEKDLSSVATSHGGRHPLPDVQKLA
    QKLGSLGINADSRVVVYDEQNGMMASRAWWLLRYIGIEYVQILNGGFTNWKQSGYETTKSVPAASPQTFVPFVQQDWGLA
    GVEYVKENLHNPNVVLVDSREKKRYLGLEEPIDFVAGHIPGAIHSFWQDVLTSEGLWKTDKEWKEMFSAIDSHAEVIVY
    C
    GSGVSACPNVLALKSAGFPNVKLYAGSWSDWISYRDNPIEKNR

    >gi|294498747|ref|YP_003562447.1| glutathione peroxidase family protein [Bacillus megaterium QM B1551]
    MSVYEYSAKTIKDEDVSLSNYQGDVLLIVNTASKCGFTPQYKDLQALYEEEKENGLTVLGFPCNQFGGQEPGSSNDIEQF
    CELNYGVSFPMFAKVDVKGEHAHPLFTYLTEQAPGLLGSKGIKWNFTKFLVNRQGEVVKRYAPQTAPKDIKKDIKELL

    >gi|294498755|ref|YP_003562455.1| Thioredoxin [Bacillus megaterium QM B1551]
    MKQFTEEKQFREQIKNETLSVGIFTTTWCPDCKRLDMFIDEIVDENTDKAWFKIDKDEFEELSAENNVMGIPSLLVYKNG
    EKIAHLHSANAKTPEAVREFLATL

    >gi|294498809|ref|YP_003562509.1| methionine-S-sulfoxide reductase [Bacillus megaterium QM B1551]
    MKEYATFAGGCFWCMVAPFDQLPGISSIRSGYAKDEQITSEAKQESEYVEAVQIVWDPSHIMFEELLNLYWQQIDPTDSG
    GQFSDRGPAYRAIIFYHNEKQKEAAFDSKKKLAQSGRFKHPIVTPILPFSFFYEAEEQQQDYYRKNTFHYKLYKEGSGRT
    DFLAQHWPKDRSYLKKVLTPMQYFVTQENGTEPPFTNLYWNNKKQGIYVDLLTGEALFKTSDQLPSHTGWPVFKRPILYG
    NIKKVPMQHETALKSKEGNNYLGLLLTEENSEYYQVNSAALRFIPTEKLKEEGYEDFLILF

    >gi|294498826|ref|YP_003562526.1| glutaredoxin family protein [Bacillus megaterium QM B1551]
    MSVKILLWNRKGCHHCEELKAYFHEKGYQYESIDVEGKDYLRDLLEFKYGIRHVPVVEIGDEGQFKGVIEKDYEQIEKLI
    EDYSPIVK

    >gi|294498995|ref|YP_003562695.1| NADH dehydrogenase [Bacillus megaterium QM B1551]
    MKIAVVGCTHAGTAAVKNMAELYPEAKITVYERNDNVSFLSCGIALYVGGVVKDANGLFYSSPSELQEMGVNMKMKHEVT
    NIDTDGKKIAVRNLETNEEFEDTFDKLVMTTGSWPIIPNLEGIDLNNVVLCKNYQHANHIIEKAKQAKKIAVIGAGYIGA
    ELVEAFEVYGKEVTFIDSADRILNKYLDPEFTNLMETEFENRGVKLALNQAVTKFVGSEGSVEKVVTTEGEYEADLVILC
    VGFRPNTDLVKGQVDMLPNGAIVVDEYMQTSKKDIFAAGDSCAIYYNPIKKHAYIPLATNAVRMGTLVAQNLVKSTIKYM
    GTQGTSGLHIYDYNVASTGITETAASLFDMNVKSITISENNRPEFMPTYENITLKVVFEEETRRIVGAQVISKIDATQAI
    NTLSVCVQQEMTIDELGFMDFFFQPHFNKPWHFLNQAGLQALQA

    >gi|294499034|ref|YP_003562734.1| organic hydroperoxide resistance protein [Bacillus megaterium QM B1551]
    MSDVLFTSKATAVGGRDGRVKSDDGIIDLTLVNPSPNNKEEGTNPEQLFAAGYSACFDGALNLIAKKQKKDIDSSITAEV
    SLLKDHTDDGFKIGVVLNAHIKGVSQEVAEKLVEDAHQF
    CPYSKATRGNVNVTLNTTAE

    >gi|294499171|ref|YP_003562871.1| rhodanese domain protein [Bacillus megaterium QM B1551]
    MTERKPYQVLLYYLYTPIENPEDFTAQHLAFCKELELKGRILIAAEGINGTVSGTVEQTDKYMETMKNDPRFEGIVFKID
    EADEHAFKKMHVRHRKELVTLRLEEDVNPLRVTGNYLSPKEFYEAMQDENTVVIDARNDYEYDLGHFRGAVRPDIRNFRE
    LPEWIRDNKDQFEDKKILTY
    CTGGIRCEKFSGWLLEEGFEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERISVPVNQ
    KEHVIVGKDHFTGEPCERYVNCANPECNKKILASEENEHKYLRACSHECRVSPRNRYVKEHGLTEEEFAARVKELEKEHV
    TL

    >gi|294499304|ref|YP_003563004.1| hypothetical protein BMQ_2548 [Bacillus megaterium QM B1551]
    MKLTVTEAAATWYKDEMMLEGNETIRFFVRYGGCSNVQKGFSLGVNTDSPKNVGVETKVDGLTFFVEDEDLWYFDGHDLT
    VNYNEETKEPDFHYEA

    >gi|294499312|ref|YP_003563012.1| AhpC/TSA family protein [Bacillus megaterium QM B1551]
    MVKKIIAVLLLVGFLSYALWQGLSPNEASDNSNLSEYKDLNIKKGDSARQASGQAYGLEPKDTAPPFTLSDTSGKSVQLS
    DFKGKKVILNFWATW
    CPPCQKEMPDMQAFYEKYGNDVQLLAVNLTSSEGSKQAVSKFLKEKQFTFRVLLDDQDSVGSKKY
    RVSTIPTSYFIDEEGKIVQRVNGPMTLKQMENFAQQAAN

    >gi|294499524|ref|YP_003563224.1| Pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus megaterium QM B1551]
    MADKYDCVIIGGGIAGLQAAIQLGRYKRSVLVIDSNDGRSNLCKNYQNILGWPEGISGQTLREAGRQQAKSYGIQFAEER
    VIQCQKEIEGFSVITNSANYEAATLLFATGVVDRVPPELQQELYPCMGKTVYV
    CPDCDGYEVNNRRVLVLGSGKAGASLS
    LTLTYWTNDITYINHDKKEIGPLEDTLMQKGITYKEAAIKKVIAEAEMLKGVILENNEFIYGERGFLAFGGNKVRTELAH
    ELGVELLENQHIIVNPRTKETNVSNVWAAGDIVAHSEQVTVAMGEGLQAAIWIHKRLLELHEK

    >gi|294499560|ref|YP_003563260.1| putative Conserved Transport (YeeE/YedE family) [Bacillus megaterium QM B1551]
    MAQTLHSSYKSKSTTVVTELSPMQKPLFAGGVIAAVILLLAIVLTTNWTQGVLFIIGLALGMTLLYARFGFTSAFRRLVS
    VGNVQGLQAHMLMLAIASTLFAIILSTGFSFTGVTPKGYVSPVGVSVIVGSFMFGIGMQLGNG
    CASGTLYSLGGGSSSMI
    LTLLSFIVGSMFGAYHLPFWQKQPSLPPISLAESTGLGYFGAWIVQLIAFAAIYWITIQIAKKKNPPMMKQLPTTKGWKK
    IIRGSWPLFTAAIVLAVLNALTLAVRGNPWGITSAFALWGGKAMMAAGIDVSSWGFFQGANGEALTQSVLADSTSVLNFG
    SILGAFISATAQGTFKPGKIKPGVAGAAVVGGLLMGYGARLAFG
    CNIGAYFGGIASFSLHGWVWMVMAMLGTGVALFIRP
    LFGLKNPKSNDSIC

    >gi|294499656|ref|YP_003563356.1| OsmC/Ohr family protein [Bacillus megaterium QM B1551]
    MAKHHFHLQANWPGGRNEVGTIESGQLKTKISIPPEMDGPGVGTNPDEMLLGAAATCYIITLAAMFERSGIRQEALTMES
    EAIVDVTNGVFTYEKIIHKPHVIITSEFAAQEEKINRLIKKAETS
    CMISRAIQGNVEIKLEPQLTVKA

    >gi|294499743|ref|YP_003563443.1| hypothetical protein BMQ_2987 [Bacillus megaterium QM B1551]
    MHITPEAKQLINNILEEQEITGIRLYFKGISCEIPNIGLAFEEPFENDEMYEVDGVQVAMEASIVPYTNELMLDVHTTPY
    GPGLALVGAKEAE

    >gi|294499893|ref|YP_003563593.1| cadmium-translocating P-type ATPase [Bacillus megaterium QM B1551]
    MKHEDKKNHQHTGSCCSGSSSPEIESKTCCSSSSEAASTEEPSSCGTKSHEHSHSCCSDTIALTTDKGQHSCCSDHDIVS
    GDSDIEETAEYRVYGMD
    CPSCAATIEKSLKTLNDIQHVTLNYNTGKLQVAAASESALLLIPSSVEKLGFNIETIQSNKKM
    KTYLIEGMD
    CAACANTIVNHLKTVPAVKDVRVNFSTGKAQIEHDNEADDIIKEVSKAGYTATLVTSSRQSAESRHHKGQN
    GPIVFSGILIALGFIGSHTGIASYMTTVLYAIAMIVSGYKPAKSAYYGIKSRSLDMNVLMTVAALGAAVIGEWLEGATVV
    WLFALGVALQTRSIEQTRNSIRGLMDLAPSEAWVKENGQLIKKAAEDISIGTTIVVKPGDRIPLDGEIINGESNINQAPI
    TGESIPVDKIIGDAVYAGTINESGSLEVKVTKLVEDTTISKIIHLVEEAQEKKAPTQAFVDKFATIYTPIVFILALFIMV
    IPPLFDGAWSEWFYKGLELLVVACPCALVISTPVAIVSAIGNAAKNGVLIKGGTFLEKAGAINAIAFDKTGTLTEGKPAV
    SEVVSLAAEENQLLAITKTLEDYSNHPIARAIVDYAAEKKVDSLQGSNFKILTGKGVQATIQETVYYAGNAKLFSDLGTP
    LSHCWSHIEKLQNEGKTIIIVGTAKSVLGIISVADTIRHTTVSALESLKQNGMQQIVMLTGDNEGTAKMIASESRVDRYF
    ADLLPEDKVKAIQQLQHEGYQTAMVGDGINDAPALATADLGIAMGGAGTDTAMETADIVLMADNLEKLPHTMKLSRKALA
    VIKQNIWFSIIVKVIALAFIFPGWLTLWIAVLSDTGAALLVILNSLRLLKMRK

    >gi|294499922|ref|YP_003563622.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium QM B1551]
    MSKAKKKKKVTPNQQTSSSKWIFWVIGIIAVCILGLIVLSNMSKGGGDERAALTYDNQPYLGKESAPVEVVEFGDYKCPA
    CKNFTESFFPLIQKDYVDTGKVKFYFMNYAFINNDSSRAAEFAETVYKELGNDTFWKFHELLYKKQNAADEKKDVLTESY
    LEDTLKEVSSDADAKKVASAFKDGKGKDAFDQDMKTANDLGITGTPTIYVGGKKFEGKTIDDFDQMVKDAAKENK

    >gi|294500096|ref|YP_003563796.1| hypothetical protein BMQ_3340 [Bacillus megaterium QM B1551]
    MMQANFALDAKGLACPMPIVRTKKKMNELEAGQVLEIQATDKGSTADLQAWAKSTGHEYLGTETEGDVLHHFLRKGGAEK
    NVTPIPEISLEEFAKKVESDEHLHILDVREVEEYDEAHIPGVVHIPLGEVEKCSIELNKEDEIYII
    CHSGRRSEMAGQTM
    KKQGFKNLINVVPGMRDWTGKVE

    >gi|294500097|ref|YP_003563797.1| rhodanese domain protein [Bacillus megaterium QM B1551]
    MKTIAAQEVEQLVKKQEQIHILDVREVGEVKTGKIPNALNIPLPLLEFRMHELDKANNYIVVCRSGGRSGMAARFLEQQG
    YSVTNMTGGMMEWKGETV

    >gi|294500098|ref|YP_003563798.1| putative rhodanese domain protein [Bacillus megaterium QM B1551]
    MIINALIIVFLLWFLYQRFAPVKGIQQIATTELKAKLKNKNNQFIDVRTPHEFRTKHIKGFRNIPLSELPAQTVQLSKDR
    EVVVV
    CQSGMRSMKASKLLKKQGFTSITNVKGGMNTWR

    >gi|294500652|ref|YP_003564352.1| hypothetical protein BMQ_3905 [Bacillus megaterium QM B1551]
    MARVLLANEEGTNFEKALNLIPHVKRLYDELYDTLWNSDIVEKETKEKIRLYLAGVNGCETCMSMSYIGDETLNQKVLRE
    KELEEKDQLLFRFIDVYRVRPRELTDADMNQLKKFYSDTQLLELLAVINLFDQFHKMIVSLDLYDFCSLQGK

    >gi|294501115|ref|YP_003564815.1| cytochrome c biogenesis protein [Bacillus megaterium QM B1551]
    MKKKRLIIRTVILAVLLCAVGYTLYAQFFADKQKVSVGDKAPDFILRDVNGETHQLSDYKGKGVFLNFWGTWCKPCKQEM
    PAMEKQYASYKKQGVEILAVNVAETNIAVEQFAKQYELSFPILMDKDSQVLGAYGIDPLPTTFLIDKNGKIVDSFIGGLE
    ESKIKEYMEEIKP

    >gi|294501154|ref|YP_003564854.1| hypothetical protein BMQ_4410 [Bacillus megaterium QM B1551]
    MNITFTDKAIAKVQEKYGKDSSLYLKLKYDTDGCGCVVSGVTTLWIVDEKESDDVTIETNFVPVLVEKTKQVFLDDNMTI
    DYNESAYTFMLKCPSQILNPRMSFIDKTKEAL

    >gi|294501184|ref|YP_003564884.1| dihydrolipoamide dehydrogenase E3 component of branched-chain alpha-keto acid dehydrogenase complex [Bacillus megaterium QM B1551]
    MAKEYDLVILGGGTGGYVAAIRASQLGLSVAVVEKNKLGGTCLHAGCIPSKALLRSAEVYQTAKKSSEFGVETSNVLLNY
    ARVQERKSEIVSQLHNGVKQLMKKGKIEVYEGIGRILGPSIFSPMPGTISVELKSGEENEMLIPKNVIVATGSRPRTLPG
    LTIDGEKVITSDEALKMETLPASIIIVGGGVIGIEWASMLTDFDVDVTVVEYSDRILPTEDQDISREMTKLLKAKGVTII
    TSAKVMADTLSIDGQVKISAQVGGDMQEYEAEKLLVSVGRQANVEGIGLENTDIVVENGVIATNDFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHLHGEKPLKIDYTTISKCVYSSPEAASVGLTEQEAKQQGFQLKVGKFPFKAVGKALVYGEA
    EGFVKIIADADTNDVLGVHMIGPHVTDMISEAGLAKVLDATPWEIAHTIHPHPSLSEAMGEASLAVDGKAIHF

    >gi|294501225|ref|YP_003564925.1| rhodanese-like domain protein [Bacillus megaterium QM B1551]
    MSAITAVLILLGVIIIYSVVMFFYQRRIMKTLTEEEFRTGYRKAQLVDIREPNEFENGHILGARNIPLSQFRMRIKEFRP
    DQPVYIY
    CQSGMRTGRAAQMLRRHGVQEIYDLKGGFKMWNGKVKKKK

    >gi|294501239|ref|YP_003564939.1| regulatory protein Spx [Bacillus megaterium QM B1551]
    MEEIKFYTYPSCTSCRKTKKWLVKEDVNFKERHLFRETPTHKEMLELLSMTTEGMDELLAKRSQEYKKLNVDVDSMTLSE
    VVNLLIEHPRLLRRPILTDGKKLVVGYNESALKNLVKKKTSLASLVV

    >gi|294501465|ref|YP_003565165.1| thioredoxin [Bacillus megaterium QM B1551]
    MAIAHATDKNFTDEIKSGLVLVDFWAPWCGPCKMIAPVLEEIDGELNDKVKIVKVDVDENQETAGKFGVMSIPTLVLFKD
    GEKVDQVVGFQPKEALTELINKHA

    >gi|294501531|ref|YP_003565231.1| thiol peroxidase [Bacillus megaterium QM B1551]
    MTKFKGNDVTLLGNQVKVGDKAPNFTVLANDLSEVTLDSTKGSVRLISVVPSIDTGVCDAQTRRFNEEAAKLDNVKVLTV
    SVDLPFAQKRWCGANGIDNVQTLSDHRDLSFGEAYGVAIQELRLLARSIFVVDSNDNVTYVEYLPEVTEHPNYEAAIEAA
    KTAK

    >gi|294501565|ref|YP_003565265.1| thioredoxin [Bacillus megaterium QM B1551]
    MEKMQTIEQYKEIIKEGKHIMMFSADWCPDCRVIEPVLPEIEANHSEYTFHYVDRDDFIDLCAELSIFGIPSFVGYSNGE
    ETGRFVSKDRKTKEEIEEFINGLNA

    >gi|294501581|ref|YP_003565281.1| FAD dependent oxidoreductase [Bacillus megaterium QM B1551]
    MIYDVVVIGGGPSGLMASIAAGESGANVLLIDKGNKLGRKLAISGGGRCNVTNRLPIDELIKHIPGNGRFLYSAFSVFNN
    EDIISYFEGLGIKLKEEDHGRMFPVSNKAQSVVDALISELHRLRVTIRTNTAVKRVNYENNTVKEVVLQNGEAIQTKSVV
    IAVGGKSVPHTGSTGDGYQWAKDAGHKITELYPTEVPITSSEHFIKTKTLQGLSLRNVGLSVLNKKGKPVITHQMDMIFT
    HFGISGPAALRCSQYVVKELKKQKSNTVQMSLDLFPSQNEEDIFQQLVRTTKEEPKKAIKNVLKGFVSERYLLFLLEQAG
    IDSQALAGQLQHEKLREFARLCKRFEFAVNGTLSLEKAFVTGGGVSVKEIHPKEMSSKFMQGLYFCGEILDIHGYTGGYN
    ITSALVTGRLAGSNAGEFATSLA

    >gi|294501583|ref|YP_003565283.1| rhodanese-like domain protein [Bacillus megaterium QM B1551]
    MEEVKVITPEELQKRVENGEELHLVDVREDEEVAEGMIPTAKHIRMNDIPANVDYFDKDKEYIFICRSGRRSENVCYYLQ
    EQGYKVTNMAGGMLEWEGKTVNK

    >gi|294501681|ref|YP_003565381.1| iron-sulfur cluster assembly accessory protein [Bacillus megaterium QM B1551]
    MSQDILTITEAASFQIKDMMKEHEEENAYLRVNVNGGGCSGLSYGMGFAHEVNENDTLFEQHGIKILVDSESAPILKDVK
    IDYKQSMLGGGFTIDNPNAIAACGCGSSFRTASNAGAPEEC

    >gi|294501709|ref|YP_003565409.1| hypothetical protein BMQ_4996 [Bacillus megaterium QM B1551]
    MQQEARHSTEQALHDYKMGVGKFSEKLPEVTKTFNAFTEACFGEGSLSKKEKQLIALGISVVAQDEYCMIYHTKGCIDQG
    ATEQEILEACGVSAAFGGGAAMSQSVTLVQECISELTSHTH

    >gi|294501713|ref|YP_003565413.1| putative thiol-disulfide oxidoreductase [Bacillus megaterium QM B1551]
    MQEWSEKQLDDQLKEGQRAFIFFHTPFCGTCQLAKKMLTVAEAMLPGVTIGMSNLNYMPSKAEVFSIESVPCLIEVKNGE
    MVKKLYAFHSIEHVLEELR

    >gi|294501717|ref|YP_003565417.1| hypothetical protein BMQ_5004 [Bacillus megaterium QM B1551]
    MSLFFYSYPKCGTCRKAKKWLDDNGVAYEEIHIVENPPTKEQLQSYYQNSGLELKKFFNTSGKKYRELGLKDKVSSASED
    ELLSILASDGMLIKRPLLTDGQKVTLGFKEEQFEDVWK

    >gi|294501746|ref|YP_003565446.1| molybdopterin biosynthesis protein MoeB [Bacillus megaterium QM B1551]
    MTERYSRQQLFQPVGNKGQQQIRSKHVLVVGAGALGSASAEALVRAGIGKLTLVDRDYVEWSNLQRQQLYTEQDAQNKLP
    KAVAAKNRLRQINTEVKIEALVMDAQPANLESIVQTADVIIDATDNFDIRFILNDLSHKYEVPWIYGSCVGSYGATYTVI
    PNVTPCLHCILKKVPVGGAT
    CETAGIISPAVQIVAAYQITEALKILVEDVEALRHTFLTFDVWNNQHAEFKTGKMKSDKC
    SSCGSTQTYPYLAYENQLKTEVLCGRETVQIRPSQRHLYNFDELEKRLKKQGKVDRNPYLLSCQLPEQRFVIFQDGRVFI
    HGTNDIQFARSLYYRLLG

    >gi|294501774|ref|YP_003565474.1| thioredoxin-disulfide reductase [Bacillus megaterium QM B1551]
    MTEEKIYDVIIIGAGPAGMTAAVYTSRADLSTLMIERGIPGGQMANTEDVENYPGYDHILGPDLSNKMFEHAKKFGAEYA
    YGDIKEIIDGEEYKTVRAGSKEYKTRSVIVATGAEYKKLGAPGEKELGGRGVSY
    CAVCDGAFFKGKELVVVGGGDSAVEE
    GVYLTRFATKVTIIHRRDELRAQKILQQRAFDNEKVDFIWNTTVKEVNEKDGKVGSVTLVDTKTGEEREFGADGVFIYVG
    MVPLTKPFESLNITNKEGYIETNEQMETKVPGVFAAGDVREKALRQIVTATGDGSIAAQAAQHYVEELKEKLKAIQQ

    >gi|294501765|ref|YP_003565465.1| hypothetical protein BMQ_5052 [Bacillus megaterium QM B1551]
    MKVVLYTKNGCHLCDDAKKLLAEMQSEFPLQLIERDIYKNDEWLEKYHLAIPVVEMDGEEVEYGKITGIPLRKRLLLKIG
    NT