Synechococcus sp WH8102

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|33864555|ref|NP_896114.1| hypothetical protein SYNW0016 [Synechococcus sp. WH 8102]
    MPLSAVYLSRRSLLLGSIAGVFGSSWWPRPVLAASKAADATWDLTPDQWRERLSSEAYDVLRNEGTERPFTSPLNAEKRS
    GTYHCAGCDLSLFSSEAKFDSGTGWPSFWQPLQGAIATKVDFKLIIPRTEYHCSRCGGHQGHVFNDGPRPTGKRY
    CNNGV
    ALVFRPAG

    >gi|33864635|ref|NP_896194.1| glutathione peroxidase [Synechococcus sp. WH 8102]
    MAISVSNVTVTTPDGSSKSLGDYSGKVLLIVNVASRCGFTKQYAGLQGLNAAYADKGLAVLGFPCNDFGAQEPGSLEEIK
    SFCSTTYGADFELFEKVHAMGSTTEPYSTLNQMDPTGDVAWNFEKFLVGKDGTVIARYKSGVDPEELKAPIEAALAA

    >gi|33864757|ref|NP_896316.1| hypothetical protein SYNW0221 [Synechococcus sp. WH 8102]
    MALTPSTMLELGTPLPAFSLPVVAGGSISSADLHGRPLLLMVICAHCPFVKHVEPEVSRLEQDYGTAVQLLAVSSNSLIT
    HPQDGPKQLADQAKRWGWSFPYLLDEQQSLAKALRAACTPEFYLFDADANGLQTLLYRGQLDGSRPGNDVPLNGVDLRAA
    LDAMLAGQAVNPEQRPSVGCNVKWNPGQEPDWFG

    >gi|33864816|ref|NP_896375.1| thioredoxin-like protein TxlA [Synechococcus sp. WH 8102]
    MTGSSPQPLLGPVQRIVLVVAAIVLAVGLTMMRGGLQSGSPLEQLARRSMTPDVALSNGRPTMIEFYADWCQVCREMAPA
    MLKLEQSMQQQLDVVMVNVDNPRWQDLVDRYDVNGIPQLNLFNAEGDAVGRSIGLRREQELSLLADALIQGSPLPSLQGL
    GRVSERTDVAPQQASLTAGPRSHG

    >gi|33864833|ref|NP_896392.1| putative type 2 NADH dehydrogenase (Ndh, Ndh2B or NdbA) [Synechococcus sp. WH 8102]
    MAGSHFFLELEPPEECLHHAPHVVIVGGGFAGVHACKALANADVRITLIDKRNFNLFQPLLCQVSTGLVSRGDIATPLRE
    LVGKQHNVQVLLGEVTNVYPEGKQIVFNGKAYSYDHLVLATGSGSTFFGHDEWRTFAPPMKILEHAEEIRRRLLMAMEQA
    EQTPDPEARQFLQTVVIVGAGPSGCEMAGAVSELMRWALNNAFKQLDPNKTQIVLVDPGDRVLRAMPEMLSSAALKSLEA
    DGIEFLPKGRVQTMRPGEVIVGTPDGDVRLQAATVIWTAGVRASSLGKKLAEATGCEVDRGGRVIVQHDFSIADHPEIRV
    AGDLSSYSHTSNGKPLPGMAAPAKQAGTFIGKDIAAIVADRPRPTFSYFDFGSMAVLDRASAVADLRGLHFADGIGWILW
    AFVHLVLIPDWENRISLSIKWIFALLTQQRAAILLTGMPSQHMALDAVDAHFPMKAGEGVSIAEPDAAIKADMNYDSHQI
    TGHPQPQELIDTRVDSAADSAAAIR

    >gi|33864874|ref|NP_896433.1| methionine sulfoxide reductase family protein [Synechococcus sp. WH 8102]
    MSERIERSPEEWRQTLSPEQFQVARCGGTERAFTGAYWNKKDSGTYHCICCDAPLFSSQTKFESGTGWPSFWDGVSSEAI
    TTKQDLSHGMVRVEINCARCDAHLGHVFPDGPAPTRQRY
    CVNSASLDFKAS

    >gi|33865096|ref|NP_896655.1| peptide methionine sulfoxide reductase MsrA [Synechococcus sp. WH 8102]
    MRRLLLALLIGMLTLPSAVMADTETAVFAGGCFWCLEHDLEDHPGVLEATSGYSGGHVDNPTYRQVSAETTGHQEVVEVR
    FDPTEITYGTLLRSYWRNVDPLDGGGQFCDRGDSYRPVIFTADAAQAREAEASAQAAARELGQPRSALKVELRDAARFWR
    AEDYHQNYAELNELKYNFYRFSCGRDRRLDAVWGASARSGDAWSDASQSDRNP

    >gi|33865218|ref|NP_896777.1| methyltransferase [Synechococcus sp. WH 8102]
    MAESCCPSPEPLDQSDAVDARYGAAALEREACLCTPVGFDPALLQVIPDAVVERDYGCGDPTRWVRPGDRVLDLGSGSGK
    NAFICSQVVGADGAVLGVDRNPDMLTLSRQAAPVVAEAIGYGNVRFVEGAIEALDEQGDGAEPLVPDASIDVVLSNCVLN
    LVNPSSRQRLLANIRRVLAPGGRVAISDIVCDQPVPMHLQQDPELWSG
    CISGAWQEDDFLKDFRALGLEQVTFADRSEQP
    WRTLEGIEFRAVTLVGQLPGQHSVVGAPCC

    >gi|33865221|ref|NP_896780.1| putative thioredoxin reductase [Synechococcus sp. WH 8102]
    MSVDASGHIENIVILGSGPAGYTAAIYAARANLQPLLITGFQRGGIPGGQLMTTTHVENFPGFPDGILGPDLMDLMKAQA
    VRWGTHLIEADADRIDLSQRPFRIEAEGQTIQAHAVVIATGASANRLGLPSEDRYWSSGISA
    CAICDGATPQFRNEELAV
    VGGGDSACEEAVYLTKYGSHVHLIVRSDQFRASAAMADRVMANPAITVHWNSEIEDVAGGTWMESLTLRDRVTSETRALA
    VRGLFYAIGHTPNTDLLKDQIDLDGKGYLLTASGRPETSVDGVFSAGDVADAEWRQGITAAGSGCKAALAAERWLTHHNL
    ATRVPRASVDPAKAEQPVNVAVTTEESYDPQGLWQKGSFALRKLYHDSDKPLLVVYTSPT
    CGPCHVLKPQLQRVINELDG
    HAQAVVIDIEADQAIAEQAGVSGTPTVQLFHNKEMVKQWRGVKPRSEFKAAIESLAA

    >gi|33865258|ref|NP_896817.1| thioredoxin [Synechococcus sp. WH 8102]
    MSSAAAVTDASFEQDVLQSDVPVLVDFWAPWCGPCRMVAPIVEEIAKEFDGQIKVFKLNTDENPNVASQYGIRSIPTLMV
    FKGGQKVDTVVGAVPKATLSGTISKYL

    >gi|33865299|ref|NP_896858.1| hypothetical protein SYNW0765 [Synechococcus sp. WH 8102]
    MRPLPLKLAPGSDLRNSLEELSQTQGIHGFVLGVVGNLSRAAFQCPGQPEPTVLEGDLEVITLNGTIAPEGVHLHLSLSD
    GACQVWGGHLEPGTLVQKGVDLLVGVLDQPPAPAESNADAPAPRLEIAVLPG
    CPWCGRALRLLRGMALPHTVITVNNDAD
    FEACQTRSGMRTFPQVFIDGTAIGGYDDLTALHAAGELETLR

    >gi|33865396|ref|NP_896955.1| L-asparaginase II [Synechococcus sp. WH 8102]
    MLITRSLPFPPLQRRALTTLQVNLGYRCNQSCSHCHVNAGPTRTEMMSAELVALIPSVLGRRAIRCLDLTGGAPELHPDF
    RSLVRRARDQGVAVIDRCNLTILSEPGHDTLAQFLADHRVGVIASLPCYSAANVDQQRGDGVFERSLEGLRMLNDLGYGS
    GDPERSLDLVFNPHGPSLPPAQGLLEADYKRELGSMGIRFDRLLTLANMPIQRFSRQLELQGRLTAYQRLLEEAHNPANL
    AAVMCRQLLSVDWQGHLYDCDFNQQLALSAQGGVRHLRDLLDDSMVIEGDPIRTAQHCFGCTAGAGSS
    CGGALQG

    >gi|33865440|ref|NP_896999.1| glutaredoxin-like protein [Synechococcus sp. WH 8102]
    MDDSTRSRIEALISSSTIFVFMKGSKLMPQCGFSNNVVQILHSLGVSFETFDVLSDMEIRQGIKDFSSWPTIPQVYVNGE
    FIGGSDILIEMYNAGELKEKLEIALAS

    >gi|33865465|ref|NP_897024.1| glutathione S-transferase domain-containing protein [Synechococcus sp. WH 8102]
    MLPILYSFRRCPYAMRARWALLEAGLLVQWREIELRAKPAAMLEASAKGTVPVLVLADGTVIEESLELMHWALAQADPRD
    CLGAGDLDPWVGENDGVFKHHLDRFKYSDRYPEADRSTHQQEGRAILKGWNDRIRAAGWLAGERMGLADAALWPFVRQWR
    IADPQGFDADPELEPLRGWLNRFLQAPAFERLMQRADPWDPGGQQHLFPADAIAVPTDQPLFHLALASDWHQAQNDGEYS
    VSTRGLMLEQVGFIHCSWREQVDATYDRFYADAGEVLLLEIDPALVSAPLRGDAIPTGELFPHLYGPLPLHAVRDVSHR

    >gi|33865549|ref|NP_897108.1| putative bacterioferritin comigratory protein [Synechococcus sp. WH 8102]
    MAIGVGDSLPSFCLDDQDGVQRTPETARGRWLVLFFYPKDDTPGCTAEACGFRDSSAAFQELGAEVWGISGDDAISHRRF
    ATRHGLNFPLLVDRNNSLRRSLGVPKALGLVPGRVTYVVDGEGVIRHVFSNLLDGPAHVREAERVISSLQG

    >gi|33865555|ref|NP_897114.1| peptide methionine sulfoxide reductase [Synechococcus sp. WH 8102]
    MLPSWLTQRGGESSTEAMHAVLGTPLRAPLMSDQEEALFACGCFWGAEKGFWRLPGVVSTAVGYAGGQRTNPTYQEVCTG
    TTGHTEVVRVVWSTPAVDFSDLLKLFWECHDPTQGNRQGNDTGTQYRSAIYTTTNQQMSLAQASRTSYQDALNQRGYGPI
    TTEILADQAFTFAEPYHQQYLAKPGSRPYCSAMPTQTVLGDFDGNNYRLPSTVWAAYDWSINHCVLRSDNAPIRMA

    >gi|33865747|ref|NP_897306.1| thioredoxin peroxidase [Synechococcus sp. WH 8102]
    MTETGCLRVGQQAPDFTATAVVDQEFKEISLSQYRGKYVVLFFYPLDFTFVCPTEITAFSDRYADFSSKNTEVLGVSVDS
    QFSHLAWIQTPRNQGGLGDINYPLVADLKKEIATAYNVLDDAEGVALRGLFIIDPDGVIMHSTINNLPVGRNVDETLRVL
    QAFQYVQSNPDEVCPANWTPGEKTMKPDPKGSKEYFSAIG

    >gi|33865814|ref|NP_897373.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergens family protein [Synechococcus sp. WH 8102]
    MRRRDLFIKSGLLLTALSITPTKAWSLGGVVLEQGAEVPSFDLPGSSRREPDRDRWSSDDLRGRWLAVYFYPRDFTGGCT
    IEARGFESLHSDFLAAGAEVVGISADSVDDHASFCESEGLSFPLLSDPDGAVSKAYGSWMAPYSLRHTFLIDPSGILRQR
    WVAVRPSGHAQEVLDAITDLQNNTSI

    >gi|33865936|ref|NP_897495.1| hypothetical protein SYNW1402 [Synechococcus sp. WH 8102]
    MLSIASADRWSDPMPTTATTFEEFRQRVDYSLLQALKPDPEATSDGNDHRPRPVFSGHWVPVRPTPIPEPKYVAHSFILF
    AELGISDDLAHNSDFTRLFSGDASVAAEPMHSWGWATGYALSIYGTEYIQQCPFGTGNGYGDGRAMSIVEGVFEGQRWEM
    QLKGGGPTPYCRGADGRAVLRSSVREFLAQEFMHALGVPTSRSLTLYRSEAETVRRPWYSDHSRSFDPDVMVDNQAAIST
    RVAPSFLRVGQIELFARRARDNAHPNAHDELRLIVQHLIDRNYRAEIDATLPFHQQVLELARLFRGRLTALVANWMRVGY
    CQGNFNSDNCAAGGYTLDYGPFGFCELFDPRFQPWTGGGAHFSFFNQPAAAEANYRMFWRSLRTLLEGDDAAQRELDQLN
    EGFAVAMQQQLEAMWASKLALPAYDETLVTELLQLLVAAKADYTKAFRLLSTIPDHVAELHPSFYLPSSEDLDQRWQTWL
    QRWRERITANGDLEETSAAMRRVNPAITWREWLIAPAYQQAEQGDNSLVLELQTLFSSPYSAPSTELAARYDQLRPQQFF
    SAGGIAHYS
    CSS

    >gi|33866067|ref|NP_897626.1| glutathione reductase (NADPH) [Synechococcus sp. WH 8102]
    MAIESTFDLIVLGAGSGGLAAAKRAARHGAKVAIVEGDRVGGTCVIRGCVPKKLLVYGAQARHQLNDAPAYGLTLGSVES
    SVAELFRRVRAEVDRLNHLHLGFLEKAGVARIDGWGRFLSDQCIGIATERGGPIQRELSAAHYLVAVGGRPVRPDIPGIE
    HTWISDDMFNLEQLPKEVVVVGAGFIACEFACILRGLGVEVTQVVRGSGLLRGFDRELADAVLEGLREQGIHVLLERTVS
    AVSGQPGDLTVQMSDGLALPCGGVLMATGRRPWLEGLGLDAAGVAVEQGRINVDADSRTSVAHIYAVGDVTDRVNLTPVA
    IDEGRAFADSTFGTRPRQVNHDLLASAVFSDPELATVGLSEEAAIDRHGVDGVVIHRARFRSMSRALPATGPRCLLKLVV
    ETSTDRVIGCHMVGEHAAEIIQMAAIAVGMGATKADFDRTMALHPSVSEEFVTMG

    >gi|33866068|ref|NP_897627.1| hypothetical protein SYNW1534 [Synechococcus sp. WH 8102]
    MDEAICPRSSMPLTSVPSEALSWSDLEGLTADESDRTQGPTNAQAVLRLFGQEASAVRVTLYRDHHAWCPYCQKVWLWLE
    FKRIPYRIRKVTMRCYGSKEPWFLRRVPSGMLPALDLDGRLITESDEILLQLEATFGPLGQPMTTPDVRSHRQLERLLFR
    AWCLWLCSPGLSPKDDQRAMEQFRRVAGQFEQALRQSPGPFLDPAAPGTADLVFVPYVERMNASLAYYKGYRLRHEHPAI
    DAWFRALEQLATYRGTQSDHHTHAHDLPPQMGGCWSNRSDAARTMADQIDRGDGLADDEACWDADHSINAAAIALGRVLR
    HRERLMERNPLGRSGFDQPLRCALTNLMGQGSPCPDHGSALALRHLRDRISVPRDMPLPAARLLRQALERTAALDGPGQP
    PPLPIRDRFDQDPAPFVSRP

    >gi|33866164|ref|NP_897723.1| dihydrolipoamide dehydrogenase [Synechococcus sp. WH 8102]
    MSDASFDFDVIVIGAGYGGFDAAKHAAEHGLKTAIIESRDMGGTCVNRGCVPSKALLAASGKVRELADDQHLASFGIHAA
    PVRFERQKIADHANQLVQTIRTNLTKTLERAGVTILRGHGRLEGSQRVGLREPSGVDRVLSARDVIVATGSDPFVPPGIE
    TDGRTVFTSDEAINLEWLPRWIAIVGSGYIGLEFADVYTALGCEVTMIEALDRVMPTFDPDIAKIAGRHLIDGRDIDARS
    GVLASKVTPGCPVRIDLADFNSRELVETLEVDAVLVATGRVPSSKGLNLESLNIETNRGFVPIDDSMRVLVNGQPVPHLW
    AVGDVTGKLMLAHTAAAQGTVAVDNILGQNRTIDYRSIPAATFTHPEISSVGLTEAEAKQLAETDGFQLGSVRSYFKANS
    KALAELESDGLMKLLFNKSSGEVLGAHIYGLHAADLIQEVANAVARRQSVRQLSTEVHTHPTLSEVVEVAYKQAASQLTA


    >gi|33866299|ref|NP_897858.1| putative arsenate reductase [Synechococcus sp. WH 8102]
    MLQVYSYSRCSTCRRALSWLKESGLEHTVIDITVDPPSRPTLAKAKEQFGDRRPLFNTSGQSYRALGAAVVKAMTDDEAL
    DALVADGRLIKRPFVVAPDGQVLVGFKEEVWQAQLKG

    >gi|33866410|ref|NP_897969.1| thioredoxin [Synechococcus sp. WH 8102]
    MVADFTDAGFASEVLQAPGTVLVDFWAPWCGPCRLMAPLMDWAADTYGERLTVGKLEVDGNPSTRDAYEVQGIPTLILYR
    DGEVIARHEGAIAKPQLQAFLDANL

    >gi|33866585|ref|NP_898144.1| molybdopterin biosynthesis protein [Synechococcus sp. WH 8102]
    MSIEELSGEERSRYARHLMLPEVGMAGQERLKAASVLCVGAGGLGSPLLLYLAAAGVGRIGIVDGDVVELSNLQRQVIHG
    MDWLGQSKGRSAAHRLQELNPHCQVELHEQMLDRENALELIARYDLVCDGSDNFPTRYLVNDACVLQGKPLIYGSVQRFD
    GQASVFNHTPESPNYRDLLPEPPPVEQVPS
    CAEAGVMGVMPGLIGLIQATEAIKLITGIGRSLDGRLLVVDALTMRFREL
    TLRRDPDRPAIDGLIDYQQFCRPTASPMDSISVIELKSLLDGSADDLVLLDVRNPAEAEVAVIPGAVLIPLATIKSGEAI
    ERIRGLAESGRLYVH
    CKLGGRSAQAVELLAQQGIPATNVDGGIDAWSVQVDQAVPRY

    >gi|33866694|ref|NP_898253.1| putative bacterioferritin comigratory (BCP) protein [Synechococcus sp. WH 8102]
    MALQIGDPAPDFSLPNQDGDLVQLSSLRGQRVVIYFYPKDDTPGCTKEACNFRDRWDRFEQHGIKVLGISKDNATSHTKF
    ISKHELPFTLLTDVEPCEVASSYESYGLKKFMGREYMGMMRHTFVVDADGKLERIYLKVKSATMADTILSDLELA

    >gi|33866746|ref|NP_898305.1| hypothetical protein SYNW2214 [Synechococcus sp. WH 8102]
    MTSTTSPAPAHTAKDGKGILITEPAMQQLAKLCSEQGDQQVLRVGVRSGGCSGMSYTMDFVPASDTLEDDETYDYVAANG
    QGFRVICDPKSLLYIYGMQLDFSTALIGGGFNFTNPNASQTCGCGSSFTV

    >gi|33866769|ref|NP_898328.1| putative P-type ATPase transporter for copper [Synechococcus sp. WH 8102]
    MSPAVQTVVLDVEGMKCGGCVRAVERTLLEQPGVQRADVNLVSRAAWLDLSEADGDVDAVLGALASRGFPARERSLEPSS
    ARLATGASGLTWWQQWRQLMVALTLLLLSVLGHLSEAGHLSLPLIGSLPFHAALATVALLGPGRPILLGGFAAARAAAPS
    MDTLVGLGVGSAYLASLVALIWPQVGWPCFFNEPVMLLGFVLLGRFLEERARFRTGQALHQLAQLQPDTARLVLPDGAIR
    DVRVGALRPGERLQLLAGDRVPVDGVVVEGYSAVDASSLTGEPLPWQAEPGLELSAGSLNLDAPLVLEVTRVGAETALAR
    IIRLVEQAQARRAPIQGLADRVAGRFCYGVIALALATFLFWWLFGASQWPQVMQASAPGMPQGHLMTSGHAMHHGGLGSG
    ATSPVGLALQLSIAVLVVACPCALGLATPTVITVATGLAAQRGWLFRGGDVIETAAGLDHVVFDKTGTLTLGRPLVTSVW
    AKDAALLLQLAASLEQSSRHPLAHALLQEAQRRDLTLLEPVQVTTVSGQGLVGEVEGWPQPIRVGRPDWLGSFGVALSDE
    ARTWLAQADGSVVAVAHGSALLGLVQIEDQLRADVVPALERLRQQGLALAIFSGDREPAVRALGQQLGFEAADLGWQMLP
    EQKLQRLEELRQRGRVAMVGDGINDAPALAAADLGIAIGTGTQIAQDTAGMVLMGDRLDNLPEALTLARRTLAKVRQNLF
    WAFGYNLIALPLAAGALLPSQGVLLSPPLAALLMAISSITVVLNALLLRVA

    >gi|33866840|ref|NP_898399.1| glutaredoxin [Synechococcus sp. WH 8102]
    MAKVEIYTWRTCPFCVRAKGLLDRKGVSYTEHAVDGDEPGRDAMAARGDGRRSVPQIFIDDRHIGGCDDLHALERSGELD
    PLLNA

    >gi|33866808|ref|NP_898367.1| hypothetical protein SYNW2278 [Synechococcus sp. WH 8102]
    MEALTPRPIQARDLQSWLQDDRPDPLLVDVREDAELDLARFPADVLHWPLSRSDAWLESVPQQMADGRPVVVICHAGVRS
    LHLGLWLLQQMPELEVWNLEGGIDAWSVHVDSSVPRY

    >gi|33866725|ref|NP_898284.1| hypothetical protein SYNW2193 [Synechococcus sp. WH 8102]
    MGTTRLVSRRRQDAGAKWARIAMAVLATVGVIDTGSITLKRWGLLGNLSCPMGADGCDKVLNSPWGTVADGIPLSFVGLL
    AYIAVLVMALLPLLPGLAENKSDLSRRTWWGMFSVSLGMVVFSGVLLGLMVFKIQAFCFFCVLSAVLSLSLFLLSVIGGG
    WDDPGQLIFRGILLALAVLLGGLIWASVVDPDRPEATATGPGVAPVVTTASSTATLALADHLTASGAVMYSAYW
    CPHCHE
    QKELFGKKATEQLKVVECAPDGRNNQADLCRSKGLEGFPSWEINGELDSGVKPLEVLADLSGYQGDREF