Symbiobacterium thermophilum IAM 14863 uid58165

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|51891165|ref|YP_073856.1| hypothetical protein STH27 [Symbiobacterium thermophilum IAM 14863]
    MRQALVRWAGGIAFEAQLGSGHTIVMDASREVGGEDRGPRPGELLLAALGGCTGMDIVSILQKMRVDFDRVEVTVEAEAR
    EEYPKYYDRFRVIYRVFGGDVPADKVKRAVQLSEERYCSVGALFSHGAEITHRIEINGEPVE

    >gi|51891245|ref|YP_073936.1| putative transport system permease protein [Symbiobacterium thermophilum IAM 14863]
    MTTQHILGWLLIAGVLSGFVFQRSRLCFVSALRDLFLFRALRMTRAMLLLFLLTVTGGATLQAVRGVLVEGFPGPTPAGA
    LAGGAIFAVGMVLAGS
    CIAGAFWRLGEGQLSQLAVLAGVLAGTWLYVNLPFLTTVTVQETFNAWIAVGLLLLGLMAVAAW
    ERRQPRVGEELPGARRLSWVRAPWAPELGAVVMAVLLVTFMALTGTGWGVSRAFLLTDLSAAAYAGGLLIGGFLGARLGR
    EFRVRGPGGRAPTVIRLLGGVLMGYGARVGWG
    CTIGAVMTGMVNLSLHPWYWMLGAMLGAWVGAELLRRFMYQYL

    >gi|51891246|ref|YP_073937.1| hypothetical protein STH108 [Symbiobacterium thermophilum IAM 14863]
    MSEGGHRMANLKRRTALSLALVFALAALAACGGSAQQPVATNQAAAAPTQECPPCPEPEPCDEEAILLEAAQDYFNNMAS
    HRNMIDAAEVKEKLEAGDDSIFLLDIRADADFAAGHVEGSVNIPFAALGMNFDKLPTDKLIVVN
    CYSGQQSGQAAAVLRM
    AGYNAMSLKGGFPNYEKAELPIVQ

    >gi|51891299|ref|YP_073990.1| hypothetical protein STH161 [Symbiobacterium thermophilum IAM 14863]
    MRMAIRLTVFSDFVCPFCYIGEGLVEKLRQEPDLGVEVTWMPFQLNPATPPEGLTLAEYFGGRMPPDRLAMMHAELKARA
    GAMGLPMDPPPFICNTRRAHELAEFARDRGRLDAVVLPLFQAYFVQGRNLYEERVLGEAAEAAGLDPVEALAAVREGRYA
    DQVDERLALAGRYGIHSVPTFIVNERYKIVGAQPYEVLRDALRSIAQEG

    >gi|51891311|ref|YP_074002.1| thioredoxin family protein [Symbiobacterium thermophilum IAM 14863]
    MHATLAAAIWAVLLLGGAFRPGAATPDGPPRPAVGSPAPALELADPTGQTVRLADFRGRAVFLNFWASWCGPCRAEMPEI
    QRLAESLPDGTAVLTVNLTGREASPSAPLAYLAEHGYSFPVLLDPRDEAGTAFQVASMPTSLFISPEGAVTARVAGPLTY
    RAMREYLTAAVSGPPSATAGRSLNRWLPESVPLGPAALPTRALLWLAGVLLAAAVAGVPRPVTDARRSAAEAESDPGPSL
    RARELVLNLAVGGVLGAKLLYVLMDPGAYVRSPALLLAFPYGRLALPGAVAGGLALSLWGLRGVPDSATVWDRALPGLLL
    GAGVGALASPDPADWALGPALLAAGLLSLGLSRLAGPPGDGAVTALLLGALAVTLADLARPSAGPAGITPVQLLAAVVAT
    LAWIRQRRRTVAP

    >gi|51891385|ref|YP_074076.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
    MAQYTVPITDATFEAEVLQSELPVLVDFWAPWCGPCRMIGPVLEEYARDNGHRIKIAKLNVDEEQEWAGRFGVMSIPTMI
    LFHKGKPVGQLVGFRPKHEMYQILDSALDQLESA

    >gi|51891458|ref|YP_074149.1| putative glutaredoxin [Symbiobacterium thermophilum IAM 14863]
    MYTKESCPGCLQIKRMLNYLQLAYEERRVDEQSADRERILALGFRSLPVVEVEGVGAVPGADPAQVEDLLVRAGLV

    >gi|51891493|ref|YP_074184.1| hypothetical protein STH355 [Symbiobacterium thermophilum IAM 14863]
    MFGFGPRIESITTAELQARLERGERPKIIDVREPWEYAEGHVPGAVLKPLGQIRTWARELDRNEEILLICRTASRSAVAY
    QFLKRLGFTNVKNVAGGMVTWRGEVAR

    >gi|51891494|ref|YP_074185.1| putative pyridine nucleotide-disulphide oxidoreductase [Symbiobacterium thermophilum IAM 14863]
    MAQRKIVIVGGVAGGATAAARARRTDEHAEIVLFEKGPYISFANCGLPYYVGKEIGDRSALLLQTPESFRARFEVDVRVL
    HEVVAIDRAAKRVTVRNLETGEVYHESYTALVLAPGSVPIRPPLPGIGLPNVFTVRTVPDAVAIRELVERESPARAVVVG
    AGFIGLEMVENLAGLGLAVTLVEKADQVLPPLDPEMAAFVQSHLEQMGVEVITGDGIAAFTGNDRATAARLESGREVEGD
    LFILGLGVRPDTRLAREAGLAIGPTGGIQVNERMQTNDPAIYAAGDAVETIHLVTGRPALIPLAGPANKQGRVAGANAAG
    DSLTFPGAIGTAIVRVGSLVAAVTGLSEKAARREGLKVYTSYTLSGDHADYYPGMQELMTKLVVESDTGRLLGAQVIGAN
    GVDKRTDVYATAILGRMTVDQLANLDLAYAPPFGAAKDAAVVAGMVAQNIRRAALRVITPEELLGRMEAGEELQVVDVRN
    PYEYDMGAVPGAVNIPVDELRSRLGELDPSRETVVYDRTGAMAYVAARILAQRGYSVSSLAGGYALFPAAEAVRAQRTL

    >gi|51891552|ref|YP_074243.1| pyruvate dehydrogenase E3 [Symbiobacterium thermophilum IAM 14863]
    MGSIKTGTDVVVIGAGPGGYVAAQRASQLGLDVTLIEREELGGTCLNHGCIPSKALISVGDLLYKVNNAAERGLVVKGSV
    EVDFAKTQEWKETKVIKRLTSGVASLMKAGQVEVVKGTARFTDPHSLEVELNDGGTAAYTFKHAIIATGSTAVNPSFFPL
    DGENVVDARGALAFREIPPRFVVVGGGYIGVELGIAYAKLGSKVTIVEATGQLLPGTDPDLVNVLMRRLRRLGVTVMLNA
    RASGGLQNGKVKVQDGEGKVHEIEADKVLVSVGRVPYTEGLHLDKAGVRVDEKGFIPVDEQMRTNVPHIYAIGDVCSPVM
    LAHKASAQGRVAAEAIAGRPSAADWQTVPAVIFTDPEIAYVGLTEAQAREKGYDPVVSRYNFAAVGRALTMGESDGMVKL
    VGDRQSGLLLGAQMVGPEVSELIGEIALAIEMGAQMEDVALTPHYHPTLSEGILEAALSWMHSIEKAGRK

    >gi|51891687|ref|YP_074378.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
    MQRLTAETFDEAVREHPHLIVNFTADWCPDCRRIKDAYAGFPERFPEIAFAVVDTEESPDLAERFDVRGIPSLLVFRDGE
    LIDRLYSRDAKTVQQVEAFVTRQLPVSS

    >gi|51891765|ref|YP_074456.1| hypothetical protein STH627 [Symbiobacterium thermophilum IAM 14863]
    MKPEVTFFTYPTCTSCKKAKQLLDEKPVEVHERRFFKEKPTPEEVRWLAARLPGGVRDLLSTRSRRYKELGLAERELTDD
    ELVELLAAEPGLWRRPVVVRGDQVVVGYDPASLEELLRVGE

    >gi|51891872|ref|YP_074563.1| cytochrome C biogenesis protein [Symbiobacterium thermophilum IAM 14863]
    MTRYPRYKRVTSAITLLLLAAWLGYVLLWPNPNAAAGSGVPVGSVAPDFELKTVTGESYRLSDLRGKAVLLNFFATWCRY
    CEQEMPALEEAYRTYADQGFVVLAIDLDETDLAITAFRDEMGITFPILVDRGSNVARVYQIVPLPTTYFIDRSGVVRGKW
    TGPLTPEQLREALQLIL

    >gi|51891967|ref|YP_074658.1| putative mercury ion binding protein [Symbiobacterium thermophilum IAM 14863]
    MTTVKIAGMSCNHCVMGVKKALSAIPGIENLQVEIGAARLEGNVDLEAVKRAIEEEGYEVVEVA

    >gi|51892037|ref|YP_074728.1| electron transport complex RsxE subunit [Symbiobacterium thermophilum IAM 14863]
    MKPSAQSPTFGSVLADGLRQAPPFRLLLGLCPSLAVTTAMENGFWMGLAVIFVLSCSELIISLLRRVIPDRVRIPVYIVI
    VATFVTVVDMVMKAYLPEMHAILGIFIPLIVVN
    CIILGRAEAFASKNGPLLSVADAVGVGLGFTASLMAIGGVRELLGTG
    NLKLFGVALLGPGLPLEVVVMLLPAGAFFVIGFLMAGLAWLQQRQEARGRRDRPASGSGSTAGAGTVSGGEEAAV

    >gi|51892038|ref|YP_074729.1| Na+-transporting NADH-quinone reductase subunit 5 [Symbiobacterium thermophilum IAM 14863]
    MEILAILIGGILVNNYIFSRFLGLCPFFGVSNKLETVYGMGAAVVFVMTLASAITWPLQHLLLEPLGLGYLQTVAFILVI
    AALVQTVEMVIQRVSPTLYAALGIFLPLLTTN
    CAVLGAALLNITQGYGFMTSVLNGFACGVGWTLATLLFAGVRERIEGA
    HIPPAMRGMPIAFVAAGLMALAFMGFQGLFRGILF

    >gi|51892064|ref|YP_074755.1| 2-cys peroxiredoxin [Symbiobacterium thermophilum IAM 14863]
    MRLVGKPAPDFTMLSTKDLDKLDQKVSLSDYKGKWLILFFYPADFTFVCPTEITAFNDRVQEFQDANCEILGVSVDSVYS
    HRAWIKTPKEEGGLGPVNYPLASDITKEVSRAYGVLIEEEGVALRGLFIIDPDGIVRYQVVHDNNIGRNVDEVLRVLEAL
    QAGGLCAANWKPGDALLKV

    >gi|51892065|ref|YP_074756.1| hypothetical protein STH927 [Symbiobacterium thermophilum IAM 14863]
    MRLGSPMPPLEGATGSYNAEGFDPAQLSGHPVLIHFWAVSCHICHEVMDQVLQYRDMYQPKGLKVVAIHMPKEEGDLDTA
    KVERDIAQYGITQPVLLDHRHALAQAFQNQFVPAFFLFDAQGNLFFRAAGDKGLQNLGPKLEQLLG

    >gi|51892103|ref|YP_074794.1| thioredoxin reductase [Symbiobacterium thermophilum IAM 14863]
    MSGTKELYDVTLIGAGPTGLFGVFYAGMRGMKTKVIEALPEVGGQLAALYPEKDIFDVAGFPRISAKRLVEQCKEQADSA
    NPDATYVFNQRVDKLNRLEDGTFELVTHTGERHYSKAVIITAGIGAFEPNRIPNESARQYEGKGVFYSVTNLPQFEGKRV
    LVIGGGDSAVDYALMVEPIAAEVTLIHRRDGFRAHEESLKKLAASRVHVKVFYELRRVEGDGNWVKKATIFDNRTGEETT
    IDVDCVIIGTGFKASLGSMLEWGLEIENKRQIVVNSKGETNIPGVYAAGDICWYPGKIRLIATGFGEVATAVNNAKAFID
    PGSAAFPGHSSEQRNK

    >gi|51892121|ref|YP_074812.1| hypothetical protein STH983 [Symbiobacterium thermophilum IAM 14863]
    MNITLTEKASNRLKEIIKSKGENLALRVLVRPGGCSGFEYGMALERNPRPDDNISEFDGIKVVIDPASLPYLDGSTIDYV
    DSLMGGGFAINNPNAVTGCACGQSFRTANAAGAPRSCGSGGCAH

    >gi|51892164|ref|YP_074855.1| putative DNA-methyltransferase [Symbiobacterium thermophilum IAM 14863]
    MEYTCCETRLGPIYVAWTAQGIACVAAGEGEEEAFRARCRALTGQSPVRNDGRRAELERMLQGWLEGEPYDGPVDLSPLS
    PFDREVLAACRAIPRGEVRTYGELAAAVGRPRAARAVGGALRRNPVPLLIP
    CHRVVRSDGTIGQYSMGGPEVKRQLLAME
    GAR

    >gi|51892210|ref|YP_074901.1| thioredoxin reductase [Symbiobacterium thermophilum IAM 14863]
    MRKVVILGTGPAGLTAAIYTARANLQPLVIEGNEPGGQLTTTTEVENFPGFPDGIMGPELMDNMRRQAERFGAEFRRGYV
    TGVDFSRRPFRITVDETDVIEAEAVIIATGASAKHLGIPGEDENIGRGVSY
    CATCDGFFYRGKKVLVVGGGDSAMEEANF
    LTKFADVTVVHRRSELRASKIMQERARANPKISWVLNAVPVEVLADERGFKALKVRDKETGEERLLEADGMFVAIGHKPN
    TDFLRGQIDMDELGYIKTIPGTAQTNVPGVFACGDVQDSRYRQAITAAGSGCMAALDCERFLEEVAAQEGSLTK

    >gi|51892264|ref|YP_074955.1| putative molybdopterin biosynthesis protein [Symbiobacterium thermophilum IAM 14863]
    MHMTHACFTPAERERLDRASVLLIGCGGLGSAVAYALAAAGVGRIGLCDMDRVDLSNLQRQVLHHTADVGRPKVESAREK
    ILGLRPGIQVDLHPVALTSENALDLFRQYDLIVDGSDNFATRYLVNDACVLTGRPQVHGSIFRFDGQVTTFVPGEGPCYR
    CVYPTPPPPGAVPS
    CAEAGVIGVLPGFIGSLMAMEALKLITGRGSPLIGRLLIFSALDMGVSEVQIRRNPECPVCGEHPT
    IHELMDYEQFCGGVGR

    >gi|51892526|ref|YP_075217.1| putative permease [Symbiobacterium thermophilum IAM 14863]
    MIQVILAGGLTGILFGFVLQRGRFCMTSGFRDLFLTRDATLFKAYVLALAVQSTGIFVLQAAGIIRLGADPFQWLAAAVG
    GLIFGISLILSGG
    CASGTYYRIGEGMVGSLIAAVFFGIGALASRGSGILAPLAQRIQAHTLTVNGATSLHEALGVSPWVL
    VAGLWVAAILFLVRARRAPAPAWQPPVDESRSWLWRAVFGRGWSWQVTGLAVGLVAVLAWLTSVSTGRMGGLGITGATAG
    LLRLVVASGDVSALDWSAFLVLGIPVGSFIAARAAGEFRLRAPGPARLLQHIAGGLGMGFGATLARG
    CNIGNGLVAVSQF
    SLNGWTATLFIILGTWLGAYLFLVLPARRAESRQVASPGLAHGD

    >gi|51892763|ref|YP_075454.1| putative zinc/cadmium-transporting ATPase [Symbiobacterium thermophilum IAM 14863]
    MATKVSYNLQGLDCADCAARIQDALHRQGMSEAVVSFATGQLLLPAEQLDRARAVIREVDPKVTVLDPTEQAGPDEEDDD
    GIPTWRRIAEMAAAAALLVAGAVFHDALHASPWAEYAVFVPAYLLVGRNVLLAALRNLGRGQLFDENFLMTVATLGAFAI
    HELPEAVAVMLFYAVGEYFQDRAVAGSRRSIRALLAVRPDHATVRRGDRLIQVSPESVAVGEEILVRPGERIPLDGEVIE
    GSTYVDTSALTGESAPRPAGVGDAVLAGTVNLQGLIAVRVTRPFGESSIARVLQLVEEAAARKAPTERAITAFARWYTPA
    VVGIAALVALLPPLLLPGATFADWLHRALVLLVISCPCALVVSVPLTYFGGIGAASRAGILVKGGNYLDALARLDTVVWD
    KTGTLTQGRFTVSSVAAADGVDAGDVLRLAAHAEAHSAHPIAAAVREAYGRPVDAGIVDDYAEIAGHGVRARIDGRVVLA
    GNARLLAAEGIPVPPGDDGASTVVHVAADGAWLGRIAVADQAKPTAGQAVERLRTLGVSRQVMLSGDDHRVAEAVGRSLG
    LDEVRANLLPEEKVAAVEEIDAARRTAGRTGALAFVGDGINDAPVLARADVGVAMGALGTDAAIEAADVVIMDDDPAKLA
    TGVSVGRRTRQIVHQNIAFAIGVKAVVMLLGALGLANMWAAVFADVGVALLAILNATRVLKQPSSPRRAI

    >gi|51892871|ref|YP_075562.1| cytochrome C biogenesis protein [Symbiobacterium thermophilum IAM 14863]
    MFCPECRTSLQPDARYCHLCGWDSKAAAAARRAAELGRRPAWKRWVSGVSLGIMAFVVLFMLLVPRTDAYAVPQVGSPAP
    DFEIPALDGGSVRLSDLRGQPVIINFWATW
    CPPCRKEMPDFQEVYDRYKGDGLQFYAINVGESRVTVRDFMARIGVDLPV
    LIDAGEEAQSAYNILPIPATFFIDREGIVRAVYQYQMSRAQIEFEVQRLMAR

    >gi|51892899|ref|YP_075590.1| bifunctional methionine sulfoxide reductase A/B protein [Symbiobacterium thermophilum IAM 14863]
    MDEKRLELATFAGGCFWCMVSPFEEQPGIYKVVSGYTGGHKENPTYEEVCSGTTGHFEAVQITFDPDVFPYERLLDLFWQ
    QIDPTDPDGQFYDRGPQYRTAIFYHNEEQRRLAEKSKAELEASGRFDKPIATLILPAGPFYPAEEYHQGYHRKNPFHYQR
    YRAASGRDDFIRKHWRDPERDAELRRRLTPIQYEVTQLGATERPFTGEYWNHFEEGIYVDVVSGEPLFSSRDKFDAGCGW
    PSFTRPLVPENIVERLDLSHGMVRTEVRSRGADSHLGHVFPDGPAPTGLRY
    CINSAALRFIPKEDLEKEGYGEFRKLFE

    >gi|51893196|ref|YP_075887.1| hypothetical protein STH2058 [Symbiobacterium thermophilum IAM 14863]
    MVVVFQPYVPLQWTKLCQRSDVGMSKAKGGRSLNRKKDRSLWWVIGVAVGVTAALIVASNVTARRLGEIVLPSIILTDQE
    RGADRHVLGSADAPVELVEFSDFR
    CPHCRESHEILGSQIEELVAEGTARYVRKHMLVIDPSDTSLNAAEAVECAADQGYY
    WAFLDMLFANQAAQGQKWTRDAMKTYARELGLDTKAFNECMDQQKYRDKVLADSAEGYSTPGITGTPSFLVNGELLRIRS
    YQDVISAVLAAAGQSPGQGQ

    >gi|51893301|ref|YP_075992.1| branched-chain alpha-keto acid dehydrogenase E3 [Symbiobacterium thermophilum IAM 14863]
    MSHSFDVVVIGGGPGGYVAAIRGAQLGLRVALVEQDKVGGTCLHRGCIPTKAYLRSAEVLHTLRQSREYGVLTGGVDLDF
    AAVRSRKDKVVSNLHKGIQGLLKKNGVAVFQGRGALVPPSIFSPNGLVSVMVGDQQELLEFNKVIIATGSRPKTLGIPVD
    GAHVMTSDEALARPDLPASVIIIGAGVIGMEWASLYADFGVRVTVLEFLDRILPTEDEAVAAELHKLMTRRKVEIVTGAA
    VLPESVQAEGGQVRVQARVGEQVREFQAEALLIAVGREPVTRGFGLENRERVTYGPGGFIQVDGFGRTGDPAIYAIGDVA
    GGGLAHVASHQGIIAMEHIAGLNPEPFAPVRVPRCVYTRPEVASVGLTEAQAREQGREVRVGTFPWRGIGKALVHGSVDG
    FAKIVADAATGDVLGVHLIGPDATNLIAEAGLALTLNASAWELGQVIHPHPTLAEIFGEAALAVEGRAIHM

    >gi|51893359|ref|YP_076050.1| hypothetical protein STH2221 [Symbiobacterium thermophilum IAM 14863]
    MLVLGIPLGGFLAYQLSGEKPAANTGSGLSATSPLTAFRGGFLVLFGARMAGGCTTGHVLSGMAQLSIAGFLFAAAVFAG
    GIPTALLLKRRWS

    >gi|51893434|ref|YP_076125.1| hypothetical protein STH2296 [Symbiobacterium thermophilum IAM 14863]
    MPPFLPGDTRRALRSLRAPSPLSRGQGGIALGLLSTCAMVLLKPMGVSTVFPSTLGILLKPLFPGFVEGDAYLQTIPLSI
    GWEHMLMLGIPLGGYLAYRLAGEGRDGQPSSGLSTTSPLLAFVGGFLVLFGARMAGG
    CTTGHVLSGMSQLSVSGFLFAAA
    VFAGGIPTALLLKRRWR

    >gi|51893507|ref|YP_076198.1| arsenite S-adenosylmethyltransferase [Symbiobacterium thermophilum IAM 14863]
    MWMDAHALREMVRKRYAEAARGSAAGSAGGCCAPEPKGDDLLVVSGCCCGSGAGGEELGRVLGYSDDELAAAPAGADLGL
    GCGNPQAIASLKPGETVLDLGSGAGFDCFLAARQVGESGRVIGVDMTPEMLARARENARKGGFANVEFRLGEIEHLPVAD
    ESVDVIISNCVINLSPEKEQVFREAFRVLRPGGRIAVADMVSLAPLPPEVREDLALYAG
    CVAGVATVGELRTMLTEAGFV
    DIVIRPKDSEQLLEAWGAGESLKNQVFSATIEARKPTA

    >gi|51893542|ref|YP_076233.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
    MAGDKVVTLSASNWAAEVEQSSLPVLVDFWAVWCGPCRMIAPVVEEIAADYEGRMKVGKLNVDENNDLAARYGVMSIPTL
    ILFKNGEPVERIVGFQPKKELAAKIDRALAQA

    >gi|51893690|ref|YP_076381.1| thiol-disulfide isomerase and thioredoxins [Symbiobacterium thermophilum IAM 14863]
    MSVSAKPGAARRPAQAVVLLVLALLLAGCGGLQRDAGAAGAGSRSGAQAGGSAADQGTVLEVKPVPGYLAADIRAKDVFT
    GEVLTLSDLKGTPVLLNFWATW
    CGPCREEMPEMEEFHQEMGDAVRVVAVSADSGDSPEKMAAFAEALGLTFSVVHDGGSA
    ARAYRVGAIPTSFFIDGEGVIQVRYTGPLTLEQMKEYAELASNTAEDPEHP

    >gi|51893754|ref|YP_076445.1| putative copper-transporting ATPase [Symbiobacterium thermophilum IAM 14863]
    MSDAIHLSGSAEARTGARLEFSVMGMTCAACSARIQRRLAKAEGVQEASVNLTTEKATVYYDPSAVTPQKLFDLVTDLGY
    GVVKDKFTFDIAGMT
    CAACSSKIERKLSRVPGVLSASVNLSTEKATVEAVGVRAEDLIGLIRDLGYGARLAADAADADRE
    RRRQEMRRQVALLAFSAALTLPLFVANMILMPMRIHHPVLMNRWFQFALATIIQVVVGWRFYRGAWLNLRHGSANMDVLV
    ALGTTAAYLYSVALSFFLGGENYYESSATILTLILLGKTLEAIAKGRTSEAIRKLLSLQAKTARVVRDGVERDVPIEDVV
    VGDVIVVRPGEKIPVDGVVLSGTSAVDESMLTGEPIPVDKGPGDAVTGATLNKNGAITLRATRVGKDTALAQIVRMVEEA
    QGSKAPIQKLADRISGIFVPAVVGIAAVTLLAWGLIAGDWNAALHAAISVLVIACPCALGLATPTAVMVGTGKGAEAGIL
    FKGGEHLERAHKVDVVVLDKTGTITWGRPELTDVIPLGAGAPGADELLALVAAAESRSEHPLGQAIVAGAKERDIALPEV
    ESFEAIPGAGLEARVAGREVLVGTRRLMAERGIDTARAEAQMAELEAAGKTAMLAAVDGALAGIIAVADTVKPTSAEAIA
    ELHELGLEVVMITGDNRRTAGAIGRQVGVDRVLAEVLPGDKAQHVEQLKEGGRKVVAMVGDGINDAPALATADLGIAIGT
    GTDVAIETASVTLMNGDLKGIAQALRLSRQTMRTIKENLFWAFIYNVIGIPMAAFGLLNPMIAGGAMAFSSVSVVSNSLL
    LKRYNPRSRGGIRGDALVKAAAAGVMAFAIWLAFFYTQPFNTVRYDLTIRDLELPVEITVRAGQQVRVSLTNENPDVIHN
    FIIPEVPHRFLKMVRFDPQLHMHAGGADVEVWVSPGRTAVVEFTPTVPGRYAIGDPGKYGVRGWLVVEE

    >gi|51893993|ref|YP_076684.1| phosphoribosylformylglycinamidine synthetase [Symbiobacterium thermophilum IAM 14863]
    MSEMQQPWSLVGLTEAEYRRVVEILGREPNPTELHMFGVMWSEHCAYKHSKAALRRLPTRGEHVLQGPGENAGVVRIDDD
    LAVAFKLESHNHPSFVDPFNGAATGVGGILRDVFTMGARPVATLNSLRFGPLDEPKQRELLRGVVAGIGHYGNTVGVPCI
    GGEVYFDESYRGNCLVNAMCIGILRPDRIHRGIAAGPGNAIMVVGNPTGRDGIHAASLLASAEFSGSEAEAALPTVPVGD
    PFAEKMLMEACLELFETDAVVGIQDMGAAGLISSSSEMAARGGVGVELDVRKVPAREEGMEPWEFLLSESQERMLVCVKK
    GREAEVEAICRKWGVGCAVIGRVTDDGMVRVLDDGRVVAEVPARALAEAPVYHPAKAEPAYLAELRAFDWSRLPEPEDWN
    ETLLRLLGSPNIGARAWIYEQFDHMVQAGTVLGPGGDAGVIRLGAAVAPGAHGLTRQPPGEGLPGRSGQAGPPKGIAASV
    DCNGRYVYLNPRRGTAIAVAEAARNCVVTGARPVAITNNCNFGNPEKPEIFWTFDEAITGMAEACEALGTPVTGGNVSFY
    NETSGEAIHPTPTIGMIAVHENLDRLTTPGFKQVGDVILLLGETRDELGGSEYARLIHGVLAGDAPALDLAFEKRLQDVV
    LRAIHEGLVTAAHDVAEGGLAVALAEMAIAAAEPSLGCQVSIFLGEGRVDGQLFGESQSRILVTATREQVGRLQALLMVE
    QIPFRVLGDVTADGRFRLAALAPGSGSAHVYRRQELIDLPVADLVRAHKEAIPRWMDA

    >gi|51894004|ref|YP_076695.1| glycine reductase complex selenoprotein B [Symbiobacterium thermophilum IAM 14863]
    MRIVHYLNQFFGGIGGEEHAGVRPEVRPGPVGPGMALKAALGDAGEIVATVICGDSWFNENLEEAKATVLALIRQQNPDL
    VVAGPAFNAGRYGMACGAVAEVVSKELGIPVVTGMFLENPGVEVYRRYAWVVETGNSAASMRTAIPAMAALIRRLAAGQE
    PEPGTYLERGLRVNTFAAERGSARAVEMLVRKLKGEPYTTEYPMPSFDRVPPNPPVKDLSKAKIALVTSGGIVPKGNPDH
    IESSSASKYGKYYLGDLDDLTAETHQTAHGGYDPTYANADADRVLPVDVMRELEREGVIGKLHDYWYATVGNGTSVANAR
    AYAREIAEDLKKYEVDAVILTST
    CGTCTRCGATMVKEIERAGIPVVHVCTVVPISLTVGANRIVPAVAIPHPLGNPALPP
    DEERTLRRRLVMKALQALTTPVDGQTVFE

    >gi|51894005|ref|YP_076696.1| glycine/sarcosine/betaine reductase complex protein A [Symbiobacterium thermophilum IAM 14863]
    MELKGKKAIILGDRDGIPGPALEACVRSAGAEVVFASTECFVCTSAGAMDMENQRRVKELAEKYPKEDLVVILGGAEAEA
    SGLAAETVSNGDPAWAGPLAGVQLGLKAYHIFEPEIKEQIDPNVYEEQVSLMEMVLDVEAIVQEVRSIREKYAAW

    >gi|51894007|ref|YP_076698.1| thioredoxin [Symbiobacterium thermophilum IAM 14863]
    MLEVNKENFEQEVLQASGPVVVDWWSPKCDPCMELLPEVERLAETYGDRVKFCKVNVLENRRLAISQRVLGLPTFLFFRD
    GEKVAELAGPEACTAEAIEAELQRLV

    >gi|51894008|ref|YP_076699.1| thioredoxin reductase [Symbiobacterium thermophilum IAM 14863]
    MAERWDLVIIGGGPAGLSAAVYGARARMSTLLIEKGRPGGQAATTEEVENYPGLGRTTGPELMKQFREHAEALGATIVRG
    EVGAVELQGPVKTIRTKKGEVYEARAVILCPGAEPRMLGVKGEGRLRGKGVSY
    CATCDADFFTDLDVVVVGNGDAAVEEA
    IYLTRFASSVTLICIHPEGIMDANKAAQERLFATPKIKVIWQTMVEEILGEDHVEKVALRHLGTGERTELPCDGVFVFVG
    TTPRTEFLRGTGIELDRKGYIIADPDTMETNIPGVFAAGDARRKWLRQIVTAAADGAIAACAAEKFLAEEEQVDREILSP
    EEPVLAVFWSPADSLSVHVLQQAERIVAGMGGQMRLARIDCYKSARTAARLGVFDVPAVRIFHKGIPLATLTEDFNHLEE
    WVVGHLPARI

    >gi|51894101|ref|YP_076792.1| thioredoxin peroxidase [Symbiobacterium thermophilum IAM 14863]
    MCLLQGIDAAAPAAVTGTLRRDPSRPVRPERPNTGKPTTPLLEGNAVERAGAFQFKGEVTLVGPELRVGDQAPAFTAIGN
    DLSTVDSRTFAGKVRIISSVPSLDTGV
    CDTQTRKFNEAAASLGDEVVVLTISADLPFAQKRWCGNAGVDRVITLSDYRDH
    AFSKAYGTYIKEWALCSRAVFVVDRNDRLVHVEYVPVAGQEPNYDAALEAARAALKA

    >gi|51894267|ref|YP_076958.1| hypothetical protein STH3132 [Symbiobacterium thermophilum IAM 14863]
    MSLNRLWSGRWGVTLTGVVVGILAPILVKLGNPGNMGVCVACFTRDIAGALGLHRAAAVQYIRPEIIGLVLGATIAALGA
    GEWRARGGSSPLVRYIMGVIAAIGALVFLGCPWRAFLRIGGGDWNAVVGVLGFAAGIWAATFFLRRGYSLGKSKPMAPVA
    GWIMPAAMVGLLVLLLAAPLFGRDADGNPVGPIFFSTSGPGSQHAAWWISLLFALVIGYLGQRSRFCSVGAFRNLFMLRD
    TKLLTGVVALIITAAVANLALGQFHPGFANQPIAHTDGLWNFMGMLLSGLAFTLGGG
    CPGRQLFLSGEGDTDAAVFTFGL
    LTGTALAHNFNLASSAAGPSPYGPAAVIIGLIVVVVLGFTMRDVAAGEDQSRSAA