Synechococcus elongatus PCC 7942 uid58045

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|81230373|ref|YP_398709.1| hypothetical protein Synpcc7942_B2654 [Synechococcus elongatus PCC 7942]
    MADHTEEFLQLAAEAKTRIQQVSPEAALQLTQEGAVLLDVRESEEFAQGHLEGATNLSRGALAEQIEGTVPDKSTPIVCY
    CAGGNRGALAADTLQNLGYTNVVSIEGGLKAFPLDH

    >gi|81298960|ref|YP_399168.1| methylated-DNA--protein-cysteine methyltransferase [Synechococcus elongatus PCC 7942]
    MESTGLRIHWQPPSESAQSEQLIYGIHRTLFGDCLIAKTAIGICQLELFDRLSPTEARQYVQATWPKADIEDQPTATIAI
    AQQLFCHAAKDPDPLCLHVRSTVFQQQVWQSLLQIPRGATTTYQALAVAIGRPKAARAVGNAVGKNPIAYLIP
    CHRVVRQ
    SGELGGYRWGRDRKQQLLAWEAECF

    >gi|81298969|ref|YP_399177.1| hypothetical protein Synpcc7942_0158 [Synechococcus elongatus PCC 7942]
    MLNLDTDSIQLTQDDYARYSRHLILPEVGLEGQKRLKAAKVLCIGTGGLGSPLLLYLAAAGIGRIGIVDFDIVDHSNLQR
    QVIHGTSWVGKPKIESAKNRIHEINPYCQVDLYETALSSENALSILEPYDVIVDGTDNFPTRYLVNDACVLLGKPNVYGS
    IFRFEGQATVFNYEDGPNYRDLYPEPPPPGMVPS
    CAEGGVLGILPGIIGVIQATETVKIILGQGQTLSGRLLLYNALDMK
    FRELKLRPNPERPVIDRLIDYQEFCGIPQAQAAEAAATDSIPEISVTELKAILDRQDPEVLLIDVRNPHEAEIATIPGAI
    LVPLPDIEAGAGVETVRELLNGKRELIVH
    CKMGGRSAKALGILKEAGITGTNVAGGINAWSQDVDPSVPQY

    >gi|81299163|ref|YP_399371.1| methionine sulfoxide reductase B [Synechococcus elongatus PCC 7942]
    MAIVKHQSRFLCKIATIESDRSCLIAAMTAAAPTLSRRRLLLGLVSAGAGAGGFLFWRQSRSPLSSTDAVYPMQLSEAEW
    QQRLSPEAYAVLREAATERPFTSDLLAEKRVGQYCCAGCEQPLFESAAKYESGTGWPSFREAIAGSLGFQTDYKLVVPRT
    EYHCSRCGGHQGHVFNDGPAPTGKRF
    CNNGVAIAFVPAADQG

    >gi|81299426|ref|YP_399634.1| rhodanese-like protein [Synechococcus elongatus PCC 7942]
    MADFTEIDPQTFAERQAAQPAPDWQLIDVREPAEVELASLPGFRVYSLSRSAEWVDRIGQELDRSKETIVLCHHGMRSAQ
    MCQWLLTQGFEHVVNLRGGIDAYSRLVDAQVPLY

    >gi|81299434|ref|YP_399642.1| thioredoxin reductase [Synechococcus elongatus PCC 7942]
    MTGVENVVIIGSGPAGLTAAIYAARANLKPLMFEGYQLGGLPGGQLMTTTEVENFPGFPEGITGPELMERMRAQAVRWGA
    ELYTEDVISADLSQRPFRIRSQEREVLAHSVIIATGATARRLSLPGEDRLWNNGISA
    CAICDGAAPIFRDGELVVIGGGD
    TAAEEAVYLTKYAKHVHLLVRSDRMRASKAMQDRVLAHPNVTVHWHTEAIEAVGNTLLEAVRVRNNQTGEEKAIAAQGLF
    YAIGHTPNTKLFEGQIELDGTGYIRTKPDSVETSLEGVFAAGDVQDHEYRQAITAAGTGCAAALLAERYLSAHNLLQEYK
    QEAAAAEPETKAAATPAASQPEASEFDPTSVYHEGSYALRKLYHESDRLLAVLYTAPT
    CGPCRTLKPILRKVAEEFSDRL
    HYVLIDIDADPEIAQSAGVVGTPTLQLFKDKAKVDEIRGVKMKSDYRARFEQHLQPVSR

    >gi|81299453|ref|YP_399661.1| bacterioferritin comigratory protein [Synechococcus elongatus PCC 7942]
    MPVSRRQLLLSSLLALPALVLAPRSAQALGGPQPPVDEPAPDFSLPTDDGRERLSLADFRGQWLVLYFYPKDGTPGCTLE
    AQRFQQDLAAYAERNAQIVGVSADDLSSHSRFRENEGLSYPLLADVKGEVSKRYGSWLAPFSLRHTYIIDPEGVLRANFT
    AVRPVIHSKEVLAKLDELQAG

    >gi|81299582|ref|YP_399790.1| hypothetical protein Synpcc7942_0771 [Synechococcus elongatus PCC 7942]
    MSSFALSWSELATLTDFNPDRVNGPTNAQSTLRLFGQPESAVRVTLYRDHHAWCPYCQKVWLWLEEKQIPYRIAKVTMFC
    YGEKETWYKRKVPSGMLPALELDGRIITESDDILLALESTFGPLMHSLLDRTVLPLRRLERELFRAWCGWLCYPSRSPQQ
    DQQGRTAFQAVVDRVEAALASTPGPYFLECFGVTDVIFTPYVERMNASLFYYKGYSLREINPRLSDWFEAMESRETYRGT
    QSDFHTHAHDLPPQMGGCYANTDPQTAVCQARVDQGPWFGLPDVTYPEPPTARQEALQRVLRHKDTLIRLNPLEAEVFDP
    ALRAALTTLITGQVCPPPAGSDRGLRYLRDRISVPRDMSIYAAKHLREALEATAQLAGDRQGPAISMRDRRDQDPARFAS
    ATAC

    >gi|81299652|ref|YP_399860.1| glutathione reductase [Synechococcus elongatus PCC 7942]
    MSFDYDLLVIGAGSGGLAASKRAASYGAKVAIAETDLVGGTCVIRGCVPKKLMVYASSFASQYHYAEAYGWSAVQPQFSW
    PKLIAAIDAEVNRLSRLHISLLEKAGVDLILGHAQFVDEHRLQVGDRQVTAAKILIAAGGRPIKLPIPGGELAITSREMF
    HLPEQPQRFAVIGGGYIGCEFAGILRSLGSEVTQIIRRDRILQGFDQELREAVQTGMSQHGVQFRTGVTVERIDQTETGL
    QLSYSDGSQQIVDQVLMATGREPWLEGLNLDAAGVAIEGRRIAVDAWSRTNQPHIFAVGDCTDRVNLTPVAIAEGRAFAD
    TEFGQKPRQISYENIASAVFSQPEACSVGLSEEAAKAEYGEERIRVYRSRFRPMFYTLPQAEERVLMKLVVETESDRVLG
    AHMVGKDAAEIIQSVAIAVTMGATKADFDATMALHPTSAEEFVTMP

    >gi|81299718|ref|YP_399926.1| HesB/YadR/YfhF [Synechococcus elongatus PCC 7942]
    MTQTTAAPQKGILISETALAQLQAMQAQQGTDLLLRVGVRQGGCSGMSYTMDFITPEGIHEKDEVYDYDGFRVVCDPKSL
    LYIYGMTLDYSTALIGGGFKFTNPNAAQTCGCGSSFSA

    >gi|81299745|ref|YP_399953.1| rhodanese-like protein [Synechococcus elongatus PCC 7942]
    MTSFSTPTNRQNTPLLSPNQLQFLIDRQEVLLLDVREVAEYQADHIAGSHLYPLSQITQLPLPASDRPIVLTCQSGMRSQ
    KAATQLQQRGLTITELQGGLNAWKQQGLPTIGQTANAPISLMRQVQLVAGSLVLISIILSLTLAPTWLGLSAFVGAGLVF
    AGLSGTCLLANVLAAMPWNRG

    >gi|81299927|ref|YP_400135.1| mercuric reductase [Synechococcus elongatus PCC 7942]
    MSSQSFIAFVSPADSHNQLLIDRVHPQDWINPEPADCYDLVVIGAGTTGLVVAAGATGLGLGLKVALIEKQLMGGDCLNF
    GCVPSKALIRSSRVIGELQRANTLGIQVAPEAIAVDFAAVMERLRKVRAGMSVHDSAQRFQALGVDVFLGQACFCDRNTI
    QVGEATLKFRKAVIATGARATYPNIEGLEASGFLTNETVFSLSN
    CPRRLAVIGGGPIGCELAQAFQRLGSQVTLFQRRSQ
    LLPKEDFEAAEVIQNQLRADGVQVCLSAEITRIERTASGKLITFRQEGRESVLEVDEILVGTGRSPNVQDLNLEAVGVDY
    DSVHGVKVNDYLQTTNPKIYAAGDVCSPWKFTHAADAAARIVIKNALFSPFGLGKSKVSDLIIPRVTFTDPEVAHVGLSE
    TAARHQGIAIATITIPLDQVDRTVLDGETAGFIRIHHQPNSDKILGATIVAPHAGEMISEVTTAIANQLGMSALSSVIHP
    YPTQAEGIKKAADNYRRTLLTPMTKQLLKLLMIFSK

    >gi|81299954|ref|YP_400162.1| glutaredoxin-like protein [Synechococcus elongatus PCC 7942]
    MMTPELQERLTSIINGDKIVVFMKGNKLMPQCGFSNNVVQILNILGVPFTTVDVLADYDIRQGIKEFSNWPTIPQVYVNG
    EFIGGSDILIELYQNGELQQMLEVALAS

    >gi|81300007|ref|YP_400215.1| dihydrolipoamide dehydrogenase [Synechococcus elongatus PCC 7942]
    MSSEFDYDVIVIGAGYGGFDAAKHACEKGLKTAIVEARDLGGTCVNRGCVPSKALLAASGRVREITDTDHLQNFGIQVQG
    VSFDRQAIADHAANLVDTVRTNLGNTLKRLGAEILMGRGRLAGSQRVTVTAADGTEKTYSARDVILATGSDPFVPPGIEI
    DGKTVFTSDDALKLETLPQWIAIIGSGYIGLEFSDVYTALGCEVTMIEALDRLLPTFDPDVAKVAQRSLLDGRDIETRTG
    VLARKITPGSPVVIELADFETKELVEVLEVDACLVATGRIPSTKNLGLETVAVEVDRRGFIPVDDGMRVLRDSKPVPHLF
    AVGDATGKLMLAHAAAAQGVVAIENITGHPRSVDYRSIPAATFTHPEISSVGLSEADAKALGGQEGFEVGSVRSYFKANS
    KALAEADADGFAKVLFRKDTGEVLGAHIFGLHAADLIQEVANAIARRQSVKELAFEVHTHPTLSEVIESAYKQAATAIA

    >gi|81300023|ref|YP_400231.1| glutathione peroxidase [Synechococcus elongatus PCC 7942]
    MKIRNVSMAPQVTDIAVTTIDGAAKSLSDYAGQVLLIVNVASYCGYTSQYSGLEALYRQYRDRGLQVLAFPCNDFGAQEP
    GSNEEIKTFCSTRFDVSFELFDKVHAKGADQHPLYAALTQTDPAGDVAWNFEKFLVGKDGTVLARFKSGVAPNDASLIQA
    IEAALAA

    >gi|81300379|ref|YP_400587.1| heavy metal translocating P-type ATPase [Synechococcus elongatus PCC 7942]
    MVNQQTLTLRGMGCAACAGRIEALIQALPGVQECSVNFGAEQAQVCYDPALTQVAAIQAAIEAAGYHAFPLQDPWDNEVE
    AQERHRRARSQRQLAQRVWVSGLIASLLVIGSLPMMLGISIPGIPMWLHHPGLQLGLTLPVLWAGRSFFINAWKAFRQNT
    ATMDTLVAVGTGAAFLYSLAVTLFPQWLTRQGLPPDVYYEAIAVIIALLLLGRSLEERAKGQTSAAIRQLIGLQAKTARV
    LRQGQELTLPITEVQVEDWVRVRPGEKVPVDGEVIDGRSTVDESMVTGESLPVQKQVGDEVIGATLNKTGSLTIRATRVG
    RETFLAQIVQLVQQAQASKAPIQRLADQVTGWFVPAVIAIAILTFVLWFNWIGNVTLALITAVGVLIIACPCALGLATPT
    SIMVGTGKGAEYGILIKSAESLELAQTIQTVILDKTGTLTQGQPSVTDFLAIGDRDQQQTLLGWAASLENYSEHPLAEAI
    VRYGEAQGITLSTVTDFEAIPGSGVQGQVEGIWLQIGTQRWLGELGIETSALQNQWEDWEAAGKTVVGVAADGHLQAILS
    IADQLKPSSVAVVRSLQRLGLQVVMLTGDNRRTADAIAQAVGITQVLAEVRPDQKAAQVAQLQSRGQVVAMVGDGINDAP
    ALAQADVGIAIGTGTDVAIAASDITLISGDLQGIVTAIQLSRATMTNIRQNLFFAFIYNVAGIPIAAGILYPLLGWLLSP
    MLAGAAMAFSSVSVVTNALRLRQFQPR

    >gi|81300498|ref|YP_400706.1| rhodanese-like protein [Synechococcus elongatus PCC 7942]
    MSVRSLRWPRQKAFLAVISLVVAVLLAVPGWLTPATAASQATVQFVAPTWAAERLNNKQLKILDVRTNPLAYIEGHLPGA
    VNIADAAYRGPNGFLPVQIWDPEKLASLFGRAGVSNNDTVLVYSDGNDVLGATLVAYLLERSGVQNIAVLDGGYKGYKDA
    GLPVTKEYPRYQAARFAPKDNRAFRVDIKQVEQLTGKSTFVDPRPPALFSGEQQVFIRNGHIPGARNIPWPTFTEANNAN
    ESLKNPHKLKPLSELKAILEAKGVTPDKDVIVT
    CSTGREASLQYLVLKHLLKYPKVRIYEGSWTEYSASNLPVETGPDRV


    >gi|81300500|ref|YP_400708.1| hypothetical protein Synpcc7942_1691 [Synechococcus elongatus PCC 7942]
    MASSDVPSFAPDQALPQWRLFWGSSAAVIAIAIAASLHGGRQTMLLLLGAAIGAVLYHGRFGFSSGFRKLLQRQDGNPAL
    AQLWLLALTSIAFAGVFSLAELRGWELRPAIAPVGWASLGGAFLFGIGMQLSRACGCGTLAAVGGGSYNLLITLIAFGIG
    AFGATLTRPLWSQLPAWEPWSFASQLGWGSALLLQLWLLLILAVALWRWAPLPMVKSRRLWLAATAIALLYTGTLVVDGQ
    PWRVTWGLALTTAQVAQNLGWDPQSSVFWGRQLGRLSSSLLADPSVITDLGLILGALTAAAYEGRWRWQGSLQPHAVGLS
    IAGGLSMGFGAFLAAG
    CNISAYLAGIASTSLHGWVWLVAALLGSWVGIHLRSRWQPSSPPASTNLS

    >gi|81300539|ref|YP_400747.1| hypothetical protein Synpcc7942_1730 [Synechococcus elongatus PCC 7942]
    MMAKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVMFICQHCPFVKHVEEELAAIGRDYLDLGIVAISPNSL
    ETHPQDGPEQLKAQAERLGFTFPYCLDETQAIAKAYTAACTPDFFLFDRDRRLVYRGQLDDSRPSSDRPVTGADLRAAIT
    AVLTGDAPSADQKPSIGCNIKWHPGQEPDYYGAQLV

    >gi|81300602|ref|YP_400810.1| thioredoxin [Synechococcus elongatus PCC 7942]
    MSAATELNDQQFESAVLKAPGLVLVDFWAPWCGPCRLIAPLMDWAAQTYADQLTVYKLEVDPNPETVARYQVQGIPTLLL
    FQNGELVERVEGAIGRDRIQTLINAHL

    >gi|81300615|ref|YP_400823.1| bacterioferritin comigratory protein [Synechococcus elongatus PCC 7942]
    MPLQVGDRAPDFTLPDQQGNPVSLTDLRGQRVVIYFYPKDDTPGCTKEACGFRDDFSLFEQAGIVVLGVSKDPASKHQKF
    IAKYELPFTLLTDADAAVASAYDSYGLKKFMGREYMGMMRHTYVIDVEGKIEQIYTKVKPETHARQILTDLGVAVAE

    >gi|81300639|ref|YP_400847.1| thioredoxin [Synechococcus elongatus PCC 7942]
    MSVAAAVTDATFKQEVLESSIPVLVDFWAPWCGPCRMVAPVVDEIAQQYSDQVKVVKVNTDENPSVASQYGIRSIPTLMI
    FKDGQRVDTVVGAVPKTTLANTLDKHL

    >gi|81300701|ref|YP_400909.1| rhodanese-like protein [Synechococcus elongatus PCC 7942]
    MSLVLINFYRFVALGDCDRWRQWLQDLCTALGLRGTILLAPEGINAGLAGNTEAIAQFLSELQQHPPFANLSFKSATVTD
    WPFARLKVKVKPEIVSLGCPELNPAERTGTLVAPQDWNQLLQDPEVVLIDVRNRFEIALGSFPRAIDPQTDRFRDFPRFV
    QEQLLPQPPAKVAMF
    CTGGIRCEKASAYLLEQGIETVYQLEGGILNYLEAIAPEENHWQGDCFVFDERIAVDRQLQTPQH
    QLCPACGQPVVATTCSHCQDSVQASSSPK

    >gi|81300746|ref|YP_400954.1| peptide methionine sulfoxide reductase [Synechococcus elongatus PCC 7942]
    MFGLFGKKTGLPTPEEALPGRAQAMLVPAKHFVLGTPLDGPFPVGIQLALFGNGCFWGTEKQFWQLPGVYSTAVGYAGGL
    TPNPNYREVCSGMTGHNEVVRVAYDPDRISYADLLKAFWESHDPTQGMGQGPDRGTQYRSGIYCYTPEQKQIALASQAAY
    QAVLKAKGYGAITTEIIDAPTFYFAEEYHQQYLDKPGSRPYCGAQPTGADLPHPNQWNLPTELQSHLTAHPEVWSKNFAE
    CPVVPH

    >gi|81300751|ref|YP_400959.1| bacterioferritin comigratory protein-like [Synechococcus elongatus PCC 7942]
    MAIAVGDVAPDFSLPAQDGTTVSLSDFRGQKPVVLYFYPKDDTPGCTIEACSFRDSYTAFQEVGAVVLGVSSDSIDSHQR
    FAQKYNLPFQLLSDAGDRLRQTYGVPKTLFVIPGRVTYVIDKEGKVRHIFDSLLNAQAHIQESLNILRSL

    >gi|81300787|ref|YP_400995.1| thioredoxin [Synechococcus elongatus PCC 7942]
    MLPVVTAQTFSAEVLQAKDPVLVYFWAAWCGPCRLLTPCLEQWHQTASQNLRVVSINADENFTLANRYRLATLPTLIWFA
    DGRIRDRLEGISDREALQTFLKRYQPVANAV

    >gi|81300898|ref|YP_401106.1| thioredoxin domain-containing protein [Synechococcus elongatus PCC 7942]
    MVRKRPTPWLHRWSRPIILFLATIGLLDTGYITLEKFGIIQQTVCPLFGGGCSQVLNSPYAVFFGLPLSLFGAIAYFSAG
    ALAAIPLFVKAEQAKSLRLQLEKTTWLLLFLLSTAMVVFSAYLIYLMAYEIKAFCFFCVGSAILSLGIFLVSLFGHDWED
    LGQVLFGGFITAIAVLVTLLGIYAGGSENPALADQGQTGPPIVNVSKPAAVSLAEYLTKTGAKMYSAYW
    CPHCHDQKELF
    GQQAVQKLDVVECDPQGRNARPQLCQQAGIQGFPTWEINGKQYSGTRPLQELAKLSGYTGPQNF

    >gi|81300937|ref|YP_401145.1| thioredoxin [Synechococcus elongatus PCC 7942]
    MTADNSVPSRLRNILVIAAALVLTILVVLGSRQPSAAASLASLAEQATPYEVAIANDRPMLLEFYADWCTSCQAMAGRIA
    ALKQDYSDRLDFVMLNIDNDKWLPEVLDYNVDGIPQFVYLNGQGQPQGISIGELPRSVLAANLDALVEAQPLPYTNARGN
    LSEFSADLQPSRSSQTDPRSHSGQVQDGVLD

    >gi|81300989|ref|YP_401197.1| bacterioferritin comigratory protein [Synechococcus elongatus PCC 7942]
    MALTVGTAAPDFTALDDAGQSIQLSQFRGKTIVLYFYPKDDTPGCTKEACSFRDSYSAYQGKDIIVLGVSTDDSSSHEQF
    KTKFSLPFPLVADPDRSITQAYDVDGGGYAKRVTYVIDGEGQIIRVYDSVKTDTHAGDILADLGL

    >gi|81300999|ref|YP_401207.1| methionine sulfoxide reductase B [Synechococcus elongatus PCC 7942]
    MTEKIRKSEEEWRAQLTPEQFQVTRKHGTERAFTGAYWDTKDPGLYRCICCDAPLFRSDTKFDSGTGWPSFWAPVDESAI
    TYKKDFSFLMMRTEILCARCDAHLGHVFPDGPKPTGQRY
    CLNSASLKLDTETPASPSSEA

    >gi|81301118|ref|YP_401326.1| thioredoxin peroxidase [Synechococcus elongatus PCC 7942]
    MTEGALRVGQLAPDFEATAVVDQEFQTIKLSNYRGKYVVLFFYPLDFTFVCPTEITAFSDRYADFSALNTEILGVSVDSQ
    FSHLAWIQTSRKEGGLGDLAYPLVADLKKEISTAYNVLDPAEGIALRGLFIIDKEGVIQHATINNLAFGRSVDETLRVLQ
    AIQYVQSHPDEVCPANWQPGAATMNPDPVKSKEFFAAV

    >gi|81301126|ref|YP_401334.1| heavy metal translocating P-type ATPase [Synechococcus elongatus PCC 7942]
    MPAAIVHSADPSSTSILVEVEGMKCAGCVAAVERRLQQTAGVEAVSVNLITRLAKVDYDAALIEDPTVLTTEITGLGFRA
    QLRQDDNPLTLPIAEIPPLQQQRLQLAIAAFLLIVSSWGHLGHWLDHPLPGTDQLWFHALLATWALLGPGRSILQAGWQG
    LRCGAPNMNSLVLLGTGSAYLASLVALLWPQLGWVCFFDEPVMLLGFILLGRTLEEQARFRSQAALQNLLALQPETTQLL
    TAPSSIAPQDLLEAPAQIWPVAQLRAGDYVQVLPGDRIPVDGCIVAGQSTLDTAMLTGEPLPQPCQVGDRVCAGTLNLSH
    RLVIRAEQTGSQTRLAAIVRCVAEAQQRKAPVQRFADAIAGRFVYGVCAIAALTFGFWATLGSRWWPQVLQQPLPGLLIH
    APHHGMEMAHPHSHSPLLLALTLAISVLVVACPCALGLATPTAILVATGLAAEQGILVRGGDVLEQLARIKHFVFDKTGT
    LTQGQFELIEIQPLADVDPDRLLQWAAALEADSRHPLATALQTAAQAANLAPIAASDRQQVPGLGVSGTCDGRSLRLGNP
    TWVQVATAKLPTGSAAATSIWLADDQQLLACFWLQDQPRPEAAEVVQALRSRGATVQILSGDRQTTAVALAQQLGLESET
    VVAEVLPEDKAAAIAALQSQGDAVAMIGDGINDAPALATAAVGISLAAGSDIAQDSAGLLLSRDRLDSVLVAWNLSQMGL
    RTIRQNLTWALGYNVVMLPLAAGAFLPAYGLALTPAIAGACMAVSSLAVVSNSLLLRYWFRRSLNHSVSV

    >gi|81301132|ref|YP_401340.1| glutaredoxin GrxC [Synechococcus elongatus PCC 7942]
    MANVEIYTWSACPFCVRAKALLTRKGVAFQEYVIDGDEAARAVMAQRANGRRSVPQIFIDDQHIGGCDDLHALDRQGGLD
    PLLGLSA

    >gi|81301236|ref|YP_401444.1| 3-mercaptopyruvate sulfurtransferase [Synechococcus elongatus PCC 7942]
    MSSPLVSAEWLQAHLHDNDLCLVDCRFNLMQPQQGRDQYQQGHLPGAVYLDLEQDLSAPKGDRGGRHPLPDIEALAARLG
    AIGISSDPATLVVAYDASFSAFASRLWWLLRYLGHERVAVLDGGLAAWQAIGGELVTDIPAIAPAKFQPHPQTGWVVDAV
    GLKVAQARGQVLIDSREADRYRGDREPIDPVAGHIPGAQLAVWKEALDEKGYWRLPSEQQQRWQHLSTAVQPIIY
    CGSGV
    TACVNLLSWELAGRSPAQLYAGSWSDWCSDPENAIATGEE

    >gi|81301245|ref|YP_401453.1| peptide methionine sulfoxide reductase [Synechococcus elongatus PCC 7942]
    MKRLLVLGLLIASFWFPNTAAWAATAEAIFAGGCFWCVEADFDKVTGVTETISGYSGGTVKKPTYKQVSAGKTGHYESVK
    IIYDPDQVSYDQLVSYFLQHIDPLDGGGQFCDRGDQYRSAIFVTPEQQPIAEAAIAAAAQELGQPIQTKIQPAKEFWEAE
    NYHQNYYQKQALLYKYYRARCGRDAQIAKVWGEYEQQS

    >gi|81301258|ref|YP_401466.1| 1-Cys peroxiredoxin [Synechococcus elongatus PCC 7942]
    MSLRLGDTVPNFTQQSSEGEINFYDWAGDSWVILFSHPADYTPVCTTELGTVAKLKEEFAKRNVKPIALSVDDVESHKGW
    IGDINETQGTQVNYPILADPDRKVSDLYDMIHPNANNTLTVRSVFIIDPNKKLRLTLTYPASAGRNFDELLRVIDSLQLT
    DNYSVATPANWNDGDDVVVVPSIPTEQAREQFPKGVTEVKPYLRLTPQPNR

    >gi|81299608|ref|YP_399816.1| hypothetical protein Synpcc7942_0797 [Synechococcus elongatus PCC 7942]
    MSAIAMAPFPITCRYCQFYSADRRWAGECQLLHVTVGSDWPACRSSSQLFSEPAAALVHKSPSVLPLTEAEWGLEAMSVP
    LQVGVA