Sulfurospirillum deleyianum DSM 6946

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|268678813|ref|YP_003303244.1| thioredoxin [Sulfurospirillum deleyianum DSM 6946]
    MGKYLELNASNFDSTVAEGVALVDFWAPWCGPCRMIAPVIEELANDFDGKAKICKVNTDEEQDVAIKYGIRSIPTILFFK
    NGELVDQMIGASSKQVLADKINSLL

    >gi|268678814|ref|YP_003303245.1| thioredoxin reductase [Sulfurospirillum deleyianum DSM 6946]
    MLDLAIIGGGPAGLSAGLYATRGGLKNVVMFEKGLPGGQITSSSEIENYPGSAQILSGLDFMAPWSEQCMRFGLKHAMEE
    VTRISKNKEGTFHIALAGGKSEEAKSVVIATGSAPKRANFEGEAEFFGKGVST
    CATCDGFFYKNKEVVALGGGDTALEEA
    LYLSHICSKVYLVHRRDTFRASPSTIEKVKNNPKIELVLNVSIKKAYGDAMGLNGLIVVDKEGNERDIKVPGVFVFVGMN
    VNNTILKQEDGRFLCEMDDNGNVIVDLNMHTSVKGLFAAGDIRTKAQKQVVCAAGDGATAGIQALEYVNH

    >gi|268678823|ref|YP_003303254.1| Peroxiredoxin [Sulfurospirillum deleyianum DSM 6946]
    MLNRGDIAPAFSLPNQDNVEISLRDLEGKWVVLYFYPKDNTPGCTSEACDFTEALPAFEDLNAVILGISPDSPKSHQNFI
    LKQNLEITLLSDEAKEVAQNYGVWQMKKNYGKEYMGIVRSTFLIDPAGKIAQVWSNVKVKEHANAVKEALVSLQ

    >gi|268678865|ref|YP_003303296.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurospirillum deleyianum DSM 6946]
    MLVTNKAPDFTATAVLGDNQIVDNFNLYENLGSKGAVLFFYPLDFTFVCPSEIIAFDKRLEEFTSRGINVISVSVDSQFS
    HFAWKNTPINQGGIGHVRFPMVADITKQISRDYDVLFKEGVALRGSFLLDKDGTIRHAVINDLPLGRNIDEMIRMIDTML
    FTNEYGEVCPAGWQKGDQGMRASTEGVADYLANNAEKL

    >gi|268678976|ref|YP_003303407.1| thioredoxin [Sulfurospirillum deleyianum DSM 6946]
    MKVICSHCLATNNVPKLDVYKKANCGKCKASLLDPHPIALSSDNLEAILRSTDVPVIVDFWAPWCGPCKMFAPVFEQAAR
    AYPLRVLFAKVDTEAEQFLASRFKIRSIPTIIVFKEGKEVERVSGAMNDEGLDRFVERFL

    >gi|268679371|ref|YP_003303802.1| ferredoxin thioredoxin reductase beta chain [Sulfurospirillum deleyianum DSM 6946]
    MITKIDMNSPEFIAELEKTEAFTDKVCAQFGFAYTPLDDVKESIQQGLTRNKLIYGKRYCPCFMVIGATKEEQIKAGNRL
    CPCTPALSVEIPQEGTCHCTIFCTPEYAQKLAQNESVEEIAHTHTRGLSEEECALLMKKEQLDGDELEALLEAREKGSVN
    FLLVDTREWMEWVGNRIKGTDVLIPTTSFHNALSQLSGEENIPLILY
    CYSGSRSAYCQRILKHMGFKTVLNLEYGIMAYY
    GECESGE

    >gi|268679517|ref|YP_003303948.1| Redoxin domain protein [Sulfurospirillum deleyianum DSM 6946]
    MKFWLTLFVSCSILFFHGCSSDKKRKEDDKNISSSQSVIRESVTLQDVNGNAIVATPTEKGFTFSGFENKVVLLNFFTTW
    CPPCKAEIPHLNNLQEKYKENFVIISVLLEENKSNEELLSFIKFNAIKYTITNGSGNFALAQSVGGVKNIPLMFLYDKAG
    NYATHYVGAIPEEMIDADIKKVL

    >gi|268679657|ref|YP_003304088.1| Rhodanese domain protein [Sulfurospirillum deleyianum DSM 6946]
    METPSKDEWSEEAVMNLVQAVTKSAEVSAEALHVMLRLRTQGKIDFVLIDIREMHEYSALSIKGTDMLLPTSTLHLHLEQ
    LTKLHDSLLVFY
    CRSANRTLHLLHGLKRMGFTKVAHLSGGIIAYQGEKIKNAPLPQTIRS

    >gi|268679799|ref|YP_003304230.1| peptide methionine sulfoxide reductase [Sulfurospirillum deleyianum DSM 6946]
    MKHEVATLGGGCFWCLEAVFEETRGVIDVISGYAGGKLPNPTYEAVSSGTTEHAEVVQITYDVSIISYEEILKIFWLIHD
    PTSLNAQGNDVGTQYRSIIFYHDETQKAKAQNSLKTFSSKFTKPMVTEIKPLEVFYKAEAYHQDYFKNNPNQGYCLFVVS
    PKVQHFKRELKDLAK

    >gi|268679935|ref|YP_003304366.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfurospirillum deleyianum DSM 6946]
    MHEIYDLVIIGGGPGGIGAAVEAKVLGIENILMIEKGDNHSQTIRKFYKDNKRVDKNYKGQEVKLEGSIDFRDGTKESTL
    NYFDSLLDKGEIDTAFNSEVESISKIGDEFRIVTSKAGYVAKYVVIAIGTMGKPNKPDYTLPLSLKERINFNLDK
    CSQNE
    KILIVGGGNSAVEYALELSKTNNITLNYRRESFSRLNDINLQMIQEYNGQEKLRLRLGMDIVSIENENGLPKVHFTDGYD
    TVYDRVIYAIGGTTPIDFLKKCGITFTEEGKAEFDENYETKTKGLYLAGDIAVKSGGSIAIALNHAYYIVTHMLKTHHS

    >gi|268679958|ref|YP_003304389.1| Peroxiredoxin [Sulfurospirillum deleyianum DSM 6946]
    MFALTLFAGDKMSLYDFEVTTIEGKKTTLEAYKGKVLLIVNVASKCGFTYQYEGLEKLYKTYKDKGFVVLGFPCNQFSEQ
    EPGNEEEIKNFCSLTYDVTFPMFSKIDVNGAKAHPLYVYLKKEQSGFLGSEGIKWNFTKFLVDKNGHVLERFAPTTKPES
    LEETIKGLL

    >gi|268679979|ref|YP_003304410.1| Thioredoxin domain protein [Sulfurospirillum deleyianum DSM 6946]
    MQQFIRFFILFFFSFSLAFSAQTSKVLSVEEAFKILFSQESEGIAIDVTLGEGIYLYDTKIKLEITQPKVVDITALVERP
    KAQMYHESLVQHNSFTLKIPFALLKEQHIDAKNVTFKLSYQGCSTQGICYQPLSQEFRFSTQSVSASNSLSEQDHITQQL
    MQGDRAWVLLSFFGFGLLLSLTPCVFPMIPILSSIIISQPNSNMSAKKGFMLSLVYVLAMACAYTIAGVLAALFGANLQA
    SMQNPWVISFFSAIFLFLALSMFGFYELKMPSFIQNKVSKKTGEAQTQGIVGIAIMGFLSALIVGPCVAAPLAGALMYIG
    QSGDVLLGGSALFVMSVGMGTPLLMIGTTAGRYMPKPGVWMQRVSTLFGIMLLGVALWMLSRIIPASLNMVLWSLLLVST
    AIYFGALESAKEGWGRLFKSFWLFCLVYGILIFVGFVSGATNPLRPLETLTSKTSVETSPSSPFTKVKSLEELKVALQAS
    KKPVMLDFYADW
    CVNCVEFDELTFRDERVKAKLAHFTLLKADVTYNTPEDKALQKAFNIYGPPAILFFKEGKEVHELRLV
    GFKNADEFLAHLDKLGV

    >gi|268680031|ref|YP_003304462.1| protein of unknown function DUF255 [Sulfurospirillum deleyianum DSM 6946]
    MHTNELIHEDSPYLLQHAHNPVHWMAWSDKALQKAKNENKLIFLSIGYSTCHWCHVMERETFEDEVSAKLLNDSYISIKV
    DREEMPDLDKYYQDVHYLLTKRSGGWPLSIIMTPTQQVIFAGTYLPPQSMQGRMGFRELTSFIKGKFDDDFEEVQKSAQS
    IEAALKQYERSFEQKEHIDKERVLEAFVRNVKASYDDVSKGVGHAPKFPHASTWNALLDIYAQTKNLEALYMSEDALLAM
    ANGGINDQIEGGFYRYSVDEAWVIPHFEKMLYTNAELIEVYAKLYTLTQKPLFKEVVDKTIEAMDERFLKEGLYLSASDA
    DSEGEEGKYFVFGFKEAKEALLKGGLSEVETKTVMDYFGITKFGNFEHQSTNPVITCNEKPARLNDAVVILKEERQKVAY
    PFIDTKILTSWNALMITALFEAGKIEKAKNVLDTLLSTLHVNGVLYHQIVLGGSLKVEALLEDYAFVIEALLRGYTHTKE
    THYLELAKKLSHEAEHKFYKEETWYLSDKAFRAKAVLEDNSYKSPLSTMIKNLFELAKIEDDTALSVRVKDMLESFGSGI
    QKYAHAYPEAVRAITLYMQRG

    >gi|268680062|ref|YP_003304493.1| DsbA oxidoreductase [Sulfurospirillum deleyianum DSM 6946]
    MKKQWILLSTLALFIGLYIAGSYLYTSANHTIPNEQQSSLYRSHAFVVGKEDAPITIVEFFDPACVTCKNFYPFVKEFLK
    KHPKELKLMLRYAPFHQDSSIVVAMIEASRLQNRYLETLEVIYRYQDQWVSQHTPNIARIWSFLPEAGVDIERLKEDMKK
    PEIEAIIAQDMADVKTLGIKATPEFFVNGKPLVKFGYKELQTLIESEL

    >gi|268680086|ref|YP_003304517.1| methionine-R-sulfoxide reductase [Sulfurospirillum deleyianum DSM 6946]
    MKLQALTPEEEHIIVQKGTEMPYSGEYNDFYEAGTYLCKRCLTPLYHSKDKFKSGCGWPSFDDEIESAVQREIDKDGRRI
    EVLCQACGAHLGHVFEGEGFTPKNTRH
    CVNSLSLMFIAEKN

    >gi|268680247|ref|YP_003304678.1| thioredoxin domain-containing protein [Sulfurospirillum deleyianum DSM 6946]
    MKKYIGFMVVLIGLLFIGCSSEPKNEVISVVKETYKEGEKVELKSVSGAKLTLVRKNGGFVIEEDEGKVILIDIFGTFCQ
    PCQEEAPSLMDFQLQNSEELMLVGLNFLEEVSDEYVIENFAAKYNAYYFISNSPKNKKLVETILQDIAYKQTLQVPFKVL
    LKEGAYQKVTDIYQNDPNNKFYIGKVSLDVIQKDLDKLVSK

    >gi|268680321|ref|YP_003304752.1| UBA/THIF-type NAD/FAD binding protein [Sulfurospirillum deleyianum DSM 6946]
    MQCLEFLRTHLIEGFLPLQTSFEAMKHFTCNFRDVEQCALENNILPLRYKRNQKTFSTQDQYTLFKAKVLIVGCGGLGGF
    VSEMLARIGVGELILCDGDVFEEHNLNRQNFSSIKTLGRNKAEVLKEKLEEINPALHVKTKTTFLRLPEERELLEKVDVI
    VDALDNPNLKCLLALCAQAINKPFVHAAIGGYYSQFATQTTLEHLYAQEGDGIETQLGNPSFTV
    CFAASIQSVEVVKLLL
    KKPHLTHFLMGDLWEYEMTHLSLR

    >gi|268680438|ref|YP_003304869.1| heavy metal translocating P-type ATPase [Sulfurospirillum deleyianum DSM 6946]
    MNTKRCDHCHLEYDTSLLLCDTHFNPPKFFCCKGCQGVYHLLHEEGLDTFYEKMGETTLEPPREHLEESSRFDLEGFVSK
    YVKKTSEGLSEISLIIEGIH
    CSACVWLNEKVLSRQAGVVEVSINYSNHKAKIVWDDSVIKLSRIIETIRSIGYNAYPYDP
    KGGEERANAQRREYYSKLLVGIFATMNVMWIAIAQYAGYFTGMQSNIKNILNFAEFVLATPTLFYTGSVYFKGAYYGLKN
    RYITMDFLVATGATLTYVFSLYAMFTKNAEVYFDSVTMIVTFVFAGKYLEVLSKKKAVDTLDAYGSSLPTEVMVVLGDEK
    ILKRVESVDVGDVIEIKAGDKVVIDGVILHGEGSFDMSRLSGESVPVLLRKGDKLLSGSLCLDSVIRYEAKQTFSSSMLT
    RMVTLLEDALSKKPLIEKFANQLSGYFSSTILFLALCTWVFWYVQEGSFEKALIVAISVIVIACPCALSLATPVATLVGL
    GLAAKRGVLFKEAGFLESMAKCDTLVLDKTGTITKGTPDVVEMKVLKEVDFSLIYALASASNHPMSQGVRRFVKEHETSL
    HVKSLEQVKSIEAKGLQAFCEGHFLMGGNAKMMQEAGIECVLEEQFHALSHYFFAVDGELVAIFGLKDSLKENAKSAIEA
    LKALGLEIVMLSGDHKSVTHVIAKEVGIAHFKAGLLPDEKADYIEALHKKGKKVVMAGDGINDTLALSKSEIAIAMGSGA
    DIALDVSDVILTNDSVKSLYDAFVISRMSLKVIKENLAFSLLYNIITIPLAMSGHIIPLFAALSMSLSSLIVVGNSMRIK
    MVLKRL

    >gi|268680441|ref|YP_003304872.1| Redoxin domain protein [Sulfurospirillum deleyianum DSM 6946]
    MATTKLQGTPVKLTGEEIKVGDSAPTIKVVAKDLSEIKVGGKSDKAQLIVVVPSLDTAVCAQETHTFNKKAASITDASVV
    VVSMDLPFAMGRFCTTEGIDNLSVGSDFREKAFAQAYGVLIKDGPLKGLSARAIFIVNKSGKVVYKEICPEITEEPNYEA
    ALCALEEATSKKRCGCSSK

    >gi|268680513|ref|YP_003304944.1| DsrE family protein [Sulfurospirillum deleyianum DSM 6946]
    MILFIFNNQPYDGGDKTYNALRLAKSLHVKGEKVKIFLMSDAVDMAREATQKPDFYDYDLVAMLKELFMDGIALGVCGTC
    MTRCGIHKNQPYFDENIKGTMGMLTEWSIEAEKILTF

    >gi|268680657|ref|YP_003305088.1| arsenate reductase-like protein [Sulfurospirillum deleyianum DSM 6946]
    MVKIYGITTCGSVKKALSFLKAKVIPYTFIDLKTTQISEAKLEEWLAKQPLSVLFNTKGTKFKTLGLSKEISDEEKKMWL
    LKEQLLFKRPIIECEDETLLVGFDEALYLRTFGG

    >gi|268680669|ref|YP_003305100.1| selenide, water dikinase [Sulfurospirillum deleyianum DSM 6946]
    MNNEAKLTKYVKAAGCAAKLGPGDLTEAIGGLNCTHEKVLVGMDESDDASVYYLDEGRALVQTVDIITPVVDDPFVYGQI
    AAANSLSDVFAMGGEVATAMNIVGFDGCHQPRSVLKEILAGGQSKVNECGGVIIGGHTIEAPEMTYGMSVTGFVHPLKIY
    RNNTPRVGDVLILTKPLGMGVLTTSIKADMLESSVVEKVASILATLNHKASRIMQKYDVSACTDITGFGLLGHAYEMSFH
    RVSIGFWLKEIPILEEAKAMADMGIIPAGAYNNKAYVSMYVDAKVPYKDEILLYDAQTSGGLLMAVSQKDAPKLLQELLD
    EGLSYSAIIAEVFEKEEKPLFYM

    >gi|268680708|ref|YP_003305139.1| multi-sensor signal transduction histidine kinase [Sulfurospirillum deleyianum DSM 6946]
    MKKQILWFVALLSSTLFAATDAQIVEHFKSTIQVPNITIEVISRKKVENIEGMDFVTLNLSDGTRSQKLSIFTKDDLIFP
    DVISIKQGGSIKEMMEMAELQKNLSTLYKKEDKKNIVSLGNDPKKETLVVFTDPE
    CPYCRQELMQIEQRLTTNNIKLIFT
    PVHARSSLEKSVLIYSETNKAKSDAEKIAILKKYFDETVSYEQKINDQEIGRIEALKQKYFGAGIKGVPFMVREKELLK

    >gi|268680742|ref|YP_003305173.1| Heavy metal transport/detoxification protein [Sulfurospirillum deleyianum DSM 6946]
    MRSIFMLLIASVLFAQEEVVILVASMHCPLCTTAVKKALKNVQGVESLKVTLQSKKAVIVAEEGIEDKVYLDAVKTTGYE
    GVIVSRTSIKAKN

    >gi|268680796|ref|YP_003305227.1| redox-active disulfide protein 2 [Sulfurospirillum deleyianum DSM 6946]
    MKIEILGTGCAKCASLYENTKKAVAQKGIFAQIEKVEDIVKIMEYGVTSTPALVVDGKVRSSGKLLSVEEILALV

    >gi|268680870|ref|YP_003305301.1| methylated-DNA/protein-cysteinemethyltransferase [Sulfurospirillum deleyianum DSM 6946]
    MVKCTFESPLGLLLAQANAQGIYALDFTCNTELYTQENGHIIQLRRELDAYFEGKLKRFLVPLVPMGTPFQRAVWEVLRT
    IPYGETISYSREAELLKHSKAVRAVANANGKNPIAILIP
    CHRVIAKDGSMGGYSSGVWRKEYLLNLEQQYR

    >gi|268680873|ref|YP_003305304.1| Peroxiredoxin [Sulfurospirillum deleyianum DSM 6946]
    MACDSNTVEAKASQPNTENQNSEMKVQEKKSMSSSLVLQKAPEFKMDAYDAKTGHYTSVSSEDYKGKWHVVCFYPADFTF
    V
    CPTEIAAMNAKYDEFQELGVEILAVSTDTKFSHKRFVETEPILAGLKLTIGADPTGTVSRAFGVMIEDEGIALRGRFLI
    NPEGVCVAQEVQAPMVGRNVNEFLRQVRAWQHASKTGEVCPAGWRPGKKTLPVATDVEKMTGRVGDYITIEEILS

    >gi|268680888|ref|YP_003305319.1| Rhodanese domain protein [Sulfurospirillum deleyianum DSM 6946]
    MKLRIFGASIVVAGLLLSGCTTTQPEVGATPSAKVLNAPTAHVKGLMEKFKLQDVDYAYVKAAVGNGTRSGAKALLIDAR
    PNPKYLGGTIPSSLNIPDTQIDKYIGQLDKVAKDKEIIVF
    CGGWDCEKSPIVAGHLKSKGFTNVKLYQAGEPEWKSKSYL
    EVGTPVAQSAFKNNSALLIDARPYAKTLAESIPGALYMNDDELPKLMGRFPVDKNTPIITFCAGYE
    CHKSHVVANKLLEL
    GYKKVSVYAGGLPAWKEAKLQTTRGAVKAEVKTDAAPKTAAMVDGVKLGIDEGTVDGEWYKAHIVAGTVPANVAIVDVRS
    PAEFTNGHIKGAINLEAGKMSATEFATKLPKGKVVVIN
    CASGGRAMEAQMKLKDAKMDVSRVLYFDANIKCDASNKCDIK
    VNEPLG

    >gi|268679966|ref|YP_003304397.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurospirillum deleyianum DSM 6946]
    MALIHSQTIPLGTALEHFELADPKGVRYSSQALYGKGGFLIAIMCNHCPYANAIWERFNAVAAFAKKLDITTVAINPNIH
    PNYPEDSPAHMLDKIEKLFIEYPYLIDEEQTVSKSLGAVCTPDLFLFDSAGKLYYHGRLDDNWRDEKSVQEEDLREAIML
    LFSKQEAPKIQHPSQGCSIKWKDTVTG