Syntrophobacter fumaroxidans MPOB uid58177

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|116747465|ref|YP_844152.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MRTAKDRLHRVLVIGATPAGIAAANKLGEMGIPVTLIDRDPDLNEKLAREEWRLSSGLLLNYAHRPGLLRILKNPRIRCI
    LPGEVQSIKHTPQGFCARYRKNPTFVDPERCTLCGRCAEVCPAAAGDGTRPIRYNGRQSLPGRPFIDKRRKPLCQANCPL
    GVNVQGYVALIRVGRFAEALELIRRDNVLPGICGRVCTHPCEAACRRNELDAPLAIRDLKRFAADHAGTEPQRPLVPQSA
    GRSESVAIVGSGPAGLAAAADLARWGYPVTVFEKESLPGGLLRFGMGPHRLPRDILDREIGAIERMGVSIRTSSAIDMRT
    DIPGLLESHAAVILTTGAWTDRKLGVPGEALERVEG
    CLEFLGRLYRGEIAALHESVAVIGDGNAAFDVARACVRLGAKVT
    ILSWFPEDLIPADPDEVIAAREEGIAIVDRAKVVEFLGGGGKLSGLRCVETKPGEPDANGIPWPVPVPGGKSFEAAFDRA
    VVAIGQVADREGFEGCIELTRSGTIRTDNDRMTSLADVYAAGDAVTGASSVVRAMASGREAALAVHCRLSGEARPHHLPN
    RPEDRDFPPIAPDLPSIARVKMPERQPMARKDGFVEVALGLDETQACSEAARCLQCGICSECLQCAEYCISPNTIMHDDR
    VSEGVEHAGVVIIADPEAAPAVKGEDVLRAYSTKSAREDAHAMMMRGFAAAAEAMVMVGGGVQRLRGHGLSISPPDPQLS
    ADLRIGVFVCRCNDAYGWPAELNHYAEELGARPNVEVLEVIASACSPEGSAAILRTIREKGLTRIVLASCVCCPLDFICS
    ACTDQRARLKNSLFHGTGVTRAMAETCNLRGEVLRLLRTDPQLAMKRFKGLLDRSIGRARKLKSMPSPARPYNFTTAVIG
    DSEAALKSALTLARTGMEVFLFGTVGEPLAEQLDHPNIHNFRGSAVTSLRGTVGNFQVIVETDGSLQVFHVGAVILGEES
    RRRVPYVPMTELPPHPVESRMQKRGMTGTPYFFPGATSIPGLFLANPPGIKLSERIKGTASAILAASVMPRSPRQNKGYT
    VSVDESRCRGCGRCLQACPYQAISFRKNGLGGSHAVVDEALCKGCGNCISVCPSDAADSPYRDQLFLEQMIEEILS

    >gi|116747544|ref|YP_844231.1| rhodanese domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MKCSVDPEELKRALADAPDETVVIDVRRKTDFETDPRLIPGAQWKDPEQVDDWSRELPRDKTVIVYCVRGGPVSRPVSAK
    PAENQVRVKYLEGGLAGWDLSAKEDR

    >gi|116747715|ref|YP_844402.1| methyltransferase type 11 [Syntrophobacter fumaroxidans MPOB]
    MKAEEIRKAVRSGYARVARLEGSCCGKTGRSCCGGDAGSLPDDVGLQIGYGEDELKTVPEGANLGLGCGNPTAIAALREG
    ETVLDLGSGAGFDCFLAAAKVGPSGRVIGVDMTPEMIAKAQENALKGGYANTEFRFGEIENLPVEDSSVDVIVSNCVINL
    SPDKPKVFKEAFRVLKPGGRFIVSDIVLTAELPEFIRNSMDAYVA
    CLSGAVLKREYLAGIETAGFRHVRVVNETVFPIEL
    VAADPAVRETAGNSGLSSEDACSFADSITSITVAAIKPL

    >gi|116747796|ref|YP_844483.1| glutaredoxin [Syntrophobacter fumaroxidans MPOB]
    MADCDVMLYALSTCIHCKNTKEYLDGCGVKYDCVEVDKLEGDERKNIIEEIKKVNPSCSFPTIIIGDKIIVGSGRKKSRR
    L

    >gi|116747854|ref|YP_844541.1| rhodanese domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MTAGSGSGDVKSLYPDEAKEFIDEHKEGTYLLLDVRQPTEYEQGHLPGAQLIPLPSLPDSIGGLDRKRPVLVYCAVGGRS
    ATAASFLAHHGFSEVYQLLGGIQAWEQPTAANPVKFHLEFASGRESPREAVLLAYAMEQGMLDFHEAVRVRTTEPDLADL
    LVKLVRAEESHKKTLRELLRQHAPDEPPPEDVPGGSSRIMEGGLDIQDFMKQNESFMKTTAGYLDIAMMVESQALDLYLR
    MGAASSNEKTRRILFHIADEEKAHLSMLAELLEKKMSA

    >gi|116747889|ref|YP_844576.1| OsmC family protein [Syntrophobacter fumaroxidans MPOB]
    MSFQAAEQRDERTVNGVDVNRLFDTIDAVKAEPEIAKFRFRVKNKWIGGGHNHTTITDFYGALKDHPHEKPFELDADEPE
    VLLGEDKGPNPVEYLLTALAG
    CLTSSLVYHAAAKGIELKGVESRLEGDLDLRGFLGLSKDVPVGYREIRVYFTIDADLSE
    QEKQELIREAQKYSPVFNTVSNSTRVTVQ

    >gi|116747959|ref|YP_844646.1| rhodanese domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MAVSLLVGFGFGFALERAGFGSSRKLGGIFYFRDMTVLRVMFTAMITAMLGLHLALSLGIVASDQIYFLPTVYGAQIVGG
    VLFGIGFGLACWCPGTAAVGVASGRLDALIYLFGAVLGSILFNEIYGLLEPLYTWGESGVKFVWEALGVSAPFFALVFSG
    LGVAAFWFAEWIERRTAGTGPYFGSPFLKAFSVAVLAAAFGVAVLPSAGIDRAAVSRLGPPPETAILQTMQAGEDHVEPE
    ALADRLMTGDPSLLLVDIRTPGEYSAFHIKGALNVAPADLPETLAPRRDRGTIVLYSNGMTHPAQARDALARMGFNNVTI
    LTDGLQGFMHRVLKPVSLREAPLTAEMAAQVEAWRGFFLGTATARADDSQGSTGGMPGLVETAWLNEHLGRGDVRIIETR
    SQPAYNGGHLPGSVRMDPEHFRGVVGGVSSMVLPVDMIVRHLELLGIRPETTIVVVPSEKIMDATLIGTALERAGHRRYA
    ILNGGWEKWLAERRPVDTLLPAITETAYPAPREADRFTVDYRTVLEHVHRRSAVLLDVRPADYFSGAKSDEARAGHIPGA
    VNRPFADDLATIDGITSFKPRAELEEAYARLIPSKDTTVVVS
    CRTGHQASQTRFVLQNILGYRKVFWYDGGWAEWSSRPE
    LPVETSP

    >gi|116747960|ref|YP_844647.1| protein of unknown function DUF395, YeeE/YedE [Syntrophobacter fumaroxidans MPOB]
    MNPDQSIHSNGPRPYMNPYLAGLILGAVLLAAFLVLGTGLGASGGIARVGAAAQGALMPQHVAGSPYFGAWGSNPLSYYL
    VFMFAGTLLGGLVSAVAARRVQPQLERGPTASPRRRILMALSGGVLAGFASRLASG
    CTSGQALTGGAMLATGSLLFLVSL
    FAAGYAAAWFARRQWS

    >gi|116747961|ref|YP_844648.1| beta-lactamase domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MQFNLPVLSHYSYLLISGKEALLVDPDRDITAYLDHAKKHGLTIKGVFLTHSHADFVAGHLELVRALNVPVYQNAASGAK
    YKIEPLKEGSTFKVGAAMVKAVETPGHTPDGMCGLVFSEGDDQPKMIFTGDTLFVGSVGRPDLLEGKMTAATLASMSYDT
    WHNVLSKLPDTVAVLPAHGAGSLCGAHLSDDPSSTIGRERSSNPYIRHKGRSEFISAVLEGLPEAPQYFKHNAAMNREGP
    PLVSWDAAPVQAKVDESITRVEDLWLVDLRDPKPYSEGHVPGSVNIGLRGRLETWVGTIVPWKAPMVLIGSSAEIKEAVL
    RLHRVGYTGSVLPFEAWTRAGLSLARSGTVKPGELYAQMQDGSAPIIVDVRLPNEWMALRIGTVVNLPLNHLGELSRKLD
    PALPVVAV
    CNSAYRSSLAVGILQRKGFKQVSSLEGGSAAWIEAGYPVFGSEKQAAGSSAPRRHVHLAERISPADLNRLLK
    DLPGTFDLVDIRPPEAFRDYSLPGSTNADPADVLSNAGYLTGAGPLIIVDRDGSLAMMIAGILSQKTKRPIKALHGGLDA
    FWEETELKAAVRAVPLPGGGPKFQGPAAPAPAPVPQPATSAPAPSTPGTPKKKSAGC

    >gi|116748144|ref|YP_844831.1| thioredoxin-disulfide reductase [Syntrophobacter fumaroxidans MPOB]
    MRDFDVIILGSGPGGLQAAVHAARGKAAVAVLGRMHKSSLFKAHVENYCCMDTTLSGREILEQGRTQAQKFGARFIDEDV
    LDLRRGEDGRFSIKLESGAVLTAWSLILAMGVSRNRLNVPGERDLLGKGVSY
    CVECDGNFFRNQVVVVAGNESAACSGAL
    SLLLIAAEVHLIYTELSVSENLAFQVNSSPIHKHPGRKVKAIVGSMGVEKVVLDNGEEIEAAGVFIELGAKGALELATKL
    DVALDPETMQYIRANKKQETNVPGVYAAGDICGPPWQMAKAVGEGCVAGMEASGYARRMKTGKSGD

    >gi|116748266|ref|YP_844953.1| response regulator receiver modulated FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophobacter fumaroxidans MPOB]
    MNQKGASALVIGAGISGIRSALDLAEMGHHVLLVDKAPNLGGTLRQLDHQFPTDHCGMCRMLPMTERDTCSQFCLRKGLF
    HDNIEIMLSTELAALQGEPGKFVATLRYRPSLIDPERCNGCGECTRVCPVEVPDEFNAGLATRKAVYLPVPHNLPNSYVI
    DTDACNHCGACQNACPTGAIDLNLEARRSFRILVVDDELVVRDSIKEWLDEAGFAVDMAASGAEAVEMLGRQSYGLLFLD
    VKMPGMDGVEVLKIAKEMHPELPAVMMTAYATIETAVEAMKVGAKDYIMKPFDIEALTEMAVQTYQATLEVPERRVEVGA
    VILATGAVPADPRAGANTYEYGTLPDVVTSVEFERLISGTGPTGGQLLRPSDGKPIRRIAWLQCVGSRNLAEGAPHCSSV
    CCMFSIKEAVLAKQKTDGAVEAMIFYMDMRTFGKDFQQYRDNAEREHGIGFVRSRVHSVEPGGDAGGIRIAFADADGAMH
    DEPFDLAVLAVGQKPGGGLEELAATVGIELNQAGFCRVQDYSSNRTARDGVFVSGSASSPKDISESVIQANSASLSASLL
    LHSKGKSLVEISEPEEMFRDVSREPSRLAVAICSCGGAIAEKVDPTSLIADLTQDGYAAHGFTIDRLCTRAGWAQLEEAL
    ASTGANRVLIGACMPYVYRRKLRELGKSLKLDPAFMEVTDIHTPVHSQPESSEQGPRSAVYAVLSMAAAKLKGAEPFPRT
    RDEAVPAALIVGGGISGMTAALSVADHGYKVHLIERNPELGGNLRLLKRFLQEPQPEALLEKTLSAVANHPHITVHTGTR
    VVHSQGRLGHFVTTVETQDGSGESIEHGVAILSTGGVEFNSEAYLHGRNDAVVTQMEFEDQFHSGKLDASGLGTVVMIQC
    VESREGSRNYCSRVCCLSALKNAFQLKERNPDTAVYILYRDIMTYGLFEEHYTRARREGVLFVRYETDRKPRVSDENGRL
    KLVTYDPVLGRELVLEPDLVVLGTGMVPNDSHGLADIFGLETDEHGFLREAEYKWRPVDTMKSGVFLCGTAHSPRTVPES
    VAMAEAAAQRALGVLRRGRLTSASVTASVRHSLCSLCERCVVACPFHARWYDEEEERIVVDEFVCQGCGACSAACPNGAA
    ILHGFQDRQVHAVLDAALD

    >gi|116748269|ref|YP_844956.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophobacter fumaroxidans MPOB]
    MQRRIGFYVCHCGTNIAGKVAVDEVAAFVRTLKNVVVARSYKFMCSDPGQEMIQKDIRELNLNRVVVASCSPRLHEKTFQ
    SACERAKLNPYYFQMACIREHCSWVTEDPAKATEKAKTLAAAAVNRVNHHEKLWAREVSVHPDVLVIGAGIAGIQASLDI
    AKADRQVYLVEKEPSIGGHMVQFDKTFPTLDCAA
    CISTPKTVAVSQSPKIKLFSYSEVVEVSGFVGNYSVKVRRKPRYVI
    EERCTGCGLCAEACPVSVPNAFDEALSLRKAVYRNFPQAVPITFVIDKKEQAPCRIACPAGINVQGYIQLIGKGKYREAV
    QLIMERLPLPGVLGRVCPHPCESMCRRAAVDTPLAIRDLKRYAADQVNLEDLPLPHIEERPEKAAVIGSGPAGLSAAYFL
    RLKGYQVTIFEALPLLGGMLRVGIPDYRLPQDVLDKEIGYLLRLGVKAETGKKLGRDFSLDDLRNDGYRVIFLGIGAHRS
    LKLNVPGEDSYQGVVDALEFLREVNLGEKSLPGRRIVIVGGGNVAIDASRVALRLGCEEVTIVYRRTREEMPAYAEEIDA
    ALEEGVKINYLTAPVGIRGEANKVTGFEVIRTELGEPDQSGRRRPVPVKGSEFVIPCDAVISAIGQEPEAETCGAGDLNL
    SRRGTIVVDRSSMQTSIPDVFAGGDAVVGPATVIEAVAAGRRAAEAMHRYVTEGIEGLAGIEPEKTGADGGDWREIPEGT
    PQVPRASLHHRSFEQSRLDFEEAAIGLADGDIARETERCLNCGVCSECMECVRACERSAIDHGAVEEIIDLKVGSIIVAT
    GFDVMDPSPLKQYGYGRFDEVYTGLEFERLNNAVGPTGGQILMKNGGKPESVGIIHCVGSRDVNHHEYCSRVCCMYALKY
    GHLIKEKAGHDTRVYNFYIDMRCFGKGYEEFYRRLQEEKVTFIRGRPAEITDQAESPLEQGKLVIVAEDTLSGRMLRVPV
    DMVILCSAMEARAEAPEVARVFGINQGGDGFFLEEHPKLGPMTTPTDGVFLAGACQGPKDIPDTVSHASGAAAQALALST
    RGKVQISPTVSFIDPDICAGCQGCIKLCPYSAIEFDERRGVSVVNEALCKGCGSCAGFCPSGAARVRHFSAKQLFAEIEG
    LLDSAV

    >gi|116748341|ref|YP_845028.1| OsmC family protein [Syntrophobacter fumaroxidans MPOB]
    MEPLQVSTVVLAGANRRMLARTRDHEITLDVPKERGGDNAGPTPPECLTMALGGCVLNICRVLAMQKRIVLDDIQVTIKG
    EIDPSKAFGIPTEKRAGFTNLSVRLKLDSELTETEKEEFRLELIGRCPLCDTLGNATPLQISFEN

    >gi|116748491|ref|YP_845178.1| heterodisulfide reductase, subunit A [Syntrophobacter fumaroxidans MPOB]
    MADVLNANRSILVAGGGMSGLSAALEAAEAGIPVCLVEREPYLGGRVARMNKYFPKLCPPSCGLEINFRRIRNNPLIRVF
    TMAEVEKIAGEAGNFDVTIKVAPRYVNEKCTGCGLCSEAASTAVPDAFNYGLQTVRAAYLPHEFAFPMRYVVAPEVIGTP
    EAEAIKAACPYGAVELDMQPATFDLNVGAIVWATGWQPYDATGIRYCGVGKHRNVITNVVMERLASPGGPTGGRITRPSD
    GVEAKKIAFVQCAGSRDENHLPYCSGVCCLASLKQATYLLERHENASATIFYIDIRALGKYESFFTTVRSDPRVNLIKGK
    PGEISEDPETGMVTVQVEDQATGGIVKDQFDLVVLAVGMVPSCAVETPPAQLALDEHGFVLDEQPVPGIVGAGCARKPVD
    VASSVQDATAAALKAIQATCRR

    >gi|116748727|ref|YP_845414.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MANAVTQSILVVGGGMSGLTAAIEAAEAGHEVYLVEKNPYLGGRVAQLHQYFPKLCPPYCGLEINFRRIKNNPRVRVLTL
    AEVERVSGQEGNWDVSVKINPRYVNENCTACGKCAEACAMEIENAFNYGMDKIKAAYLPHDMAFPMRFVLDPALVKSGEA
    QKVQEACAYNAIELDMQAKSLNLTVGSIIWATGWQPYDATRLDTLGFGKYPNVITNVMMERLASFGGPTQGKIVRPSDGK
    EPQTIAFVQCAGSRDENHLPFCSSICCMASMKQATYIREQYPDAKVYIFFIDIRATDRLEDFYRKVKEDQNVVFFKGKVA
    KIEEDGATKNLTLRVEDTTAGSLHEITVDMAVLATGMQPTTSVAGAPNGIPLGDYGFVGSEGGKPGIIGAGCTRTPAGVS
    ESVQDGTAAALKAIQSIARR

    >gi|116748752|ref|YP_845439.1| methyltransferase type 11 [Syntrophobacter fumaroxidans MPOB]
    MSRISAAHFRWTCSNARVAALSSSPRSSLWAGWPKWRDSLKTSDPACLAPGPPTGHAGLLYERLAASGAAADAIRPGGLP
    LTERALTLCPFPPGSRLLDVGCGVGTTVRYLTDRHGHRAAGIDPSALMIETGRRRYPGLWLMRARGEALPFADDVLDGVL
    AECSLSVTRAADRVVREIHRTLTPGGKLLMSDVYARNPEFLPELRRIGLSG
    CLGGIKSMEELAFSLGASGFEILHWEDHS
    AELKLFAARLILSGGFAADFRCLWGECGGEGRNPEKTRQAVSRVRPGYFLLIAGKRMKKAAGF

    >gi|116748837|ref|YP_845524.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophobacter fumaroxidans MPOB]
    MASGKRILIVGGVAGGASCAARARRLSEEAEIIMFEKGPFVSFANCGLPFHIGDVIEKEEALMVASPQLFKERFNVDVRV
    NSEVVSIDRRNSEIAVKDLSSGETYTEKYDALVLSPGAAPVRLPIPGIDLPGVFTLRNIPDTRRIREWVSANGSNRALVV
    GGGFIGLEMTENLVKRGLTVTIVEAQSHVMPALDPEMVSPVHSELKRCGVSLRLGESVTGFQSMPDGSIRAGLASGGEEQ
    ADIVIVCVGVRPETKLAREAGLEIGELGGIRVDSRMRTSDPAIWAVGDAVEVRDFITGGWTLIPLAGPANRQGRVAADVI
    LGRDREFRGVQGTAVCGVFDVTVASTGLSEKTLKRLGLWKQDYEKIYLHPGHHALYYPGARTISLKLIFSKKDGRIIGCQ
    AAGKEGVEKRVDVISMAIQSNRTVFDLEEAELCYAPQYGSAKDPVNMAGMIAANVLRGDSSIAQWDEIASAAPFVLDVRD
    VKEFGKGHVEQAVNIPLDQLRTRMNEVPGDRDVWAY
    CLVGQRSYYAMRLLSQNGFNVKSISGGYRTFLAAKGGK

    >gi|116748948|ref|YP_845635.1| redoxin domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MRHKPFLKYLQLLTLLLLFLQCYSTHGAEDEQFTVGTRVPSFTLPAPENAQAQKYLELASAQPFTISKIGAKIVVIEFFS
    AM
    CPHCQTNAPIVNRLYKAIQDDARLSKDVKLIGIAVGNNKKQADAFRKTYKVPFPVFLDEEYGITGPLGGVDTPTMLVL
    ATADSKVLACHVGVITDFDAVLKELRELSKKQ

    >gi|116749090|ref|YP_845777.1| DsrE family protein [Syntrophobacter fumaroxidans MPOB]
    MQKMLFIISKGFEKSGGATRAFQFASIAAEQGNPVEVFLIDDAIHWAQLGMAEGIRSSTGESMKELLDSLVAHKSPIHVC
    KACADKRLISPDELIKGAQISGAQVLVKMMTSPEYKVVTF

    >gi|116749143|ref|YP_845830.1| thioredoxin [Syntrophobacter fumaroxidans MPOB]
    MAGKNIIEVTDGSFDQEVLQSDVPVLVDFWAPWCGPCRAIAPVIEELSGDYEARLKVAKCNVDDNPKTPSRYGIRAIPTL
    IIFKGGNVSEQITGAVAKSQITAAIDKAVG

    >gi|116749144|ref|YP_845831.1| thioredoxin reductase [Syntrophobacter fumaroxidans MPOB]
    MKMNDIYDIAIIGGGPAGLTAGLYAARARLKVILLERMGFGGQLLTYEKVDNYPGFPEGIGAFGLSELISAQALKFGLVT
    RNAEVTDLLVDEPIKVVRLADAELLAKTVVIASGASPNKLGVRGESEYTGRGVSY
    CAVCDAPFYRNQEVAVVGGGDTAIE
    EAIYLTKFASRVHVIHRRDQLRATRIIQERALQNDRISFILSSVVTEIKGSGEQGVDRLTIREAKGTKIDELPVNGVFIF
    VGIQPNSGFVPTEVDRDVFGFIRTDQEMKTSVPGVFAAGDVRVKELRQIVTAVGDGATAAFNAGRHIESHL

    >gi|116749155|ref|YP_845842.1| periplasmic binding protein [Syntrophobacter fumaroxidans MPOB]
    MRTVSRIISLAPTQTEIVAALDRLGNLIGVTENCDFPDGVEHIPRFGSWYAPDLRRVIAAAPDLVCTFGSHHEEVRDTLL
    EAGISVVHGDPKSVRESLEAILELAEILD
    CQDVGATLVEGLQERLERVDRFVHDTGPALRPMVFRIMHWKPLITVGSGSF
    QHDAVERAGGRNLMGDGPAPYYVCDPTAVRSRNPEVIFFCEPFIKPLLEKDPLWREIRAVRNGRVHVYDCGLTCRSGPRI
    VDMVERLCEALYPGCAL

    >gi|116749168|ref|YP_845855.1| methylated-DNA--protein-cysteine methyltransferase [Syntrophobacter fumaroxidans MPOB]
    MHEERLAIFQSTFKSRLGWVVLASTARGVCLLHLFGGDKPLEKDVENLILRAYPNGSVRSSPLPPLLAAARDAVSAYLEQ
    GVPLPPIALDLPGGTPFQQTVWAELQSIPFGETRTYGEIARRIGRRQASRAVGQACGRNPAAIIVP
    CHRVLGAGGRLGGY
    SGGLEIKKALLDIERHGRQA

    >gi|116749237|ref|YP_845924.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MRQAQKIGAITVVGGGIAGIQSALDIANSGFKVYLVEEQPSVGGIMAQLDKTFPTNDCSSCMMGPKLVELANHSNIEILA
    YSELLDVTGEPGNFKATVRRKARAVDPEKCVGCGICASKCPTKVPDPFNGEMSERRAIYVPFPQAVPLVYTIDKSVCRYF
    TKGKCRICEKVCKNKAIDYDQKDQIVELDTGAVILTGGFRPFDARLKPEYGYGLWPNVVTSLDYERILSAAGPFQGHIQR
    LSDGKTPERIAWIQCVGSRDSSIGRDYCSSVCCMYATKQAMITKEHEHDAQTTIFYIDMRAQGKGFDRFFERARDETGVR
    YVRSMISRVLPVPETDRLQISYVDEAQKLQQEEFDMVVLSVGLCAHPSTMDLAKRLGVEVDPFGFCKSDAMDLVATSRPG
    IFVSGVFQGPKDIPDSVQQGSSAAACATALLADARGSLIVTPPKVEEKDIKGQKPRIGVFICHCGINIAGVVNVEEVAAY
    AKTLPGVEYASNCMFACSTDQQKEIKRVIDEQQLNRIVVASCTPRTHEPLFRNTMREAGLNPYLFELANIREQDAWVHQG
    EAGAATEKAKDLVRMAVSRSTLLEPLHDFSYQVVQSALVIGGGLAGMTAALAVADQGFPAVLVESAEELGGNARTLYYTE
    DGASPAEYVQELIKKVESNALITVRKGAEVVSLMGSCGNFTTTIRYHGQTEEIPHGVGIVAVGGEEYKPEEYLCGQDPRV
    MTQKEFESLLAKEPEKAKQFGRVAMIQCVGSREPENSYCSRVCCTSAVKNGIKLKELNPKAQVSILYRDIRTFALKELAY
    QEARRRGVRFMRFDADRKPEVKANGAGLQIALHDGQLGRPISLEADLLVLSAAIRPRADSKKLAETLRMPLDQDGFFSEA
    HIKLRPLDFATAGFFLCGLAQGPKFANEAIAQARGAVSRACTILSQKEIVAEGVVTQVDAALCRACGECENTCLFEAIKV
    KQMEDGRKRAMVNEALCTGCGACNAACPTGAASLAHFRDKQVNAVIQAL

    >gi|116749337|ref|YP_846024.1| OsmC family protein [Syntrophobacter fumaroxidans MPOB]
    MIRQASGGSREAFLRDIRSSRCASQIAGSRVGASLRRLPVGVGMRRERNMIYTVKVDVKEIENRIVECKVRNHVVRVDQP
    KEFGADDTAPTPPEMLAISLGS
    CVVSTIQFIAAQRNLDVGNIEVSVEGSIDFSRAMGVSDRERAGFGALKVGIRFDSGMA
    SREKEDFIKTVFECGASIDNIRNATPVTCEILE

    >gi|116749408|ref|YP_846095.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MKNKNELKPVTGAVMVVGGGIAGVQSALDLADSGFYVYLVEKSPSIGGVMAQLDKTFPTNDCSMCILSPKLVEAGRHLSI
    QLITKAEVEKVEGEAGDFTVTVREQPRYVDSSKCIACGVCAEKCPKKVDDLFNEGLGKRKAAYVKYPQAVPLKYVIDEDN
    CIYFKSGKCRACEKFCPAGAVDFSQKARDHVIKVGSLILAPGFQPFEPAVYDTYGFGKYPNVITSMQFERILSASGPFEG
    HLVRPSDGKAPQKIAWLQCVGSRDIHRGAHGYCSGVCCMYAIKEAVIAKEHAHGDLDTAIFFMDMRTYGKEFERYYNRAK
    TETGVRFIRSRIHSIEPAGAGSHDLKLEYVDDGGVARSEEFDMVVLSVGLEVSRDIRDLAARLGIELNEDGFAAASDFAP
    VETSRPGIFVSGAFSGPKDIPYSVMESSAASAASAALLAASRNSLTKEKTYPDENPVSGEETRIGVFVCHCGINIGSVVD
    VPAVRDYARSLPLVAYVADNMFTCSQDTQKLIRDAIVEHKLNRIVVAACTPRTHEPLFQETIREAGMNRYLFELANIRDQ
    DSWVHQAEPEKATQKAKDLVRMAVAKVALLEPIEKLRVELNQSALVIGGGVAGMSAALNLADQGFKTFLVEEKNELGGHA
    LKVRKTWRGEEVGPFVARMRDRVLNHENIEALVGARILDVQGFIGQFNTTVQVDGSERNLEHGVTVLATGAHSLKPEEYL
    YGRSERVTRWHELQKLFDEKPGELERAEAVAFIQCVGSREPERPYCSKICCTASVQEAIELKTLKPDLDVFILYRDLRTY
    GQREELYRKAREQGVLFIRYSVDEKPLVETIPGSEKLRITVRDHVLGRPVQIDVDYLNLATAIIPKGQETLAKFFKVPLN
    EDGFFLEAHMKLRPVDFATDGVFIAGLAHYPKPIEESIAQAQAAAARAASVLAKPFVEVAPVVSVVDQEACIGCGLCEAL
    CPFGAIRLHKVIGKGFRAETISASCKGCGVCSASCPQKAIDMKHFRDRQIVAAIRAGGQRG

    >gi|116749579|ref|YP_846266.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MSNLSRNLVGSVMVVGGGIAGVQAALDLADTGYFVHMVEKSEAIGGVMSALDKTFPTNDCSMCILSPKLVECGRHPNIEI
    LTLTEVREVGGEAGCFSVKLRSRARYIDAKKCIACGVCAQKCPRKVPDAFNLGLNRRKAAYVKYPQAVPLKYAIDREHCL
    YFEKGKCRACEKFCPAGAVNFEDEDRDFSLEVGSIILAPGFQTFDPKVFDTYNYSRFPNVITSMEFERVLSPSGPSGGHL
    ARPSDGREPRRIAWLQCVGSRELNRCDNAHCSAVCCMYAVKEAVIAKEHSREPLDATIFFMDMRTSGKDFEKYYQRAREE
    QGIRFVRSRVHSVEQARESGNCLIRYAADDGLPREEEFDLVVLSVGLETSPQVLELARRMGIAIDAARFAATAPFAPVST
    SVPGIFVCGAFQGPKDIPQSVIEASAAAAEAASLLAPVRGAVARKPAETAESEISGEEPPRIGVFVCHCGINIGAVVDVP
    AVKDYAGTLSDVAYVEESLFTCSQDAQDRMKEAIREHGLNRVVVASCSPRTHEPLFQQTIREAGLNKYLFELANIRDQNS
    WVHQDFPEAATIKAKDLVRMAVAKVALQKPLEEIRLNVTRSGLVLGGGVAGMEAALALGGQGFPVTLVERGDDLGGNARK
    LLTVWNGDPVRPYLDSLIERVENHPLITVRKKTVLKEVRGFVGNFCSVLESGGNSEEVHHGVAVIATGGQPHKPDEYGYG
    TDGRICLNTELDEAVSNRRRSFVDARSAVFIQCVGSREPARPYCSRVCCSHSIENAIRLKEINPAMDVVILYRDIRTHGL
    RENLYREARRRGVLFIRFDADRKPEVETGGDSLQVTVFDPILQRRIVLHPDVLTLASAIEPRESEGPAKLFKVPRNPEGF
    FLEAHMKLRPVDFATEGVYVAGLAHWPKPLEESIAQAKAAAARAATVLARDFIVAGGVTAVVEKDRCSGCRACVECCPFG
    AVSYLEREGRCEVNQALCKGCGTCASACPSEAVSLMGFSNPQIYRQIDEALSA

    >gi|116749769|ref|YP_846456.1| redoxin domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MTERPGAVTMKGAPLTLVGKEIKPGDRAPDFEVLDNGLAPVRLGAYQGKVIVLSSVPSLDTPVCDMETRRFNSEAAKLGD
    EVVVLTVSMDLPFAQKRWCGAAGVEQVTTLSDHKDASFGLAYGVLIKELRLLARSVFVIDRQGVVRYVQLVKEITHEPDY
    DDVLQAIAKAR

    >gi|116749973|ref|YP_846660.1| hypothetical protein Sfum_2547 [Syntrophobacter fumaroxidans MPOB]
    MPNRLSAEKSPYLLQHADNPVDWYPWGEEAFRKAKEEDKPVFLSIGYATCHWCHVMERESFEDEEVAALLNEHVVAVKVD
    REERPDIDQIYMTVCQALLGSGGWPLSVFMTPEKNAFFAGSYFPKHARLGMAGFTDVIRRIVHMWKNDRERLLEAGRQIT
    ESIQPRPVQTVGSLPGPEVLEEAYSRLSRAFDATWGGFGSKPKFPTPHHLTFLLRWHRRNPWSDALAIVEKTLDGMRDGG
    IFDQVGFGFHRYSVDEKWLVPHFEKMLYDQAMLALAYLEAFQVTGRERHGRVAREIFEYVLRDMTDPDGGFYSAEDADSE
    GVEGRFYVWTPAEVNALLGNEIGETFCRFFDITPEGNFEDGRSIPHLAELADSLSDRDEPGIGGLEDLLEKGRRLLFEAR
    RMRVHPLKDDKILTSWNGLMIAALSKGSRALGDRSYALAASRAADFILDRMRRDSGRLHRRYRKGEAAIHAYADDYAFFI
    WGLIELYEAAFDVRYLEEAVKLQDLMIDLFWDDAEGGFFFTPNDGENLIVREREIYDGAVPSSNSAAALNLLRLGRMVGA
    VRFEEKADRLLRRFSETVRDYPSAYTQFLHAVDFAAGPTREVVIAGSPDNATTAEMMKIVGSGFVPNTVVLLRGTPESGA
    RLAELAPYTAGLVAPGGNPAVYICEKFACTSPITEIEELRETFG

    >gi|116749974|ref|YP_846661.1| redoxin domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MKKTMTSRVVALVACCALLGLTSSALGLSEQFQGRIFQGGKLKPVDSQPKLKVGDKAPDFTLPSLSGEPVSLHQFLGKKN
    VVISFVPAAWTPV
    CSEQWPGYNIVKGLFEAADATIIGITTDNIATLYAWTEQMGGVWFPVLSDFWPHGEVAGKYGVLRSG
    GVSERALFIIDKQGIVRYIDIHDINERPNLETLIGELQKVK

    >gi|116749975|ref|YP_846662.1| redoxin domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MEEVQYLGLKEKVSFKIPETRAEVVIVEIFSMYCPFCQKEAPAVNQLYQIIANRADLKDKVKIIGIGAGNSQFEVNAFRD
    LYRIAFPLFPDTDFSVHKLLGEVRTPYFIVIRIKPDKTHSVIYSQVGAIGDPGQFLEKILSKPAPGKGV

    >gi|116749997|ref|YP_846684.1| methionine-R-sulfoxide reductase [Syntrophobacter fumaroxidans MPOB]
    MMNRRSASLLLLLGIGAVAFGKPGALTARAERRLEAMSSANHPDTGTRETGAAPDAVVKTDAEWRASLTEEQYAILRQKG
    TERPFTGKYHDFKGKGTYVCAGCGNPLFSSDTKFDSGTGWPSFRAPISDKNISTATDRSFLMTRTEVLCARCGGHLGHVF
    NDGPAPTGLRY
    CINSAALDFVAD

    >gi|116749998|ref|YP_846685.1| peptide methionine sulfoxide reductase [Syntrophobacter fumaroxidans MPOB]
    MKISVLVIALLLLGSAAALLVFTASGPGSEGKYPAGNAKLAEATFAGGCFWCMQPPFDKLEGVVSTTAGYTGGREKDPTY
    EQVSAGATGHVEAVRIVYDPSRISYEQLLDVFWQNIDPTQPDGQFADTGPQYRTVIFTHDDEQRLLAEASRRKLEQSGRY
    DRGITTEILPATPFYEAEEYHQAYYRKNPLRYEYYRRMSGRDRHIAEKWGREKPARSGKAAEK

    >gi|116750071|ref|YP_846758.1| dihydrolipoamide dehydrogenase [Syntrophobacter fumaroxidans MPOB]
    MVMGEFTQETDVLVIGAGPGGYAAAFRAADLGLDVTMVDTGDRPGGVCLFRGCIPSKTLLYVTELLYDVGRAADMGISLG
    EPKIDLPRLREWKKQVVDKLAGGLVELCRSRGVQFLRGRAVFESSSYARLLEAEISRIKFKHAVIATGSHARSIAGAEFR
    DGGRIMDSTGALELTDIPKRLLVVGGGYVGVELGSVYASLGSRVTMVEAGERLMAGADQDLTAFLSRRLSGLFEAVHVDT
    RIQSLREFDDWVEVELEGKVDQPAQSFDRVLIAVGREPNSGGIGLEKTGVEVNEHGFIVVDEQRRTTDGKIYAVGDVAGG
    VMLAHKAMHEGKVAAEAIAGQKSAFDYQAIPAVVYADPQLAWVGLTEEQARRENRPVKVSRFPWSASGRAATMGVPRGMT
    KVIVDPDTQRVLGVGIVGREAGEMIAEAVLALEMGALAEDLALSMHPHPTLSESEEEAAEAFLGTSTHILPQRR

    >gi|116750121|ref|YP_846808.1| RnfA-Nqr electron transport subunit [Syntrophobacter fumaroxidans MPOB]
    MITPKRSLFFPGIAAALLGLILLCGCETEHSFIKKTAFKGAREIVVSFAGPVEEGWASTAANFRIYEKTDPDIPLKIVRT
    GLSADRTTLTLVFDEDLNQKQPHVLAVTGIRSEGKPVGDALVSVKKLYAGYVFSILIGAMIINNFVFTKYLGLCVFFGTS
    KRKSTAVGMGVTFTIVMVVSAMMSWALYQFILKPFSLNFLQIVVFIGMVSLSVQAVDTILRKVNPALFKAFGVYLVLVIA
    N
    CVIIAVPLLLADNEYNALESLALAIGAGVGFFIALFLMSSVRERLELADVPPTFRGLPIAFVLGGLFALAFMGFSGMSI
    F

    >gi|116750167|ref|YP_846854.1| periplasmic binding protein [Syntrophobacter fumaroxidans MPOB]
    MAYPFSLIVVLFLGLSAMIPWRCEAGMLPGPGGEAIRVPHDPTRIVSLAPSITEILFSLGAGHRLAGATDLCDFPSEASL
    LPKVGRFPGPDLERIVSLRPDL
    CIALKNVNPADLLDRLGTFGIPVYVVEPKDLSTTMETILELGRLLDAEARAQELVGGM
    SSRVERVKSRVAKVGSRPGVFLQIGVTPIVSVGSHTFIDELITLSGGRNLAQGPVPYPRFSREQVLALQPEVIIITSMTR
    GLVFERVRDEWREWESLPAVKNQRIFIVDSDLIDRPTARLAEGLEMLAGLIHPELF

    >gi|116750310|ref|YP_846997.1| cytochrome c biogenesis protein, transmembrane region [Syntrophobacter fumaroxidans MPOB]
    MRSRKWLIVTLSAAAAAAGALWLTGCAVSPVDVPSVDAPNGPATPLQGWTMIWTLLGIFAGGMALNLTPCVYPLIPITVS
    YFGGRATGAGTAPGSVVAHGLCYVAGLAVTNSLLGVVAALTGGLMGGLLQNPLVLSAVAVILVVFATSLFGFWELRLPAG
    LTQAAAKPYPGYFGSVFMGLTLGIVTAPCIGPFVLGLITWVAGIGSPLFGFLVFFTLSLGLGCPLFVLAVFSGYLDRLPR
    SGGWMVWVRKLMGWVLIGMAAHLVSPVLPVFAETWLLAAVAVAAGVHLGWVDRTMDDSQAFLRTKAATGLICFALAAFLA
    ASGTMRGAGVEWKPYSEENLQEAQRLKRPVVIDFYAAW
    CMPCRELERFTFSDSSVVERARNGFAMLKVDLTAGGDPLHRR
    LMQQYGIRGVPTVVFLDAAGRERKDLRVVGYIPPERFLGLMDALAKAGS

    >gi|116750393|ref|YP_847080.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MSDVKTGAIGAVLVVGAGVAGMQASLDLADSGYLVHLADRSPAIGGIMSQLDKTFPTNDCAMCIISPKLVEVGRHPNIRI
    YPGSEVEALEGKAGCFKPTLATQPRFIDLERCTACGQCRQVCPASAINEFNQGIDRREATFMRYPQAIPRGYGIDRASCL
    GCGLCEKVCLAQAVRYDDQPRRTALEVGAVILAPGNEVFDPSNMDTYPYRDHPNVVTSLEFERILSASGPYRGHLMRPYD
    REEPTRIAWLQCVGSRDLQHCDNAYCSGVCCMYAIKEAVIAMEHAQGKLDTAIFFMDMRTYGKDFEHFYNRARDEHGVRF
    IRSRVHSVTPVGDGDLSIAYGTESGSIEEEIFNMVVLSVGFEVGRETIALSQRLGIEINENRFARTTSFAPVETSREGIY
    VCGTFQGPKDIPQSVMEASAAVAASSTLLSEARWTQAAVPEKPVEVDVRGEPPRIGVFVCQCGINIGGVVDVPAVREYAK
    GLPHVVYVEDNLYTCSQDTQVKMCQVIKEQGINRVIVAACTPSTHEPLFRETLVSAGRNKYLFEMANIRNHDSWVHQGDP
    VRATQKAKDLVRMAVAKAALLEPLEEPRLSITRGALVIGGGVAGMVAARALADLGYPVHLAERGAQLGGQARSLFKTWRG
    EDIRRFVDDLAQTVLHHPRVTVHLASTVTQVEGFVGNFRSTLGNGTDPVTVEHGVAIIATGGKEHRPEGYLYGQDPRVLT
    HQELDERFAARDPFLSSVESAVFIQCVGSREPERPYCSRVCCTHTVESALELKRLNPAMDVFVLYRDLRTYGERELLYQE
    ARRAGVLFVRYTLENKPLVEEREERLRVTVFDPILQRQVVLSADLMVLASAVIPNEARQLSQFFKIPVTAENFFLEAHAK
    LRPVDFATDGVYVCGLAHYPKSIDESIAQAQAAAARAAILLARDSLALSGTVASSNPNVCSGCGVCVNICPFSAPRFMES
    GRDAGKAEINPALCKGCGLCAASCRSGAIRLKGFDDAQIFAMIESV

    >gi|116750435|ref|YP_847122.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MSDVKTGAIGAVLVVGAGVAGMQASLDLADSGYLVHLADRSPAIGGIMSQLDKTFPTNDCAMCIISPKLVEVGRHPNIRI
    YPGSEVEALEGKAGCFKPTLATQPRFIDLERCTACGQCRQVCPASAINEFNQGIDRREATFMRYPQAIPRGYGIDRASCL
    GCGLCEKVCLAQAVRYDDQPRRTALEVGAVILAPGNEVFDPSNMDTYPYRDHPNVVTSLEFERILSASGPYRGHLMRPYD
    REEPTRIAWLQCVGSRDLQHCDNAYCSGVCCMYAIKEAVIAMEHAQGKLDTAIFFMDMRTYGKDFEHFYNRARDEHGVRF
    IRSRVHSVTPVGDGDLSIAYGTESGSIEEEIFNMVVLSVGFEVGRETIALSQRLGIEINENRFARTTSFAPVETSREGIY
    VCGTFQGPKDIPQSVMEASAAVAASSTLLSEARWTQAAVPEKPVEVDVRGEPPRIGVFVCQCGINIGGVVDVPAVREYAK
    GLPHVVYVEDNLYTCSQDTQVKMCQVIKEQGINRVIVAACTPSTHEPLFRETLVSAGRNKYLFEMANIRNHDSWVHQGDP
    VRATQKAKDLVRMAVAKAALLEPLEEPRLSITRGALVIGGGVAGMVAARALADLGYPVHLAERGAQLGGQARSLFKTWRG
    EDIRRFVDDLAQTVLHHPRVTVHLASTVTQVEGFVGNFRSTLGNGTDPVTVEHGVAIIATGGKEHRPEGYLYGQDPRVLT
    HQELDERFAARDPFLSSVESAVFIQCVGSREPERPYCSRVCCTHTVESALELKRLNPAMDVFVLYRDLRTYGERELLYQE
    ARRAGVLFVRYTLENKPLVEEREERLRVTVFDPILQRQVVLSADLMVLASAVIPNEARQLSQFFKIPVTAENFFLEAHAK
    LRPVDFATDGVYVCGLAHYPKSIDESIAQAQAAAARAAILLARDSLALSGTVASSNPNVCSGCGVCVNICPFSAPRFMES
    GRDAGKAEINPALCKGCGLCAASCRSGAIRLKGFDDAQIFAMIESV

    >gi|116750481|ref|YP_847168.1| rhodanese domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MIEAFAAAQGYDGAAPGRKLLTGVWQGALVVVFGVLLGLTVNHFRLAGLPLVAEWSMEKQVASIPTQENPVVDLEEATAL
    YMTRGAVFIDAREAKFYRMGHVEGARNLPWEDFENRFPQIMADIPPDTLLITY
    CDGEACTLSKDLAVALVGKGYPHVRVL
    LNGWSVWQAANLPVERE

    >gi|116750554|ref|YP_847241.1| 4Fe-4S ferredoxin iron-sulfur binding domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    METSNGSTFGSVMVVGGGVAGIQAALDLANAGFYVYLVERASAIGGAMSQLDKTFPTNDCSMCILSPKLVECGSHPSIRL
    LTTSELTALEGDVGRFRAKVLQHPRYVDLSKCISCGACAEKCPAVVSDAYNAGLGKRKAIYKLYAQATPSGYAIDAANCR
    RIGRGKKCSVCAKFCPAGAVDYTQQEQVLDLEVGAVILSAGFQAFDPAGLDTYLYNDHPNVVTSLEFERILSASGPFMGH
    LVRPSDHAEPRRIAWIQCVGSRNVNHCENGYCSSVCCMYAIKEAIVAKEHSKEPLDATVFFMDMRTYGKDFEKYYNRAQS
    EYGVKFVRSRVHTIDRAPGDRLSISYTTEAGEQSEEQFDMVVLSVGMEVSAEATALAGRLGISLNSYRFAETSSFAPVST
    SRPGVYVCGVLQGPKDIPFAVAEASAAAGAAAGDLADSRGTRVKVRELPPELDLGDESPRIGVFVCNCGINIGSVVKVPE
    VVEYAAKLPHVVWTEENLFTCSQDTQERIRQAIKEHRLNRVVVAACSPRTHEPLFQDTLKGCGLNKYLFEMANIRDQDSW
    VHQKEPGNATEKAVDLVRMAVARAALLKPLIERPLEINQKALVIGGGISGLNAALNLARQGFEVALVEKEKELGGIARRL
    HHTIEGLDVQSYLAELVREVRGNGRIEVLSDTVVAGYKGYKGNFVTEVRTNSGEERRTIDHGVAIVATGAVEYKPTEFLH
    GEHPMVMTQLDLGRLIHEDGRGISKWRRVVMVQCVGSRNEQNPNCSRICCQNAVKNALTLKELNPDLEIIILYRDMRMYG
    MLEDYYTKARQEGILFCRYQQANPPAVTSENGALRVTFSDHVLNRSIQAGVDAVVLSAGTVAADNERLATLLKVPRNAEG
    FFIEAHAKLRPVDFSSEGIYLCGMAHGPKLISESIAQAMAAASRAGAFLSSKDLTIGGVVARVDPSLCAACLVCVRSCPY
    GVPQINKDDVSEINEALCQGCGICASECPAKAIRLAHYADDQIMVKVDALLEGVL

    >gi|116750589|ref|YP_847276.1| hypothetical protein Sfum_3168 [Syntrophobacter fumaroxidans MPOB]
    MEKTRNLLATGTGIIAVGALIGVLAALLQKLGNPGNMGICVACFDRDITGAVGMHRADVVQYLRPEILGFVLGSFVAALA
    TREFKSRGGSAPLARFVLGMTAMIGALVFLGCPWRTLLRLAGGDGNALLGLAGLVVGVWIGTLFFKQGYSLGRSQKQSFG
    TGLLMPLLILGLLALRFIYPPVEGQTQSGVLFYSAKGPGAAHAPLFISLGIGLLVGFIAQRSRFCTMGALRDLILFRQWH
    LFSGFLALLAAALVTNLVLGQFHPGFEKQPVAHTQAFWNFAGMLVAGFSFALAGG
    CPGRQLFMSGEGDADAGVFVFGMIT
    GAAFAHNFGLASSPAGIGPHGMAAVAVCLFFCLVIGFGNIERTRA

    >gi|116750639|ref|YP_847326.1| glutaredoxin [Syntrophobacter fumaroxidans MPOB]
    MAVDVIVYTVEECPFCEKAKRFLAEKGIEYKEIPVRPASRQWLEMKEKTGGGTVPQVLVEGVPVGGYSDLVSLEATGELY
    RRLGMKDREAAATLYDVIILGAGPAGLSAAIYAIRKLLKTLVISRDVGGQVTWTADVENYLGFSHVNAGDLVARFEEHVK
    TFGVERVIGPEVTSVDLTAKIKRVVTDDGKVYSGKTLIIATGGRHRHMNIEGEHELIAKGISY
    CSTCDAPLYDGADVAVI
    GGGNSALAAALDLIQIANRIYLVSMTPLTGDPLYQEKVQKSEKVEMFLEYVPVRVLGDKAVRGVEIRSLQSGEVRELTVE
    GIFVEIGILPNSSLFVDTLATNRRGEILVDLECRTGLAGVFACGDVTNVPFKQVVVAVGEGAKAALSAYSYLINQ

    >gi|116750640|ref|YP_847327.1| YruB family glutaredoxin-like protein [Syntrophobacter fumaroxidans MPOB]
    MDKKVKIYTTPGCNYCRQAKEFLEEKGIDFESVDVSADKEAMQEMRKLTEGGRSVPVIRVCDQVLVGFDRKDLEKALECL
    GA

    >gi|116750644|ref|YP_847331.1| heavy metal translocating P-type ATPase [Syntrophobacter fumaroxidans MPOB]
    MTCAACVRRVEQGLKELEGVRDASVNFATSRASVDYDPEVSGTEAIAERIRDIGYEPVSIDSAEDEKLRKTTLLVGGMSC
    AACVRRVENALKSVPGVDRAAVNLASSRATVFHDSRVAPVASLRAAVEDAGYEYLGLFRETPQEDPVEAARDRELRDLRV
    KVAVGAVLSVVIMTGSMQHWFPFLHGIPRGIMQVALLVLTTPVVFWVGDRFLIGALKATRRKSADMNTLVAIGAFSAYVY
    STLATLWPAFFASAGIETHVYFDGAAMIITLVLLGRLLEMKARGRTTAAIKKLMQLTPKTARVIHGDREMDIPVEEVVEG
    NLILVKPGGRVPTDGRVETGASAVDESMLTGESIPVAKEPGSNVFAGTINQTGSFTFRATRVGSETALAQIIRLVEEAQG
    SKAPIQYFADRVAAVFSPAVIAIALVTFCIWYFVVPGDTFSRALLNFVSVLIISCPCAMGLATPTAVMVGTGLGAESGIL
    IKGGESLERAHELTTVVFDKTGTLTNGTPEVTDVITAPGMQRSELLTLAASIEAVSEHPLARAVVERASAEGCAPLPVED
    FRALSGLGSRGLVNGREVMVGSARLLAEHSVDFGELNTQAETLVAAGRTCVYVGAQRRIIGVIALADGVKESAVAAVARL
    RERGMEVAMITGDRKETALAIAKVVGIERVMAEVLPGDKAGEIRRLQNEGKVVAMVGDGINDAPALAAADVGIALGAGTD
    VAMEAADITLIKGDLRLVVSAIELSSLTMRVIKQNLFWAFFYNSLGIPVAAGALYPFFGILLDPMFAAGAMALSSVSVVS
    NALRLKRLWGKRRN

    >gi|116750728|ref|YP_847415.1| rhodanese domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MKSGKALGVWMLGLALLLCLSSGVFALGGRTDEAEVQKLAAKFHNEAAGGGYRIVSTGEFKAWLDQLDPRWASDMRTLLI
    VDTMPLDDGFRKHHIPGAVPFEFPNDEVNRLDDKTKAKFEELLGPDKNRKVVFYGRDTQ
    CGRSHNGAMWAARLGYTRVYR
    YPDGIKGWLEAGYMVDRTD

    >gi|116750771|ref|YP_847458.1| methyltransferase type 11 [Syntrophobacter fumaroxidans MPOB]
    MRFPESSSFQGKLLRWIKGSMGKAFRIAVNNPLLNSAAAWCGADPLLCRLHHQWVGRNFNPAKSLQENVGFSHREDVEAA
    LSKVHGTLWSFACGNLEEGASILDLGSGTGLIAKRMSSRFKIVGIDISEELTRVARKENPQCEFHVGDFLSFECGSDFAL
    IYSIGVLMYFPPSRLRLFFERAHEVLRPGGYLFLQYSHALKRSDLWFPDISSIKYSPAIVER
    CAAEFFKIEAHHHSFFEE
    KIVQDYDRDPFPMDSFVNGYLLIARRP

    >gi|116750810|ref|YP_847497.1| hypothetical protein Sfum_3389 [Syntrophobacter fumaroxidans MPOB]
    MAEKDITRITVGRQSISLVGLRSLLEEMAESHAGRDEKEIIEYMMNHLGRQNYIPASAREEYGRAFIREFRKFTGQPYTE
    APREGLDIKVLGAG
    CNQCDKLTQLVMEVLSENRLPGSVEHVTDYKEIAGYGLMGVPALVIDGKAYSVGTVPPKSQIEKFI
    ARAVAEAAARTE

    >gi|116750903|ref|YP_847590.1| redoxin domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MNRWGTWRFCCIALIALTFAGGLACPVGPASASEAKMMLTGLFGSDPKAPDFELPDLDGNKIALSKYKGNRPVLFYFWAT
    W
    CPHCMAAKPAIMSIRKDIPESNLEILAINVGGGDSIERLKKFRQGHPMPYPLLYDGDQKVCRAYQVQGIPLFVLVDKEG
    KVLYRANELPRNVKELLKLK

    >gi|116750967|ref|YP_847654.1| dihydrolipoamide dehydrogenase [Syntrophobacter fumaroxidans MPOB]
    MAGDGKYDVIVIGSGPGGYVACLRAAELGLRAACVEKSDRVGGACLNVGCIPSKALLESSRYYTLARKRFQEHGIVLDDQ
    VLDLPVMMARKSEVVRGLVENVRKLLENAGVALIRGTARLAGEHRVEVTRDGEKTMLEADAVVLATGGEPVPVPSLPFDG
    CRIVSSTEALDFDRVPEHLAVVGGGTIGLELGSVWSRLGARVTVIEMMPGIAAVADGQVSRTLERLLGRQGLEFRLRTKV
    TGAEVTDEQVVLTLDADGKEDRIACDRVLVAVGRKPFTGGLGLEALGIGTDPRTGHVLVDERYRTGVASIYAVGDLVPGP
    MLAHKASAEGIAAVECIAGLPGEVNYDTIPSVIYTSPEVAGVGLTEEQARERGLSFVAGSCPFTGSARARCIGDTDGFVK
    VIAHGRTGRLLGVHIIGPEASELIGECAGALERNATAEEFARVVRAHPTLSEAVRDAALIVQSSRKRG

    >gi|116751012|ref|YP_847699.1| hypothetical protein Sfum_3594 [Syntrophobacter fumaroxidans MPOB]
    MASFLFILSKDENEAATRCFQFARIAHSKGHEVNLFFIDAGVMWANKERDLTLKTTTGDCPGDYLPYLVENEVRVGVCTP
    CARNRKLDEAKFYHNMALDGGPHLIDMAAESKVFNF

    >gi|116751016|ref|YP_847703.1| redox-active disulfide protein 2 [Syntrophobacter fumaroxidans MPOB]
    MEIKVLGPGCPKCRQTEKNVREAVSESGVDAEIEKVTDILKIGEYGVFGTPAVVIDGEVKSVGKIPTKEEIKRWIGK

    >gi|116751022|ref|YP_847709.1| thioredoxin domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MNKLIGFVALLGLLTLTTPVFAADEQPPLPEVPVKGMVTMVDVGAEKCIPCRMMAPILRELGEAYKGRAAIVFIDVWKNK
    GQEQRFGIRAIPTQIFYDKEGKEVRRHEGFLDKVRIVEIFRELGVED

    >gi|116751066|ref|YP_847753.1| DSBA oxidoreductase [Syntrophobacter fumaroxidans MPOB]
    MLSFFLLADTAGLRKIFSGPDNSEVIAKIAGESVTDRRIEIMLGARLYDLKKEIFKLKKDRIDHLLLDQLIEKEAASRGM
    TFDDFVNQVIVPNGVTIEEAEIDGYIRENRDRMREWTGTYEELRERIRGFLEQQKRFNAIRAYGKSLEPKYGAAIYLKEP
    QYPIVEVKLDGSPSLGPADAPVTLVEFSDYQ
    CPACRATQEGVKKVKSHFGDRVRLVFKDYPLKRHKNAHLAAQAARCAGD
    QSRFWDYQDVLFAWEQELDVTQLKRFARDLGLSTRMFDECLDSGKYKTAVERDVEEAVRIGVDRTPSFIVNGKLIVGGPS
    FERFEKIIEEELNKPKGKS

    >gi|116751190|ref|YP_847877.1| heavy metal translocating P-type ATPase [Syntrophobacter fumaroxidans MPOB]
    MERMAFRIRGMCCGDEISVLKRQVGPLVGGELNLSFDLLNGKMTVVSSGPPIRAEEITAVVAATGMQAVPWVDFCSGGVC
    AVEEGLWRRHGRLLLCCASGLLIVAGFLLHVFQNGSFLEALAGGEHAGRPFPPGTVMLYACAIVAGGWNIAPRAFFAARN
    LQPDMNLLMAVAVVGAIWIGQWTEAASVTFLFSLALLLESWSVGRARNAIRALTDISPRTARFICPTDGDIEEKPVDDVP
    VGATVLVRPGEKIPLDGTVTAGASWVDEAPITGESLPVEKRMGDPVFAGTVNGEGAIEFRATRPSGDTTLARIIRMVEEG
    QARRAPAEQWVERFARFYTPAMMILAGLIAVAPPLVLGGDWTGWFYQALVILVIACPCSLVISTPVSVVSGLTAAARHGV
    LIKGGAFLEAPAHLRSIAFDKTGTLTRGEPRIQEIIPMDDHTESGLLLNAAALESHSTHPLARAILNAAQARGIEYTPAR
    DFTILPGMGARGVIDGRPYWIGSHRMLESLERESPLFHEMACRLEDAGHSLVAMWCDDHICGVMSVADMVRPEAGEVIRE
    LKSLGVRRVVMITGDNHRTAAQAARAIGVDEFHSELLPEDKVELVSKMEQESGPTAMVGDGVNDAPAMTASSVSIAMGAM
    GSDAAVETADIALMSDDLTRLPWLVRHSRRTLGIIKSNIAFSLGVKALFVVLSVMGLANLWGAIAADMGASLLVIFNGLR
    LLGDTVPRSPALTGTAA

    >gi|116751291|ref|YP_847978.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophobacter fumaroxidans MPOB]
    MPKQAGSSTPGESQLGAEVEDQLRAAFKALPHDMPVFLFTDGKSKDPLGAAAKQMMRLFRNLSDRIKVKEYDMDHPEARK
    WNVTGAPTFLFDPERYSIRYMGTPFGEEGRTFLGALILIGSGTGSLSEQSRKVLKKIDSPRDVKVFVSPT
    CPYCPEQAIN
    AIRAAIENPEFISLEIIDIQANPELADKYGAFSVPQTFANDVLIAQGAQTEELFLLSLEKMEQQNVFIPESDAAVLDVDL
    VIVGGGPAGLTAGIYAVRSGLRTAVVEAGQLGGQVAATPIVENYPGFTRVPGKTLVDILVSHALEYTEIFQGEKVLEIIR
    GDPLEVRTTRRKFLTRAVILATGAEYKKLGVPGEARLAGRGVSY
    CATCDGPLFKGKKVIVVGGGNSAATEALYLHNIGVG
    VTMVHRRDTFRAQEHLTRNVLGNNIPVFWDTEVKEIRGKERVSEVELFNGKTGRTQTVPTDGVFIAVGYSPTVELALKAG
    VEITPDGFIKHDSHHRTNIPGIYSAGDVEGGYKQIVTAMSQGTEAALSVFEDLKTPYWLSEAVVKAAG

    >gi|116751439|ref|YP_848126.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Syntrophobacter fumaroxidans MPOB]
    MNAKRVVVIGAVALGPKVACRLKRLHPESDVVMVDQDEYISYGGCGIPYFISGDVSDVKELMSTSYHMERTPRFFEDAKG
    VRVRTRTRALSIDRKAKTVRVKDLRSGLEEDLPYDRLVLATGSEPNRLSIPGVDLPEVIGVSNIASAIAVKERIAKGQVN
    KALIIGAGAIGCEMAEALSDLWGIETTVVEIADQVLPIVLDRGLARMVQKHMEEKGVSIRLRETVKAIRRNGGTSALTVA
    TSQGEIEADLVIASIGVRPKSNLAREAGLVTSPRGAVVVNRRLQTSDPDIYAGGDCIEVLHLVTGKPVFFPQGSLANRQG
    RVIGTNLAGGFATFNGVVGSFSIKIFDLAVASTGIPLHTALNEGFDAARALVVQADRAHFYPTQDLMYLEVIADRKTRRV
    LGAQGIARNGDALTGRINAIAAMLPYRPLLEDLANMEVAYSPPFASALDIVNAAANTAENILDGINRPVDPEEFEKCFLD
    AQADDAVCLDVRGPANAAPFVAYFGERWLNVPQETLKQRMAEVPRDKRLFVL
    CNSGARSYEALRQLETAGLCEAVNVQGG
    VAALKKSGLLELDHEEDTTE

    >gi|116751462|ref|YP_848149.1| OsmC family protein [Syntrophobacter fumaroxidans MPOB]
    MHFQKLVFRNADGKNLSARLDLPADEKPLTYAIFAHCFTCTKNFNAVVNVNRALSSRGIAVLRFDFTGLGESEGDFSETN
    FSTNVSDLVAAARFLESHFEAPRLLLGHSLGGAAVLQAAALIPSAMAVATIAAPSDLAHVAELLGGSRAEIKARGEAEVR
    LAGRDFVIRRQFLEDLEEKRMEQTIRDLRKPLLIMHSPLDSIVSVDNAARIFQAAGHPKSFVSLDTADHLLSNRADSLYA
    GSVLAAWASRYLEMPETTAALRDLTDNRVVARTGRTGYRTEILANGHRLIADEPIAVGGADTGPTPYDYLVSALGA
    CTGM
    TLRMYADRKGWPLESITVRLRHRKIHRDDCRDCEDGSRTIDSIEREIEPSGPLDDAQRQKLLEIANKCPVHRTLHSMVEV
    RSHLKEPPPARNGVE

    >gi|116751509|ref|YP_848196.1| thioredoxin domain-containing protein [Syntrophobacter fumaroxidans MPOB]
    MNGRNIIAKCDKCGARNRIPENRMRDRPVCGKCRAPLTTTLIYPEYPLNVNDQSFFNEVVQFPGAAAAFFWAPSCPHCVR
    MLPVIDELAKQYAGKIKFVKLVTEQSPATASRFDVLGVPTLILFKAGRQVNRLFGAIPKEQLEYHLHALL