Sulfurimonas denitrificans DSM 1251 uid58185

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|78776213|ref|YP_392528.1| bifunctional methionine sulfoxide reductase B/A protein [Sulfurimonas denitrificans DSM 1251]
    MKYIFIFILILTTMNALEPLTKKIEQLSEEEKRVILHKGTERPFVGKYTDEKSHGIYTCKLCEAPLFDSSAKFDSRSGWP
    SFDDEIKGAIKRVPDADGRRVEIVCANCGAHLGHVFESEGYTPKNTRH
    CVNSISLNLVKKPQIKDENLSYAYFAGGCFWG
    VEYYLQKLGGVKEVTSGFMGGFVKNPSYYEVVRSNTGHLEAVEVIYDENKISYEEIARTFFEIHDPTQANGQGPDIGEQY
    LSVVFVQNDKEREIIENLISKLESNGYKVTTKIMKKSDFYPADESHQNYYDKKGSKPYCHGYIKRF

    >gi|78776333|ref|YP_392648.1| thiol peroxidase [Sulfurimonas denitrificans DSM 1251]
    MATTKFKGTDVQLLGNQVNVGDKAPQITVVNSDGLGDVVVGGAQGHKQLIIVVPSLDTGVCATETRNFNAKASSLNGVKP
    VIVSLDLPFAAGRFCSTEGITNLTVTSDFRNKEFANAYGVLLGGSVLAGVTCRAIFAVNEEGIVTYKEIVPEITEEPNYD
    AALAAVK

    >gi|78776350|ref|YP_392665.1| arsenate reductase [Sulfurimonas denitrificans DSM 1251]
    MQDITIWHNPKCSKSREAMAILEQNGCEVEVVKYLDSAPSKDEIITALTMLGMNPKELMRTKEDIYKELNLKDEYDYDKL
    VDAMVQNPKLIERPIIFKGNRAIIGRPSEIIEKFLKS

    >gi|78776366|ref|YP_392681.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sulfurimonas denitrificans DSM 1251]
    MSHMYNLAIIGAGPSGIATAVESYLLGVRDIIILEKDQNHNSTIRKYYKDNKRVDKDWKGQKVELEGKIYFVDGTKESTL
    DFFDEILNNHSVELRTHTEVQNIKKRDGYFEIFIAGESINAKYVVVTIGRMGKPNKPDYKIPQGVKDKVAFTLDN
    CGIGE
    KILVVGGGDSAIEYAIDLSAKNEVAICYRRETFRRANPTNQRDIANAIMHKEVEPILGVDINSLEDENGRVKVIFSEREA
    DIYDRVIYAIGGTTPSAFLASSGIKEEDGKPSHDENYETNIEGLFVAGDITQESGGSIALGLNHGYAIAKHIQEKKL

    >gi|78776367|ref|YP_392682.1| hypothetical protein Suden_0166 [Sulfurimonas denitrificans DSM 1251]
    MKNIILILLFSVFVFADGYRDFAESMSYETSYEVALKRAKEQKKNLMVLMVTNYCPWCSKFEKKTLMDADIDRAIKAKYI
    PLIINKEEKEFPSFLNVPVVPTTFFIEASTEKPFHQSVGFSNKIDFKNLLDALK

    >gi|78776467|ref|YP_392782.1| hypothetical protein Suden_0266 [Sulfurimonas denitrificans DSM 1251]
    MKKVIVSLVFCVSLLFSAEFYTYEEALEIQKTSSKIIMIDVVRDNCRYCILMDKLLEDREFSSWIAERFIPVKINIEHDK
    IDLKLDVKMTPTFYFLDKNQKILKMIPGSWSKEDFKDLTKNIKGE

    >gi|78776543|ref|YP_392858.1| thioredoxin-like [Sulfurimonas denitrificans DSM 1251]
    MQNIEDINRVIKENLAVMLYFSAPTCNVCHALKPKLLEAIENNFQEFEVVSIDTSIEQEIAANFSVFAIPTVLVFLDGRE
    FLRKSRHMSVDEVIREIKRPYEVMTS

    >gi|78776696|ref|YP_393011.1| hypothetical protein Suden_0496 [Sulfurimonas denitrificans DSM 1251]
    MRKFFIFLLMGILVNLMGSEIKWAKDYNEGIKSAQASSKPVLFVSSRHSCKYCVVLDETTFKDKRVIEELNKSFVSIISY
    SDENDYMPRELWQPGTPAIWFLYSKGEPMFQPLMGAIDPENFLKALAIVKEEFTKGKK

    >gi|78776701|ref|YP_393016.1| putative thioredoxin [Sulfurimonas denitrificans DSM 1251]
    MKNKLLNYSKEIFLFLIFITIFSNLLSLYRSNNLNQDSIDVNSFTLMDGSSYMLSENKPILLHFWATWCPTCKAEAGNIE
    TISKEFEVITIATKSGDNSNIQSYLKSRNLTFKVVNDNNGSLAEKFNISVFPTTIIYDKNREIFYSDVGYTTTFGLWLRM
    WLAK

    >gi|78776775|ref|YP_393090.1| copper-translocating P-type ATPase:heavy metal translocating P-type ATPase [Sulfurimonas denitrificans DSM 1251]
    MENLKLSSKVACSHCNIKFEESVMIKEVQSSSKESSASQTLIRYFCCSGCQGVFYLLQDKGLESFYEKSKDIELSLQNQN
    LKDSSSFDSQSFYDKFVKKNSDGFCEVSLVIEGIH
    CSACVWLNEKVLHNMDGVIEVNINFTNNKAIIVWADDIVKLSNII
    DTIRSIGYNAFAYDSSAQELHANKERKSYYLKMAVAIFASMNTMWIAVAQYAGYFSGITQDVKTILNIAEGVLATPVLFY
    SGWVFFRGAYYGYKNRVVNMDMLVATGATLTYMYSLYITIIQRGEAYFDSVSMIITFVLIGKFLEVLSKKNAADTLDKIA
    SSIPSEVKILKENRIVNVKLDDVGIGDIVIVSSGERVLLDGEIIKGGGSFDESNLTGESEPIYKSVGMSVISGTLSIDAD
    INFRASKDFKHSTLSNIVKLLESAINKKPKIQQMANRLSEHFSSVILALSVLTLFGWWFWTNNFETSLMIAISVIIIACP
    CALALATPVATLVGLGLGASRGVLFKEAAGLEIMAKTDTLVLDKTGTITVGKPEVVKEHILEEFDKKLLYSLVSSSKHPV
    AKGIANYLKNSEYICDIVFDEFAQLPALGIKAKLGKIELLGGNKKLLDENKIEIDFFTQGTLFYFAIDKQVVAIYELEDR
    VKDGVKEFVNRMHKMNIDVVMLTGDNENIAKRVAQKVGIKTIFYEQTPQSKAEYISTLSKNKKNVVMVGDGINDILALAS
    ADIGIVMGSGSDIAVEVGDVVLLNSSIKSLEEALKISRTTFGLIKQNLALSLIYNALTIPLAMAGYVIPLVAAISMSVSS
    LLVVGNSLRIKYKWNRG

    >gi|78776829|ref|YP_393144.1| thiol peroxidase [Sulfurimonas denitrificans DSM 1251]
    MQSTKFRGTKVTLVGDQIGVGDSAPIATAIGTDLNSVTIGGARDKIQLIVTVPSLDTDTCAAETRRFNEDVNNLDICETT
    VVSMDLPFASERFCTTSGIENLTVVSDYLDKSVSLAYGVLMDDNKLQGLSARAVFVVDRSGIIVYKEIVEEVTSEPNYEA
    ALEAIKLAR

    >gi|78776883|ref|YP_393198.1| methylated-DNA--(protein)-cysteine S-methyltransferase [Sulfurimonas denitrificans DSM 1251]
    MIKDSRIVSTPIGYMLAVASESALLYLDFIDEKVETQNSNNPILLKLEQELRDYFVKKLRTFSIPLSPSGTAFQRAVWDT
    LLKIPYGLTLSYADEAKLFGNPKATRAVANANGKNPISILIP
    CHRVISSDGSIGGYSGGGIWRKEFLLSLEGVEK

    >gi|78777018|ref|YP_393333.1| 4Fe-4S ferredoxin, iron-sulfur binding [Sulfurimonas denitrificans DSM 1251]
    MSKPEYARMKFYCDEDLCIDCNGCVVACKEAHEVPVGINRRKVVTINEGIVGKEMSMSMACMHCTDAPCQQVCPVDCFYI
    RADGIVLHDKDKCIGCGYCLFACPFGAPQFPQDGAFGTKGKMDKCTMCAGGPEETNSHEEFEKYGQNRISEGKVPMCASM
    CSTKALLVGDANEVAAIKTHRAVAHGKGISTQSYGW

    >gi|78777028|ref|YP_393343.1| putative inner membrane protein [Sulfurimonas denitrificans DSM 1251]
    MNFLEDVKKYLVSFWQPVPAVIALGVLSVYYFGITGTYWAVTGEFTRWGGHALQLFGVDISEWGYFKIMHMDGNIFTRVD
    GVMIIGMFAGVMAAALWGNNVKWRIPASKIRIYQALIGGIIAGFGARLGMG
    CNLASLFTGIPQFSAHAWFFTFAMIVGVY
    LGVKVTQLPFFQSKVKLQKLSCGIDVQSDKSRDEGKVKRFFTFGTFIFLAMVLWAMYLIFIANSQKLGAAMLFGGAFGLI
    IAKAQICFTSAFRDLFTTGRSQMARAIVIGMVVSSIGVFSYILLGTPPKIMWAGPNAIIGGVLFGFGIVVAGACECGWMY
    RAAEGQTHFWIVGIGNVIGATLLAFVWDDISVPLATSWPKINLLESFGNYGGLFFNYLLLFLLFLLVLKLEKNYLKKLKG
    NTNYGK

    >gi|78777042|ref|YP_393357.1| putative lipoprotein thiredoxin [Sulfurimonas denitrificans DSM 1251]
    MFKKSILTLSIIATLLFQGCSEDKTKKEVNTMISTSEYVLTDLNNKQHVVKKVDKGFILAGAEDKIVIFDIFATWCPPCR
    GAAQHLSSLQEKYKNDLIIIGITIEDNIQNEKLAEFAKTYNANYILVNSDQNRRLNSAIVKELELGDRYPIPTLAMYKNA
    KLINHYIGATEEEFIDSDIRITLGK

    >gi|78777060|ref|YP_393375.1| DSBA oxidoreductase [Sulfurimonas denitrificans DSM 1251]
    MFASNQGIKSLNVKVTNITEVQGHDDWYAYYVELDALLVKDKRQVVQKMVWFSDGKVITKEIFDIEKIKDMNELVSLPFE
    DKNYKKENLIYGNENAKHKVAIFSDPL
    CPFCKTFVPEALEYMKKRPNDFAVYYYHFPLESLHPAAVELVKAATALELQGK
    KDVVLNLYKVKVDPKEKSNDKILAEFNRVMGSNIKMFDLISKEVGEHLKSDLAVADSMMVNGTPTIFFDGVLDRTKMKYK
    EVK

    >gi|78777095|ref|YP_393410.1| hypothetical protein Suden_0897 [Sulfurimonas denitrificans DSM 1251]
    MSNRLQKEDSPYLQQHKDNPVDWYPWCDEAFKKAKDENKAIFISIGYSSCHWCHVMEENVFENQECADILNKHFISIKVD
    REERPDIDKHYQEVYMLLNRRAGGWPTSIFCTPHNKPFFAGTYIAPQTREGSIEGMGFIELTKLIADKISSNDEQLFKNA
    DEIENFLNNKEHPKEATVLKEDFVKNFMLQVKNNYETTYGGFSHSPKFPHVSTLGTLHVIDKLYDDKAAKAIFLHTLRMM
    KQGGMYDLVDGGFCRYSVDDKWLVPHFEKMLYDNALLCEIYTNAYLSYNDESFLHIAKECADFWHNFMSEDNLMYSASDA
    DSEGEEGTYFVYSYEEIYNLLRENNYSNIEVILDALSVTKNGNFEGKNIIRFIDEDGIEGFSEIKRLLQTLRSKREYPFI
    DKKIQTSWSSMMIKALFNLGKIDSSYTQRAINSLNALLDTMLIEGKLYHTTLIHKSPKVEAFLEDYAYLSLALIEAYNAT
    QNELYLIRAQHLTNIALEKFYDKGTWRFSVGEFETKAEISDNTYTSSVSIIVDVLLSLSTLLEDEKYNHFAFKTLEYNSY
    ELGRRPVIYPYMLRQMLRYLRGDRVVKSEQKNLESNALKIASLDYPFIFKKVSEDKGFMICGDKSCFANTDDVNSINDII
    GQTF

    >gi|78777096|ref|YP_393411.1| protein-disulfide reductase [Sulfurimonas denitrificans DSM 1251]
    MKKIILFLLSSIALLAVSPKFLMPDEAFAPSATLNEKTQLEARIELGKDIYLYEEAIKLELKNSDGIKIKDIVSPKSVEH
    HGDKVFLESPTFLITLSKDSHVSGIKNITLDLSFQGCSEQGLCYEPDTKSFTFDIDSSKLEVDKDNLSKIEIKTEAKVEK
    KELSESDSIADTIKDGSIALILATFLGFGLLLALTPCTFPMIPIISGIIISQGEGITTKKAFMLSLVYVLAMAAAYTIAG
    VLAGLFGSNLQASLQAPWAIYTFSAIFVALALSMFGFYELKLPDSFVAKISSNRSSNRNGYVGVAIMGFLSALIVGPCVA
    APLAGALVYIGQTGDALLGGAALFAMSIGMGLPLILVGVSAGKFMPRPGAWMTMVSAVFGVMMLGVAIWMLERVVDESII
    ALLSVMLGIGFATYFGAFDKEAHVFRRTISILVFIYSVSLFVGLMAGAVNMQKPLEFLKSSSNGSAQSVKSAHLDFKNVT
    TISELDLLLNKNIGKKIILDFSAEW
    CAVCKELDKKTFSDEAVKAKMSEFVLIRADVTQNSDEQKALSKKYGVFGPPVIIF
    FDKESNVISSKTVVGFIEADKFLQHLNNI

    >gi|78777360|ref|YP_393675.1| selenide water dikinase [Sulfurimonas denitrificans DSM 1251]
    MEEIKLTEYSHGAGCGCKISPMLLDEILKTDISSTLYPQLLVGNEHKDDAAAYDLGNGTSVLSTTDFFMPIVDDAFTFGR
    IAATNALSDIYAMGGKPLMAISIFGWPIEKLSSEVARQVIDGGRAACEDAGIPLAGGHSIDSPEPIFGLAVTGIVDNKNL
    MKNSSATDDCYIFITKSIGIGILTTAQKQKKIEDGDIDVAIEAMATLNRAGAIFATLDSVLTMTDVTGFGLLGHLSEVCE
    ASGISANIWFEKVPLLQNVEKYRAQGCIPGGSRKNFMSYGHKISQISDRQREILCDAQTSGGLLVFVKKSGLDEFYKSAK
    EFGLNLEPIGETTPRRKHVIEVL

    >gi|78777485|ref|YP_393800.1| rhodanese-like protein [Sulfurimonas denitrificans DSM 1251]
    MKKTIANCLFCAGLLFASSSLFAEEDAKMALINEAKKEAREITPLELKSMFENEESVVILDVRESEQRAEGYLFDDFVSV
    NTVSITRGNLEWEVLSKIQDKNNTIVTY
    CRNGGRGALAAQTLKRMGYKNAKNLKGGIQDWAKAGYSVKTGFGVTALTTK

    >gi|78777571|ref|YP_393886.1| rhodanese-like protein [Sulfurimonas denitrificans DSM 1251]
    MSIIKIDMNSPEFQEELQKTIKFTDKVNHQFGWVYNPQEEVNEGVQMGLARNKMMYGKRFCPCFMVEVVDEKPRSVDDRI
    CPCKPAIEQEIPEDGVCHCGIYCTPEYAANKRAEMGMEEAVHTHSRGLTKEEATLLLNQRELDGDEVVSLLEARELGMVT
    FTLVDVREHMEWQMGHIKGANKLVPTSSFFAALDDAKLNKEENIILY
    CHVGSRSAHCARILSDMGYTKIGNLTYGIVSYG
    GEIER

    >gi|78777641|ref|YP_393956.1| hypothetical protein Suden_1444 [Sulfurimonas denitrificans DSM 1251]
    MKFLLSIVMLIATLSANFNWPSDYEAALSQAKAQKKDVYLFLGSEYCKYCEKFENEILSREDVLKKLKKKYVLIYLSRDI
    DDIPSHLETKPVPRHYFLNYKGEIIYTTIGYRSFEGFNELLNEVDEAKKD

    >gi|78777695|ref|YP_394010.1| rhodanese-like domain-containing protein [Sulfurimonas denitrificans DSM 1251]
    MENNYLKKILISFLLLSASLLATVINEEASQQLIDSKTPIVDIRTPAEWKETGLLKGSIPIMLFDEKGNYDLKDFIDKLN
    NAVDTKKQFAII
    CRTGSRTRVLAPFLSQKLNYDVINIKSGILYAKFIKLPIEPYSAK

    >gi|78777780|ref|YP_394095.1| hypothetical protein Suden_1583 [Sulfurimonas denitrificans DSM 1251]
    MRLSFILMIFASLLFGEHIRWQSDFEKTLIEAKKEQKDILLLVLKRDCKDCKNIFRDIFTDKEVTKRVNDKYISIVVFFE
    AKDSYPVELFYTQQFPALFFVSRKDELFLNAPLFGAFTKESLLNSL

    >gi|78777972|ref|YP_394287.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurimonas denitrificans DSM 1251]
    MLVTNQAPDFSATAVLADGSIVENFKLSENFGKKGTVLFFYPLDFTFVCPSEIIAFSHRIEEFKSRDVNVIGVSVDSQFS
    HFAWRETPVNSGGIGRIKYPLVADLTKQISRDYDVLFGESVALRGSFLIDGKGVVRHAVINDLPLGRNIDEMIRMVDAMQ
    FTDEHGEVCAAGWQKGDEGMKASTEGVAEYLSKHENNL

    >gi|78777997|ref|YP_394312.1| Alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurimonas denitrificans DSM 1251]
    MVQIDNIAPDFCLPNQDDVEICLRDLRGKWVVLYFYPKDNTPGCTTEACDFSEAAPDFSSINAIIIGVSADSTAKHRDFI
    EKKDLSITLLSDESGAMLKEYGIWQLKKNYGKEYMGIVRSTLIINPEGVIKAIWKNVKVKEHVRAVEEKLKLLQG

    >gi|78778053|ref|YP_394368.1| alkylhydroperoxidase AhpD core [Sulfurimonas denitrificans DSM 1251]
    MAHIKLPEFEEMTPAIQERARPILEKTGKLGEIFKLMAMDEKIYFATDMMIQKYLLDETTLSYDTKEAIALLVSKENGCK
    M
    CVDVHKGIAKMLGLSDEKIEKILEGVDAIDTDAKEKALLNFCLRAAQKDSYKMLKEDIDAIRDLGYSDAQILEAVAITG
    YFNYINTLSNVFGLGQ

    >gi|78778061|ref|YP_394376.1| thioredoxin [Sulfurimonas denitrificans DSM 1251]
    MGKYIELTSSDFEATLSKGVSLVDFWAPWCGPCRMIAPVIEELANDYDGKAKICKVNTDEEQDIAVKFGIRSIPTIMFFK
    DGKMVDQVVGAQSKAALAQKIDALLA

    >gi|78778063|ref|YP_394378.1| thioredoxin reductase [Sulfurimonas denitrificans DSM 1251]
    MILDCAIIGGGPAGLTAGLYATRGGLENVVMFEKGMPGGQITQSSEIENYPGVTGEISGMDLMIPWPAQCQKFGLKHEMV
    AVLRVSKDGDIFKILKEDGTVAEAHSVIVCTGSSPRRAGFKGENALFGKGVST
    CATCDGFFYKGKEVVVIGGGDTALEEA
    LYLAKICSKVYLVHRRDTFRSAPNTVERVKRTQNIELVLNSSPQEVYGDEMGVTGIFIKNNNGEIRDIKVPGVFTFVGND
    VNNQTLKQKDGTFLCEMNKQGEVIVDISMQTSIKGLFAAGDMRVAAPKQVVSAAGDGAVAALKAISYVDELLNH

    >gi|78778094|ref|YP_394409.1| hypothetical protein Suden_1900 [Sulfurimonas denitrificans DSM 1251]
    MKFLTSLFLSFLTLFGADNLLWLNDYEVAIKQAKEQNKGVYLFVGADDCRWCDRFKETTLSKDEVISKLKEEYILLYMSR
    DKHNIPKHFEVKGVPRHYFLTKDGKIIHADRGSREPDGFFALLDEVELKN

    >gi|78778140|ref|YP_394455.1| AraC family transcriptional regulator [Sulfurimonas denitrificans DSM 1251]
    MDEISLLHDNYKQIEKAIKYIDENFKEHPSIDEVAKNIGMSKFHFIRVFKEYVGVTPKQFLHSVTLNYAKEHIKESKSIL
    DSSLDIGLSSSSRLHELFVNLIGVTPKEWREKGKDVLITYGYGQTPFGEALIGFTDKGVCYLGFIDENKNEIFKRFNELW
    ENANLHFDEKAAREYLENIFIKNKKYSLFVKGTNLQVNVWKALLNLPNGVVATYQDIANYLEKPKATRAVASAIGKNHIG
    YLIP
    CHRVIAKSGAMSGYRWGIERKKILIACESIQNNQLSNK

    >gi|78778293|ref|YP_394608.1| thioredoxin [Sulfurimonas denitrificans DSM 1251]
    MRVVCPYCKSVNNVPQKDSYTKANCGKCKESLLDTKPIELTTLNFDEVIVNSDIPVVVDFWAPWCGPCKMMAPNFQKSAM
    NFPLKALFVKVNTENEQNLGARFGIRSIPTIIVFKNAKEVHRVSGALDESALNRLVAQFI