Synechococcus elongatus PCC 6301 uid58235

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|56750036|ref|YP_170737.1| copper transporting CPx-type ATPase PacS [Synechococcus elongatus PCC 6301]
    MVNQQTLTLRGMGCAACAGRIEALIQALPGVQECSVNFGAEQAQVCYDPALTQVAAIQAAIEAAGYHAFPLQDPWDNEVE
    AQERHRRARSQRQLAQRVWVSGLIASLLVIGSLPMMLGISIPGIPMWLHHPGLQLGLTLPVLWAGRSFFINAWKAFRQNT
    ATMDTLVAVGTGAAFLYSLAVTLFPQWLTRQGLPPDVYYEAIAVIIALLLLGRSLEERAKGQTSAAIRQLIGLQAKTARV
    LRQGQELTLPITEVQVEDWVRVRPGEKVPVDGEVIDGRSTVDESMVTGESLPVQKQVGDEVIGATLNKTGSLTIRATRVG
    RETFLAQIVQLVQQAQASKAPIQRLADQVTGWFVPAVIAIAILTFVLWFNWIGNVTLALITAVGVLIIACPCALGLATPT
    SIMVGTGKGAEYGILIKSAESLELAQTIQTVILDKTGTLTQGQPSVTDFLAIGDRDQQQTLLGWAASLENYSEHPLAEAI
    VRYGEAQGITLSTVTDFEAIPGSGVQGQVEGIWLQIGTQRWLGELGIETSALQNQWEDWEAAGKTVVGVAADGHLQAILS
    IADQLKPSSVAVVRSLQRLGLQVVMLTGDNRRTADAIAQAVGITQVLAEVRPDQKAAQVAQLQSRGQVVAMVGDGINDAP
    ALAQADVGIAIGTGTDVAIAANDITLISGDLQGIVTAIQLSRATMTNIRQNLFFAFIYNVAGIPIAAGILYPLLGWLLSP
    MLAGAAMAFSSVSVVTNALRLRQFQPR

    >gi|56750345|ref|YP_171046.1| glutathione peroxidase [Synechococcus elongatus PCC 6301]
    MKIRNVSMAPQVTDIAVTTIDGAAKSLSDYAGQVLLIVNVASYCGYTSQYSGLEALYRQYRDRGLQVLAFPCNDFGAQEP
    GSNEEIKTFCSTRFDVSFELFDKVHAKGADQHPLYAALTQTDPAGDVAWNFEKFLVGKDGTVLARFKSGVAPNDASLIQA
    IEAALAA

    >gi|56750361|ref|YP_171062.1| dihydrolipoamide dehydrogenase [Synechococcus elongatus PCC 6301]
    MSSEFDYDVIVIGAGYGGFDAAKHACEKGLKTAIVEARDLGGTCVNRGCVPSKALLAASGRVREITDTDHLQNFGIQVQG
    VSFDRQAIADHAANLVDTVRTNLGNTLERLGAEILMGRGRLAGSQRVTVTAADGTEKTYSARDVILATGSDPFVPPGIEI
    DGKTVFTSDDALKLETLPQWIAIIGSGYIGLEFSDVYTALGCEVTMIEALDRLLPTFDPDVAKVAQRSLLDGRDIETRTG
    VLARKITPGSPVVIELADFETKELVEVLEVDACLVATGRIPSTKNLGLETVAVEVDRRGFIPVDDGMRVLRDSKPVPHLF
    AVGDATGKLMLAHAAAAQGVVAIENITGHPRSVDYRSIPAATFTHPEISSVGLSEADAKALGGQEGFEVGSVRSYFKANS
    KALAEADADGFAKVLFRKDTGEVLGAHIFGLHAADLIQEVANAIARRQSVKELAFEVHTHPTLSEVIESAYKQAATAIA

    >gi|56750414|ref|YP_171115.1| promoter active fragment E3 [Synechococcus elongatus PCC 6301]
    MMTPELQERLTSIINGDKIVVFMKGNKLMPQCGFSNNVVQILNILGVPFTTVDVLADYDIRQGIKEFSNWPTIPQVYVNG
    EFIGGSDILIELYQNGELQQMLEVALAS

    >gi|56750440|ref|YP_171141.1| mercuric reductase [Synechococcus elongatus PCC 6301]
    MSPADSHNQLLIDRVHPQDWINPEPADCYDLVVIGAGTTGLVVAAGATGLGLGLKVALIEKQLMGGDCLNFGCVPSKALI
    RSSRVIGELQRANTLGIQVAPEAIAVDFAAVMERLRKVRAGMSVHDSAQRFQALGVDVFLGQACFCDRNTIQVGEATLKF
    RKAVIATGARATYPNIEGLEASGFLTNETVFSLSN
    CPRRLAVIGGGPIGCELAQAFQRLGSQVTLFQRRSQLLPKEDFEA
    AEVIQNQLRADGVQVCLSAEITRIERTASGKLITFRQEGRESVLEVDEILVGTGRSPNVQDLNLEAVGVDYDSVHGVKVN
    DYLQTTNPKIYAAGDVCSPWKFTHAADAAARIVIKNALFSPFGLGKSKVSDLIIPRVTFTDPEVAHVGLSETAARHQGIA
    IATITIPLDQVDRTVLDGETAGFIRIHHQPNSDKILGATIVAPHAGEMISEVTTAIANQLGMSALSSVIHPYPTQAEGIK
    KAADNYRRTLLTPMTKQLLKLLMIFSK

    >gi|56750615|ref|YP_171316.1| hypothetical protein syc0606_d [Synechococcus elongatus PCC 6301]
    MTSFSTPTNRQNTPLLSPNQLQFLIDRQEVLLLDVREVAEYQADHIAGSHLYPLSQITQLPLPASDRPIVLTCQSGMRSQ
    KAATQLQQRGLTITELQGGLNAWKQRGLPTIGQTANAPISLMRQVQLVAGSLVLISIILSLTLAHTWLGLSAFVGAGLVF
    AGLSGTCLLPNVLAAMPWNRG

    >gi|56750642|ref|YP_171343.1| hypothetical protein syc0633_c [Synechococcus elongatus PCC 6301]
    MTQTTAAPQKGILISETALAQLQAMQAQQGTDLLLRVGVRQGGCSGMSYTMDFITPEGIHEKDEVYDYDGFRVVCDPKSL
    LYIYGMTLDYSTALIGGGFKFTNPNAAQTCGCGSSFSA

    >gi|56750707|ref|YP_171408.1| glutathione reductase [Synechococcus elongatus PCC 6301]
    MSFDYDLLVIGAGSGGLAASKRAASYGAKVAIAETDLVGGTCVIRGCVPKKLMVYASSFASQYHYAEAYGWSAIQPQFSW
    PKLIAAIDAEVNRLSRLHISLLEKAGVDLILGHAQFVDEHRLQVGDRQVTAAKILIAAGGRPIKLPIPGGELAITSREMF
    HLPEQPQRFAVIGGGYIGCEFAGILRSLGSEVTQIIRRDRILQGFDQELREAVQTGMSQLGVQFRTGVTVERIDQTETGL
    QLSYSDGSQQIVDQVLMATGREPWLEGLDLDAAGVAIEGRRIAVDAWSRTNQPHIFAVGDCTDRVNLTPVAIAEGRAFAD
    TEFGQKPRQISYENIASAVFSQPEACSVGLSEEAAKAEYGEERIRVYRSRFRPMFYTLPQAEERVLMKLVVETESDRVLG
    AHMVGKDAAEIIQSVAIAVTMGATKADFDATMALHPTSAEEFVTMP

    >gi|56750774|ref|YP_171475.1| hypothetical protein syc0765_d [Synechococcus elongatus PCC 6301]
    MSSFALSWSELATLTDFNPDRVNGPTNAQSTLRLFGQPESAVRVTLYRDHHAWCPYCQKVWLWLEEKQIPYRIAKVTMFC
    YGEKETWYKRKVPSGMLPALELDGRIITESDDILLALESTFGPLMHSLLDRTVLPLRRLERELFRAWCGWLCYPSRSPQQ
    DQQGRTAFQAVVDRVEAALASTPGPYFLECFGVTDVIFTPYVERMNASLFYYKGYSLREINPRLSDWFEAMESRETYRGT
    QSDFHTHAHDLPPQMGGCYANTDPQTAVCQARVDQGPWFGLPDVTYPEPPTARQEALQRVLRHKDTLIRLNPLEAEVFDP
    ALRAALTTLITGQVCPPPAGSDRGLRYLRDRISVPRDMSIYAAKHLREALEATAQLAGDRQGPAISMRDRRDQDPARFAS
    ATAC

    >gi|56750892|ref|YP_171593.1| bacterioferritin comigratory protein [Synechococcus elongatus PCC 6301]
    MPVSRRQLLLSSLLALPALVLAPRSAQALGGPQPPVDEPAPDFSLPTDDGRERLSLADFRGQWLVLYFYPKDGTPGCTLE
    AQRFQQDLAAYAERNAQIVGVSADDLSSHSRFRENEGLSYPLLADVKGEVSKRYGSWLAPFSLRHTYIIDPEGVLRANFT
    AVRPVIHSKEVLAKLDELQAG

    >gi|56750910|ref|YP_171611.1| thioredoxin reductase [Synechococcus elongatus PCC 6301]
    MTGVENVVIIGSGPAGLTAAIYAARANLKPLMFEGYQLGGLPGGQLMTTTEVENFPGFPEGITGPELMERMRAQAVRWGA
    ELYTEDVISADLSQRPFRIRSQEREVLAHSVIIATGATARRLSLPGEDRLWNNGISA
    CAICDGAAPIFRDGELVVIGGGD
    TAAEEAVYLTKYAKHVHLLVRSDRMRASKAMQDRVLAHPNVTVHWHTEAIEAVGNTLLEAVRVRNNQTGEEKAIAAQGLF
    YAIGHTPNTKLFEGQIELDGTGYIRTKPDSVETSLEGVFAASDVQDHEYRQAITAAGTGCAAALLAERYLSAHNLLQEYK
    QEAAAAEPETKAAATPAASQPEASEFDPTSVYHEGSYALRKLYHESDRLLAVLYTAPT
    CGPCRTLKPILRKVAEEFSDRL
    HYVLIDIDADPEIAQSAGVVGTPTLQLFKDKAKVDEIRGVKMKSDYRARFEQHLQPVSR

    >gi|56750918|ref|YP_171619.1| hypothetical protein syc0909_c [Synechococcus elongatus PCC 6301]
    MADFTEIDPQTFAERQAAQPAPDWQLIDVREPAEVELASLPGFRVYSLSRSAEWVDRIGQELDRSKETIVLCHHGMRSAQ
    MCQWLLTQGFEHVVNLRGGIDAYSRLVDAQVPLY

    >gi|56751170|ref|YP_171871.1| hypothetical protein syc1161_d [Synechococcus elongatus PCC 6301]
    MAIVKHQSRFLCKIATIESDRSCLIAAMTAAAPTLSRRRLLLGLVSAGAGAGGFLFWRQSRSPLSSTDAVYPMQLSEAEW
    QQRLSPEAYAVLREAATERPFTSDLLAEKRVGQYCCAGCEQPLFESAAKYESGTGWPSFREAIAGSLGFQTDYKLVVPRT
    EYHCSRCGGHQGHVFNDGPAPTGKRF
    CNNGVAIAFVPAADQG

    >gi|56751357|ref|YP_172058.1| hypothetical protein syc1348_d [Synechococcus elongatus PCC 6301]
    MLNLDTDSIQLTQDDYARYSRHLILPEVGLEGQKRLKAAKVLCIGTGGLGSPLLLYLAAAGIGRIGIADFDIVDHSNLQR
    QVIHGTSWVGKPKIESAKNRIHEINPYCQVDLYETALSSENALSILEPYDVIVDGTDNFPTRYLVNDACVLLGKPNVYGS
    IFRFEGQATVFNYEDGPNYRDLYPEPPPPGMVPS
    CAEGGVLGILPGIIGVIQATETVKIILGQGQTLSGRLLLYNALDMK
    FRELKLRPNPERPVIDRLIDYQEFCGIPQAQAAEAAATDSIPEISVTELKAILDRQDPEVLLIDVRNPHEAEIATIPGAI
    LVPLPDIEAGAGVETVRELLNGKRELIVH
    CKMGGRSAKALGILKEAGITGTNVAGGINAWSQDVDPSVPQY

    >gi|56751365|ref|YP_172066.1| ADA regulatory protein [Synechococcus elongatus PCC 6301]
    MESTGLRIHWQPPSESAQSEQLIYGIHRTLFGDCLIAKTAIGICQLELFDRLSPTEARQYVQATWPKADIEDQPTATIAI
    AQQLFCHAAKDPDPLCLHVRSTVLQQQVWQSLLQIPRGATTTYQALAVAIGRPKAARAVGNAVGKNPIAYLIP
    CHRVVRQ
    SGELGGCRWGRDRKQQLLAWEAECF

    >gi|56751666|ref|YP_172367.1| antioxidant protein] rehydrin [Synechococcus elongatus PCC 6301]
    MSLRLGDTVPNFTQQSSEGEINSYDWAGDSWVILFSHPADYTPVCTTELGTVAKLEEEFAKRNVKPIALSVDDVESHKGW
    IGDINETQGTQVNYPILADPDRKVSDLYDMIHPNANNTLTVRSVFIIDPNKKLRLTLTYPASAGRNFDELLRVIDSLQLT
    DNYSVATPANWNDGDDVVVVPSIPTEQAREQFPKGVTEVKPYLRLTPQPNR

    >gi|56751679|ref|YP_172380.1| peptide methionine sulfoxide reductase [Synechococcus elongatus PCC 6301]
    MKRLLVLGLLIASFWFPNTAAWAATAEAIFAGGCFWCVEADFDKVTGVTETISGYSGGTVKKPTYKQVSAGKTGHYESVK
    IIYDPDQVSYDQLVSYFLQHIDPLDGGGQFCDRGDQYRSAIFVTPEQQPIAEAAIAAAAQELGQPIQTKIQPAKEFWEAE
    NYHQNYYQKQALLYKYYRARCGRDAQIAKVWGEYEQQS

    >gi|56751688|ref|YP_172389.1| thiosulfate sulfurtransferase [Synechococcus elongatus PCC 6301]
    MSSPLVSAEWLQAHLHDNDLCLVDCRFDLMQPQQGRDQYQQGHLPGAVYLDLEQDLSAPKGDRGGRHPLPDIEALAARLG
    AIGISSDPATLVVAYDASFSAFASRLWWLLRYLGHERVAVLDGGLAAWQAIGGELVTDIPAIAPAKFQPHPQTGWVVDAV
    GLKVAQARGQVLIDSREADRYRGDREPIDPVAGHIPGAQLAVWKEALDEKGYWRLPSEQQQRWQHLSTAVQPIIY
    CGSGV
    TACVNLLSWELAGRSPAQLYAGSWSDWCSDPENAIATGEE

    >gi|56751788|ref|YP_172489.1| glutaredoxin [Synechococcus elongatus PCC 6301]
    MANVEIYTWSACPFCVRAKALLTRKGVAFQEYVIDGDEAARAVMAQRANGRRSVPQIFIDDQHIGGCDDLHALDRQGGLD
    PLLGLSA

    >gi|56751794|ref|YP_172495.1| copper transporting CPx-type ATPase CtaA [Synechococcus elongatus PCC 6301]
    MPAAIVHSADPSSTSILVEVEGMKCAGCVAAVERRLQQTAGVEAVSVNLITRLAKVDYDAALIEDPTVLTTEITGLGFRA
    QLRQDDNPLTLPIAEIPPLQQQRLQLAIAAFLLIVSSWGHLGHWLDHPLPGTDQLWFHALLAIWALLGPGRSILQAGWQG
    LRCGAPNMNSLVLLGTGSAYLASLVALLWPQLGWVCFLDEPVMLLGFILLGRTLEEQARFRSQAALQNLLALQPETTQLL
    TAPSSIAPQDLLEAPAQIWPVAQLRAGDYVQVLPGVRIPVDGCIVAGQSTLDTAMLTGEPLPQPCQVGDRVCAGTLNLSH
    RLVIRAEQTGSQTRLAAIVRCVAEAQQRKAPVQRFADAIAGRFVYGVCAIAALTFGFWATLGSRWWPQVLQQPLPGLLIH
    APHHGMEMAHPHSHSPLLLALTLAISVLVVACPCALGLATPTAILVATGLAAEQGILVRGGDVLEQLARIKHFVFDKTGT
    LTQGQFELIEIQPLADVDPDRLLQWAAALEADSRHPLATALQTAAQAANLAPIAASDRQQVPGLGVSGTCDGRSLRLGNP
    TWVQVATAKLPTGSAAATSIWLADDQQLLACFWLQDQPRPEAAEVVQALRSRGATVQILSGDRQTTAVALAQQLGLESET
    VVAEVLPEDKAAAIAALQSQGDAVAMIGDGINDAPALATAAVGISLAAGSDIAQDSAGLLLSRDRLDSVLVAWNLSQMGL
    RTIRQNLTWALGYNVVMLPLAAGAFLPAYGLALTPAIAGACMAVSSLAVVSNSLLLRYWFRRSLNHSVSV

    >gi|56751802|ref|YP_172503.1| thioredoxin peroxidase [Synechococcus elongatus PCC 6301]
    MRLMTEGALRVGQLAPDFEATAVVDQEFQTIKLSNYRGKYVVLFFYPLDFTFVCPTEITAFSDRYADFSALNTEILGVSV
    DSQFSHLAWIQTSRKEGGLGDLAYPLVADLKKEISTAYNVLDPAEGIALRGLFIIDKEGVIQHATINNLAFGRSVDETLR
    VLQAIQYVQSHPDEVCPANWQPGAATMNPDPVKSKEFFAAV

    >gi|56751916|ref|YP_172617.1| hypothetical protein syc1907_c [Synechococcus elongatus PCC 6301]
    MTEKIRKSEEEWRAQLTPEQFQVTRKHGTERAFTGAYWDTKDPGLYRCICCDAPLFRSDTKFDSGTGWPSFWAPVDESAI
    TYKKDFSFLMMRTEILCARCDAHLGHVFPDGPKPTGQRY
    CLNSASLKLDTETPASPSSEA

    >gi|56751924|ref|YP_172625.1| bacterioferritin comigratory protein [Synechococcus elongatus PCC 6301]
    MALTVGTAAPDFTALDDAGQSIQLSQFRGKTIVLYFYPKDDTPGCTKEACSFRDSYSAYQGKDIIVLGVSTDDSSSHEQF
    KTKFSLPFPLVADPDRSITQAYDVDGGGYAKRVTYVIDGEGQIIRVYDSVKTDTHAGDILADLGL

    >gi|56751973|ref|YP_172674.1| thioredoxin [Synechococcus elongatus PCC 6301]
    MTADNSVPSRLRNILVIAAALVLTILVVLGSRQPSAAASLASLAEQATPYEVAIANDRPMLLEFYADWCTSCQAMAGRIA
    ALKQDYSDRLDFVMLNIDNDKWLPEVLDYNVDGIPQFVYLNGQGQPQGISIGELPRSVLAANLDALVEAQPLPYTNARGN
    LSEFSADLQPSRSSQTDPRSHSGQVQDGVLD

    >gi|56752013|ref|YP_172714.1| hypothetical protein syc2004_d [Synechococcus elongatus PCC 6301]
    MVRKRPTPWLHRWSRPIILFLATIGLLDTGYITLEKFGIIQQTVCPLFGGGCSQVLNSPYAVFFGLPLSLFGAIAYFSAG
    ALAAIPLFVKAEQAKSLRLQLEKTTWLLLFLLSTAMVVFSAYLIYLMAYEIKAFCFFCVGSAILSLGIFLVSLFGHDWED
    LGQVLFGGFITAIAVLVTLLGIYAGGSENPALADQGQTGPPIVNVSKPAAVSLAEYLTKTGAKMYSAYW
    CPHCHDQKELF
    GQQAVQKLDVVECDPQGRNARPQLCQQAGIQGFPTWEINGKQYSGTRPLQELAKLSGYTGPQNF

    >gi|56752127|ref|YP_172828.1| thioredoxin [Synechococcus elongatus PCC 6301]
    MLPVVTAQTFSAEVLQAKDPVLVYFWAAWCGPCRLLTPCLEQWHQTASQNLRVVSINADENFTLANRYRLATLPTLIWFA
    DGRIRDRLEGISDREALQTFLKRYQPVANAV

    >gi|56752161|ref|YP_172862.1| bacterioferritin comigratory protein [Synechococcus elongatus PCC 6301]
    MAIAVGDVAPDFSLPAQDGTTVSLSDFRGQKPVVLYFYPKDDTPGCTIEACSFRDSYTAFQEVGAVVLGVSSDSIDSHQR
    FAQKYNLPFQLLSDAGDRLRQTYGVPKTLFVIPGRVTYVIDKEGKVRHIFDSLLNAQAHIQESLNILRSL

    >gi|56752166|ref|YP_172867.1| peptide methionine sulfoxide reductase [Synechococcus elongatus PCC 6301]
    MFGLFGKKTGLPTPEEALPGRAQAMLVPAKHFVLGTPLDGPFPVGIQLALFGNGCFWGTEKQFWQLPGVYSTAVGYAGGL
    TPNPNYREVCSGMTGHNEVVRVAYDPDRISYADLLKAFWESHDPTQGMGQGPDRGTQYRSGIYCYTPEQKQIALASQAAY
    QAVLKAKGYGAITTEIIDAPTFYFAEEYHQQYLDKPGSRPYCGAQPTGADLPHPNQWNLPTELQSHLTAHPEVWSKNFAE
    CPVVPL

    >gi|56752212|ref|YP_172913.1| hypothetical protein syc2203_c [Synechococcus elongatus PCC 6301]
    MSLVLINFYRFVALGDCDRWRQWLQDLCTALGLRGTILLAPEGINAGLAGNTEAIAQFLSELQQHPPFANLSFKSATVTD
    WPFARLKVKVKPEIVSLGCPELNPAERTGTLVAPQDWNQLLQDPEVVLIDVRNRFEIALGSFPRAIDPQTDRFRDFPRFV
    QEQLLPQPPAKVAMF
    CTGGIRCEKASAYLLEQGIETVYQLEGGILNYLEAIAPEENHWQGDCFVFDERIAVDRQLQTPQH
    QLCPACGQPVVATTCSHCQDSVQASSSPK

    >gi|56752273|ref|YP_172974.1| thioredoxin [Synechococcus elongatus PCC 6301]
    MSVAAAVTDATFKQEVLESSIPVLVDFWAPWCGPCRMVAPVVDEIAQQYSDQVKVVKVNTDENPSVASQYGIRSIPTLMI
    FKDGQRVDTVVGAVPKTTLANTLDKHL

    >gi|56752296|ref|YP_172997.1| bacterioferritin comigratory protein [Synechococcus elongatus PCC 6301]
    MPLQVGDRAPDFTLPDQQGNPVSLTDLRGQRVVIYFYPKDDTPGCTKEACGFRDDFSLFEQAGIVVLGVSKDPASKHQKF
    IAKYELPFTLLTDADAAVASAYDSYGLKKFMGREYMGMMRHTYVIDVEGKIEQIYTKVKPETHARQILTDLGVAVAE

    >gi|56752309|ref|YP_173010.1| thioredoxin [Synechococcus elongatus PCC 6301]
    MRSRFGPTMSAATELNDQQFESAVLKAPGLVLVDFWAPWCGPCRLIAPLMDWAAQTYADQLTVYKLEVDPNPETVARYQV
    QGIPTLLLFQNGELVERVEGAIGRDRIQTLINAHL

    >gi|56752370|ref|YP_173071.1| hypothetical protein syc2361_c [Synechococcus elongatus PCC 6301]
    MAKTASTMLALGTAAPDFALPDVVSGRTVQLADFSDRAGLLVMFICQHCPFVKHVEEELAAIGRDYLDLGIVAISPNSLE
    THPQDGPEQLKAQAERLGFTFPYCLDETQAIAKAYTAACTPDFFLFDRDRRLVYRGQLDDSRPSSDRPVTGADLRAAITA
    VLTGDAPSADQKPSIGCNIKWHPGQEPDYYGAQLV

    >gi|56752408|ref|YP_173109.1| hypothetical protein syc2399_c [Synechococcus elongatus PCC 6301]
    MALWRWAPLPMVKSRRLWLAATATALLYTGTLVVDGQPWRVTWGLALTTAQVAQNLGWDPQSSVFWGRQLGRLSSSLLAD
    PSVITDLGLILGALTAAAYEGRWRWQGSLQPHAVGLSIAGGLSMGFGAFLAAG
    CNISAYLAGIASTSLHGWVWLVAALLG
    SWVGIHLRSRWQPSSPPASTNLS

    >gi|56752410|ref|YP_173111.1| putative thiosulfate sulfurtransferase [Synechococcus elongatus PCC 6301]
    MSVRSLRWPRQKAFLAVISLVVAVLLAVPGWLTPATAASQATVQFVAPTWAAERLNNKQLKILDVRTNPLAYIEGHLPGA
    VNIADAAYRGPNGFLPVQIWDPEKLASLFGRAGVSNNDTVLVYSDGNDVLGATLVAYLLERSGVQNIAVLDGGYKGYKDA
    GLPVTKEYPRYQAARFAPKDNRAFRVDIKQVEQLTGKSTFVDPRPPALFSGEQQVFIRNGHIPGARNIPWPTFTEANNAN
    ESLKNPHKLKPLSELKAILEAKGVTPDKDVIVT
    CSTGREASLQYLVLKHLLKYPKVRIYEGSWTEYSASNLPVETGPDRV