Sulfurimonas autotrophica DSM 16294 uid53043

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|307719959|ref|YP_003891099.1| hypothetical protein Saut_0038 [Sulfurimonas autotrophica DSM 16294]
    MRKLLLIALLATLSFAQSYKDFARDYGYETVYSVAFAKAKKEKKPILMVQVTNYCPWCRKLEKKVLAKEKINTDIHKRFI
    PLIVNREEAVLPKRFTTPIVPVTYIIDYKDDTKFTKIMGYKNKKDFAHLIK

    >gi|307720022|ref|YP_003891162.1| thiol peroxidase (atypical 2-Cys peroxiredoxin) [Sulfurimonas autotrophica DSM 16294]
    MATTKFKGTDVELLGNEVNVGDKAPEVNVVNSEGLGDVKVGGAQGEKQLIIVVPSLDTGVCATETRNFNAKASELDGVKT
    VVVSMDLPFAAGRFCSAEGIDKLTVASDFRNKDFANAYGVLLGGSPLAGVTARAIFVIDANGVVTYKEIVPEITEEPQYD
    AAIEAAKK

    >gi|307720041|ref|YP_003891181.1| peptide methionine sulfoxide reductase [Sulfurimonas autotrophica DSM 16294]
    MKKERIVLGGGCFWCIEAVYRNVKGVISAVSGYAGGARANPSYENVCSGATGHAEIVDITYDVDVITLSEILDIFFEIHN
    PTTLNAQGADKGTQYRSVIYYADEEQKKVIEDSIAKHQQKFSDKIVTEVSPLPEVYPAEHYHQNYYNLNSSQGYCQVVIA
    PKLQKFMTKFPDKLA

    >gi|307720168|ref|YP_003891308.1| selenophosphate synthase [Sulfurimonas autotrophica DSM 16294]
    MKDIKLTQYSHGAGCGCKISPKLLDSILKSSRETIQYPELLVGNSSKDDAAAFDLGNGTSVLSTTDFFMPIVDDPFTFGR
    IAATNAISDIYAMGGKPLMAISIFGWPINKLDANVAREVIDGGRSVCEEAGIPLAGGHSIDSPEPIFGLAVTGIANNEHI
    KRNNTAEADCELFLTKPLGIGILTTAQKQGKISEGDIDIAIEAMCTLNKIGAEISQLEGVTALTDVTGFGLLGHLSEICE
    GSGISAVVEFEKVPTLKNVKKYLEMGCVPGGTRRNFESYGEKISPMTTEQQDILCDAQTSGGLLCAVRKDALDDFLSITK
    NAGLTLESIGKTTAPSKYLVEVL

    >gi|307720228|ref|YP_003891368.1| Thioredoxin domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MNTIKNIEQTIKENLAVMLYFSAPTCNVCHALKPKLLEAIDKNFKEFTVISIDTSIEQEIAAHFSVFAIPTILVFLDGKE
    FLRKSRHMSVDEVVREIKRPYEIMMS

    >gi|307720315|ref|YP_003891455.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurimonas autotrophica DSM 16294]
    MIEVGDKAPDFCLPNQDDVEMCLRDLKGKWIVLYFYPRDNTPGCTTEACEFTEAAPDFSSLDAVILGVSADTTKKHRNFI
    EKHDLGITLLSDESTDMMQKYGVWQLKKNYGKEYMGIVRSTFIIDPQGIVRAKWEKVRVKGHIETVKEKLEELQN

    >gi|307720351|ref|YP_003891491.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurimonas autotrophica DSM 16294]
    MLVTNPAPDFTATAVLADGSIVEDFTLSENYGEKGTVVFFYPLDFTFVCPSEIIAFSHRYEEFQKRGVNVVGISVDSQFS
    HFAWRETPVSEGGIGRINFPLVADLTKDIARDFDVLLNNAVALRGSFLIDDKGIVRHAVVNDLPLGRNVDEMLRMIDAQQ
    FTDEFGEVCPAGWQKGDEGMKADTEGVAEYLAKHESEL

    >gi|307720353|ref|YP_003891493.1| redox-active disulfide protein 2 [Sulfurimonas autotrophica DSM 16294]
    MKIEILGTGCTKCKTLEEVVKQAVAKSGKFVQIEKVDDIMKIMEYNVVSTPGLVIDGQVVSTGKVLTVDEVLKLING

    >gi|307720385|ref|YP_003891525.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Sulfurimonas autotrophica DSM 16294]
    MKIHYDLIVIGAGPAGTPAAMTAAQFGAKVLLVDKRDAPGGECLFEGCIPSKVLENAANNYWRVISSKKFHIQNTNTAQI
    HWEAVIQDKDEILKKRSQGAMQVIKKLPTLDFKQGTAKFTDAHTLNIDGEFFSFDKALIATGGKTTIPPLKGNGVDKIWT
    NKDVFFEKELPKELLFIGAGAISCELTQMFNKLGVKCHILERSERILRHLPSEAALTVQNKMIENGVTVDLHVDLQKIDY
    ENDKFIVTFMQEGKERILECKHVLMATGRGANVDGLELENANVEYNKGGVVVNKQLQSSQAHIYACGDCVPGPKFAHTAT
    YEAGIVVHNMFAPSSHFVNYDKNSWVLFSDPQIGIAGINEQQAHERGLDVDIATYDYSQDARSQIDKSTEGFVKFIIDKK
    SKVIIGIEIVSEDAASLLGEAALIVANEMNSMDIMKAIHPHPTLTESFGKLAQQIFFKSMMQRNR

    >gi|307720407|ref|YP_003891547.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Sulfurimonas autotrophica DSM 16294]
    MYDIIFIGGGLNYAGAIVAAKNGKKVALIEKDMKQLGGVCLHKGCIPSKMFLHYANVVYESKSDILEGEAVLCMQKLFHK
    KTNLIENAWHAITKQCSHVDLIEGEAKLKEPHKVEINGEILEAEHIVMGTGSHSFVPEGIEYNTKDIIVSDEVLMMQELP
    KKIAIYGVGAIGLEMASFFATAGVEVTLINHSGKILKQSNPLIQKEIKNQLEKIGVKILENHGIKTAKSTKKGVHITFED
    KSSIYIPVLLVAAGRRPNVDFLTCKDIKVEKGIVTDRFFETTLAKHYAIGDCNGKLQLAHAARAEVLNVTERILGKNPRP
    LNLDHVVKFIHILPMSYAVVGKTDGEKSGVVPLSQFPYSAYNHASAGLMISYTDNNGFIVGAEILAPNAEELAAIVGMSL
    AGEMDAAQAKRTIFGHPTFSEALERTFYKL

    >gi|307720416|ref|YP_003891556.1| Rhodanese domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MKSKVEEFDKYLRSFDYQERKDMKIKRDELFERYAKGELQIIDIRFNEEYEAWHIGFGDHIPLNELPDRLDEIDKSKTIV
    TM
    CPHYDRAEIARLYLKLQGFDAKYLTDGMLGLVEGLRGDKARDYMKKLKD

    >gi|307720418|ref|YP_003891558.1| hypothetical protein Saut_0497 [Sulfurimonas autotrophica DSM 16294]
    MNELARKIVPSEMNNMRIEIEDFVSLYNEGKCELVDVRVPFETAVWQVNFGLKIPANELPERLNELPKDKLIVVACPKTD
    RSNMARTYLASEGFEVKYLVGGLLGLMDALKGGKAKGIKL

    >gi|307720475|ref|YP_003891615.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Sulfurimonas autotrophica DSM 16294]
    MKEYDVVIIGAGPGGYETALKVAASGKKTLLIDRAKENIGGICLNVGCIPTKNYLESAVFLSRVPYFQECGALLQNNGFD
    IQKLREKTLALVKEIRSGVVWMLDQAKVELLYGNATFINADTIEVSGEKVSFNKCVIATGSYARELSNLSFDSKHILSST
    DIFKLQKLPKSIAIVGGGPIACEFATFFNALGVEVTMIVRGTQLLSKEDEDISKALLRAFKKRNINVLLSTTVLKSEVGN
    KSIKLLLGSQENIESEIVLNASGRIPNTNKLNLENADITLDEKGFIKVSASFETSQENIYAIGDCINTPALAHIAYAEAR
    ITAHNILNNTKTTNSHITPMAVFSNPPIASCGLNQTKAKEKGIDTNVKKVYFKVNAKAKIHGDDAGFIKIITNAKNGVIL
    GASIIGVEATEIIHEIVVAVEEQLTMKEVEEIIHIHPSVSEIIRY

    >gi|307720529|ref|YP_003891669.1| Thioredoxin domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MPFIDVDEDNFDAVLAREFEKEKFVILKFGSHYCDACQVMEMELEELCDRLTNVSVLSIDSGVCEYLSQRFFIEEVPTTV
    IFKEAEKQLFYRTGVTLADDMIDVILKEC

    >gi|307720674|ref|YP_003891814.1| hypothetical protein Saut_0753 [Sulfurimonas autotrophica DSM 16294]
    MKFILMLFLLSEMIFGAELKWPCDYSKALLTAKKEHKLVYVLIVSDTCRWCEKFENTTLQNKKIKERVNQEFVTVLLSRD
    RHFIPKGFKVSPVPRHYFVDAEGNILYSSLGYRDEELFDSFMDNAQENYIKLKDQNDETSTNK

    >gi|307720798|ref|YP_003891938.1| Rhodanese domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MSMIKIDMNSPEFQAELEKTIKFTDKVNAQFGWVYNPQEDVNEGVQMGLARNKMMYKKRFCPCFMVDTTGEKPKSVDDRV
    CPCKPAIEKEIPQDGVCHCGIFCTPEYAEKKRVELGMEEVSHTHSRGLTKEECELLVNKNELDGDELVSLLEARELGMVN
    FKLVDVREYMEWQMGHIKGADKLVPTSSFFQTWEEAKIGKDENIILY
    CHVGSRSAHVARILTDNGYTKIGNLTNGIVSYS
    GEIER

    >gi|307720829|ref|YP_003891969.1| DSBA oxidoreductase [Sulfurimonas autotrophica DSM 16294]
    MSLMLKLLSMTLLLSSFVYASTASEKIEDFLEDKFSENPKLKSADVQVEEVRALKQLPKWNAYIIDVQAVLKNKPKQLIK
    QKMIWFSNGEMITKDLTDINTGESLVERVKPKVKPEHYAKNHLIYGSTDARHKVVIFSDPL
    CPFCKGFVPGAIKNMKKEP
    QKFAIYYYHFPLARIHPASVTLVKAAVAAEHKGTKDVILKLYNVKINPREKNAQKILDAFNKAEGTHITLKDINTPAVIK
    QLNHDKLVANDLMVGGTPTVYLDGSVDNTKKKYLKVK

    >gi|307720893|ref|YP_003892033.1| hypothetical protein Saut_0972 [Sulfurimonas autotrophica DSM 16294]
    MSNRLANEDSPYLQQHKDNPVDWWPWCDEAFERAETENKAIFISIGYSSCHWCHVMEEKVFEDKECAQILNESFICIKVD
    REERPDIDKYYQEVHMLLNRRAGGWPTSIFCTPQNKPFFAGTYIPPESNAGSIEGMGFKELTRLIATKIKEMDPKLFENA
    DEIEGFLNHKDHPKEATVLKEDFYKNLLLQAKNNYDTRNGGFSDKPKFPHSSTLTALMVIDRLYNDASAKAMTTNTLEHM
    IKGGIYDLVDGGFCRYSVDEKWLVPHFEKMLYDNALLCGVYTEAYLTYEDEKYLHTAKEVADFWYNFMSEDDLFYSASDA
    DSDGKEGTYFVYTYDEVYTVLTQNGYENAKEMCQEMSVTHHGNFEGKNIIRFEDEIPEWFNDIKPLLQKIRQKRSYPFID
    KKVQTSWSGMMINSLFKLGAIDRKYKEKAIKTLNKLLDTLFIDGKLYHTTLIHKKPKVEAFLEDYAFLSQALLSAFKYTQ
    NEVYLIHAQRFVNKALEEFYDKGVWNFSSGEFAVKAEITDTTYTSSVSIMINALITLGTLLEDEKYRHFAFKTMEYNSYE
    LGRRPIYYPYMLTQALRYVKGDRIIKTNEQNINNYAYALAKIKYPFVEFKKSEDDDFMICGDKSCFANTQDLHQINKLIE
    QSL

    >gi|307720908|ref|YP_003892048.1| cytochrome c biogenesis protein transmembrane region [Sulfurimonas autotrophica DSM 16294]
    MKFLLKIFFAFALGLGLLNAADFLMPDQAFKPYAKVNDEIQIEAGVTIAKDIYLYEDKLKIELVDAKGLSIENIQKPATT
    KHSGDNVYLKSPNFIVTLQKDASVSGLQDVKLKISYQGCSEQGLCYEPSSKIFNLKIDTSKFSANTAKSVEKTAEKNVKS
    ETDSIADTIKSSSFLVVLATFFGFGVLLSLTPCVFPMIPIISGVIISQGEGLTTRKAFALSLVYVLAMAIAYTIAGVLAG
    LFGSNLQAALQTPWVVYSFAGVFVALAASMFGFYELKLPDALVTKVSSNSNRNGFAGVAIMGFLSALIVGPCVAAPLAGA
    LVYIGQTGDALLGGAALFSMSIGMGILLILVGVSAGKFMPKPGPWMVMVNEIFGALMLGVAIWMLEKVLPSSITILMYAI
    VGLGFSVHFGAFDKEGHSFKRTVSLMLFIYSLALFISVLAGAPSIKQPLGFLKSQAAGTVFSANEKKLTFTKVTSLEELN
    ALLQKNKGKKIMLDFAADW
    CTACKELEEVTFADPNIREKLSEFVLIRADVTANGAKEKALSKAYGVFGPPVILFFDKDLH
    VKKSKTIVGFIEPQEFLAHLNAL

    >gi|307720919|ref|YP_003892059.1| hypothetical protein Saut_0998 [Sulfurimonas autotrophica DSM 16294]
    MNNLFLLLVLSITSLWGVEFHSYEEALKLQKKNNKIIMIDVMRSDCHYCIKMKKEVFDNPEMSAWIQKRFIPVELNLDFD
    ELPLNLHVYFTPTFFFVDQNQKVIKKIPGSWNIQDFKDLTKNIK

    >gi|307721203|ref|YP_003892343.1| Rhodanese domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MNHNEQMKEYYKRCDIGLIKGHLKELLTKAKEEIKQIKVEDIDLENMVLIDVREADEFASGVIPAKSIFTIPRGKIEFAV
    DDKLVNLSDHQIVCY
    CLKGARGLMAAKTLKDLGFSNVVNLEGGIESWVNAGKEIKNYLGYFTLCTNTTFK

    >gi|307721250|ref|YP_003892390.1| hypothetical protein Saut_1330 [Sulfurimonas autotrophica DSM 16294]
    MKLLFLFYMIFTTLLYANNIKNALQYETSPYLKQHENNPVRWYVWNEKTLLKVKKEHKPIFLSIGYSTCHWCHVMAKESF
    ENKKIAKLLNDNFISIKVDREEMPHIDALYQNIYYHVNKRTGGWPLSVFMTPQREVFYITGYIPPQKEFYSEGFSNLIIR
    LSKLYKNKKALKEKIDEIQKDVTSAVKISNPGDENVSLSTLKKSLKKSFDDIYIGFGTGKKFPEASKLSLMMDLAAITQD
    KKLQKQSFEMLDIMALRGLYDHIGGGFFRYSVDVNWEIPHFEKMLYNQAELIPLYLRGYTLRHKKLYKSVVQETILMTQK
    RFLKNNLYWSASNADSQGKEGEFFTFTTQEVKQALKNNPYAAEIEDAMGLGIEGNFEDKVHVNFYNDDRPRGFEAFKNNL
    EKIRQKKEYPFIDKKINTAWNAMMIEALYKASVIDKRYAKTADKNLQALKNLMFRQGELYHQTLLGIKPKQKGLLEDYSF
    FISALIAGYEVDYDIQKLDFAEYLLNLAKSKFYKNGVWYLSNDGLHVKAGFNDKYYTSPLSKILQNILKLAALKASFVYE
    KFARKTIENIKPELAVKQANAPALAKAYLMQELGVVTLKSSKKNLINNQQRILQIKYPYLLSKAVAYENYLVCTIRQCFI
    EDISIQKVINFIDTDMRKQYN

    >gi|307721285|ref|YP_003892425.1| arsenate reductase-like protein [Sulfurimonas autotrophica DSM 16294]
    MIKVYGIKNCDSVKKALSFFKKHNVEYELFDFKTQELPCEKIQDWVSKVSIKPLFNARSTTYRNLKLKELNLNEVQQQEW
    LCKENLLIKRPVIEYNDNVIVGFNEEQYQRSFS

    >gi|307721357|ref|YP_003892497.1| Redoxin domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MRKIPLLTTLLTIGLLFGACSKEKESTTQEANSLLATNKIVLTSLNNKQFVVEKTDTGLKLKDAKDKVVIYDIFATWCPP
    CQAEASHLASLQKKYKDKLIVLGVTVENNIPNEKLEEFAKQHHADYTLVNSSANMRLIDKIAKQLHLGKDFGIPLMVLYK
    DGKIINYYQGATEEEFIESDIKKALDL

    >gi|307721453|ref|YP_003892593.1| rhodanese-like domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MKKIIFMLMVLAVTLFAEVQDEYISKELLKQNIPIVDIRTPGEWKETGLLKDAIPIMFWDAKGNYDARKFLNELNKKVDT
    TKPFALI
    CHTGSRTSMVAPWLAKEFGYKVINLKGGMEYATKGLHVKTVPYKK

    >gi|307721491|ref|YP_003892631.1| heavy metal translocating P-type ATPase [Sulfurimonas autotrophica DSM 16294]
    MQKTEIWGSLKLSDKIACDHCHLEFSKDVMIKEDEHYFCCNGCQGVFHLLSNEGLDGFYDKLGNNKLAPPSKQYEDSSNF
    DSPAFYERFVILNKDAFSEVSLVIEGIH
    CAACVWLNEKALTNMEGVIATNINYTNNKAKIVWDDDTVKLSKIIDMIRAIG
    YDAYPYDASLQEQKADKERKEYYTRMAVAVFATMNMMTIMVAQYAGYFSGISENIKHILNIGEWVLATPVLFYSGWPFIR
    GMYYGIKTKTVNMDTLVATGAILTYIYSIYITITRSGEAYFDSVTMIITFVLVGKFLEVLSKKSIADTLDIMNHHLPNDV
    KVVVDKKIITKNVNDVNAGEIVILNSGERVALDGEIKEGSGSFDESSLTGESEPIFKNVGENIISGTVSIDADVKYRVTK
    DFAHSTMSNIVALLENAMNNKPKIQQLANKLSEYFSEVILALSFITFIGWYIYSSNFEQSFMICIAVIVIACPCALALAT
    PVATLVGLSIASKRGILFKEAAQLETMANADVLLLDKTGTITKGRPEVVKEEIFLPFHKSLLYALLLNSKHPVAKGVEQY
    IFDEDLDPLELESFQNIPSQGLSAMYDGKMLAGGNAKLMKAIGVDVSSLSKNSEFYFAYGGELLAKYELFDMPREDAKEA
    IEKIKKMGIKIIMLTGDHEKSAKKVAQIVGIEKYEYGLTPQDKAVFIEKLHENGKVSVMAGDGVNDILALANSDIAIAMG
    NGSDIAIEVSDVVLLNDTFSSLHDSFKISKKTFTMIKENLALSFIYNGITIPLAMAGYIIPLIAAISMSISSLIVVGNSM
    RIKFGYKD

    >gi|307721532|ref|YP_003892672.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sulfurimonas autotrophica DSM 16294]
    MKSKIKHYMKEIIFFFVLMTILANAISFYKSQDLSQKPLAIQSFKLINYQEYKIPDKKPVLIHFWATWCPTCKLEASNIN
    FLAKHFEVVTIAVKSGGDDSVKKYINEHNYTFKVVNDKNGKLSSQFHIAGFPTTFIYGKNKKLLFSDVGYTSTLSLYLKM
    WWASL

    >gi|307721545|ref|YP_003892685.1| hypothetical protein Saut_1626 [Sulfurimonas autotrophica DSM 16294]
    MGKLLLIIVFLLTTSLMADEVHWAKDFTSGIEQATKENKPVLFVFSRHTCKYCVILEKTTFSDSRVIKELNNDFVSIIAY
    SDEGDAMPQELWRPGTPTIWFLMPNGQPMFQPLMGAVKENAFLQALDIVKKEFSEINKKKSGK

    >gi|307721612|ref|YP_003892752.1| methionine-R-sulfoxide reductase [Sulfurimonas autotrophica DSM 16294]
    MKVTKSEDEWEKELSPEAFYICRQHGTEAPFSGKFYDNKKDGTYKCICCGAPLFESTTKFDSGTGWPSYYEAIEGAVTEI
    KDMSHGMIRTEVRCSSCDAHLGHLFPDGPEPTGMRY
    CINSVCLNFKEEE

    >gi|307721729|ref|YP_003892869.1| thioredoxin [Sulfurimonas autotrophica DSM 16294]
    MGKYIELTGANFEETLAEGVSLVDFWAPWCGPCRMIAPVVEELAEDYDGKAKICKVNTDEEQDIAVKFGIRSIPTIMFFK
    NGEMVDQIVGAQSKQALAEKLDALLA

    >gi|307721731|ref|YP_003892871.1| thioredoxin reductase [Sulfurimonas autotrophica DSM 16294]
    MILDCAIIGGGPAGLTAGLYTTRGGLENVTMFERGMPGGQITQSSEIENYPGVTGDITGMDLMMPWPEQCQKFGLKHDMA
    EVSRISKDGDIFTVTKSDATTIEAHSVIVCTGSSPRRAGFKGEDIFFGKGVST
    CATCDGFFYKGKEVAVIGGGDTALEEA
    LYLAKICSKVYLVHRRDSFRAAPNTVKRVKENEKIELILNSVPEEVYGDASGVNGLKVKDKDENIRDITVPGVFTFVGND
    VNNQTLIQEDGSFLCDVNEQGQVVVTLSMKTSVPGLYAAGDMRIEAPKQVVSAAGDGAVAALSAISYVDELLG

    >gi|307721812|ref|YP_003892952.1| Rhodanese domain-containing protein [Sulfurimonas autotrophica DSM 16294]
    MKNTLTKLFIVGALVVSSSLIAKPLSKMDLINQAKKEVGEVTPKKLKSMLDEGEDVIVLDVRESEQHAEGSIPFDDFNKE
    NFRAVTRGNLEWKINKIIPDKDAYVVTY
    CRRGGRGALAAQVMKEMGYTHVTTLKGGLKGWAKAGYPVKTGLGNVVLKKQK


    >gi|307721813|ref|YP_003892953.1| DsrE family protein [Sulfurimonas autotrophica DSM 16294]
    MTTIILNHQPYDGTDVTWNALRLAKTLFKSGESVNIFLMNDAVDLAREKTPKPNNYDYDLVEMLKIMYSDGINLQVCGTC
    NARCGLFKNEPYFDASISSTMPILADWVIKSDKVISF

    >gi|307721814|ref|YP_003892954.1| Protein-disulfide reductase [Sulfurimonas autotrophica DSM 16294]
    MKKTDNIKIMLLLLVAVVPLFAADENISSMNIISILSGAFAAGILLTFTPCVLPMIPILSSVIAGEGKKISKIKALQLSF
    AYVLGTAITYAAMGALAGATGEQLQSYFQNVWAISILSMIFVLMALAMFGVFTLQLPSSLQTRLDSTAHNFKGGKFFAVF
    LLGLVSALVLGACVSPVLISFLSVAIATSNPLLGAQTMFSLALGMGIPLLLMGMGMGYVLPKAGAWMDDVKYFFGALLLG
    VAIAIFSELQLISSLFLWGLYFIGIAFYMGALNFYKEESSNWQKFQRMIAVFLFIWGTITLVGAAKGNSNLYLPLQGKSA
    VLLPTEQNTLTKKSELPFEKISNLQEFTTKKEYALQQHKPIVIYFHAEH
    CKVCEKLKNTTLKDPKIRKILQSSYVALMVD
    MTNKSDAGANTIKKKLKVFGPPAFVIIDADGTVQEDEIAYGYQSAHNLFDMLDMNAE

    >gi|307721817|ref|YP_003892957.1| Methyltransferase type 11 [Sulfurimonas autotrophica DSM 16294]
    MADNKQIIELYTKLAQNPTKDFGWDKGLDNAKAHGYKQEWIDATPPEVWEYCAAVGNPFTYADIQEGDTVLDLGCGAGVD
    LMVSRLHVGKSGRVIGVDITPKMVETAQEHAKLAGFTNVEILENSFEAIALEDESVDVVISNGAINLTACKESVFTEIYR
    VLKPKGKISFADMIDISKEAECCNIEQNSCCASAGEEDWAN
    CVAGTMRESELIELIQKASFENVTCTGMTHYTTSETTQG
    ATFFATKIPAEKFRNSHWENIFQTKDYTQVLWHQNSPKKSLDFIRSFAKTDATIIDAGCGASLIVDNLLELGYKDITLLD
    TASTSLELVKKRINNLHVKYVCDDILTFETQKKFDIWHDRAVFHFLLSKKERQRYFEVLSNSLKENATAIIATFKVNGEI
    QCAGLDIIAYDYKKMLEELPKSLELIESEEYTHITPKESEQKYIYFIIKKRSQ

    >gi|307721821|ref|YP_003892961.1| hypothetical protein Saut_1906 [Sulfurimonas autotrophica DSM 16294]
    MKTFILTLILASCLFGFETDKWLHDYDKALKIAQKEHKNIYLFIGADECHFCKRFKEKTLSKKKVMGRLHQDYILIYLSR
    DRHFIPKKFQKFGVPRHYFLNKNGEILFESFGVLEPAGFFTLLDEADLNADN

    >gi|307721908|ref|YP_003893048.1| hypothetical protein Saut_1993 [Sulfurimonas autotrophica DSM 16294]
    MIRRMPWWLAGILMALLVLFTFSTFGANRPFGASTYVPYFAGILFDLSPEKYPYLKEVHFAGAWEGVMLLGALTGGFLTS
    VFVTKSFRLSIMPTGWKKYKNSSVISRLVWSFVSGFFLIIGARLAGG
    CTSGHFLSGMAQTAVSSMIFGGVVLLSVIITGK
    IFYKSEANDV

    >gi|307721943|ref|YP_003893083.1| arsenate reductase [Sulfurimonas autotrophica DSM 16294]
    MSKITILHNPRCSKSREALKILEDNGITADVVKYLEEHPSAAQLKNIVKMLGIKSAREMMRTKEDIYKELDLKNEHDEEK
    LIEAMAEHPKLIERPIIIKGDKAIIARPPQKAEEFLKV

    >gi|307721968|ref|YP_003893108.1| hypothetical protein Saut_2053 [Sulfurimonas autotrophica DSM 16294]
    MKILILLLTSVLILFANELQFEHNFDKALKKAKEQNKAVMMMYSAVWCPECNYMKEIVFKDKQVSTYIEKHFIVLSLDIQ
    KDTLPKGFEYPGIPVFFFLDDNASEKDKIIGGSKANIFLEKLKSVK

    >gi|307722077|ref|YP_003893217.1| thioredoxin [Sulfurimonas autotrophica DSM 16294]
    MKVVCPHCFTVNNVPQKESYKKANCGKCKQSLLDTKPVELTNANFDEVVVNSDIPVIVDFWAPWCGPCKMMAPNFERAAT
    QFPLKALFTKVNTENEQNLGARFGIRSIPTIIVFKGGREVERVSGALDINALASLASKYTN