Sulfurihydrogenibium azorense Az Fu1 uid58121

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225847955|ref|YP_002728118.1| thioredoxin [Sulfurihydrogenibium azorense Az-Fu1]
    MAGKVISVNESNFEQEVLNSDVPVLVDFWAPWCGPCRLIAPIVEEIAEEMEGRAKVVKVNTDENPNLAMKYGIRAIPTIM
    VFKNGRVVDTRVGVQPKEVLKALLA

    >gi|225848009|ref|YP_002728172.1| hypothetical protein SULAZ_0175 [Sulfurihydrogenibium azorense Az-Fu1]
    MLENLKKELSNLKEKVNIRYNTFEEDDFEKFLKEISQENSSIKLQKDTFLGEKPIFLIEKDKISIKFLGKVSGGEVKSFL
    DSIKIVANNEYHISSRILEFAQEIDKPVDIKVFTTNS
    CGWCHPAILKAVSFSVVNPNIKVSIIDCYSFPELAMKYNVSAV
    PKIVINDKVEFVGARDDNEFFGYIVKALGEV

    >gi|225848079|ref|YP_002728242.1| dihydrolipoamide dehydrogenase [Sulfurihydrogenibium azorense Az-Fu1]
    MFDLIIIGMGPGGYEAALTALRKKINVAIVEKSKLGGNCLNRACIPTKYLRSGAHSIEKLQKLKAYGIEVKDYSIDYKAA
    FENKEKSIGFLRKSLEQLLKSKKVPVFKGKGKIIDKNKVEVSYPDGSKEIIEGKNIIIATGSYPASVGKLIPDGNYIITT
    EDYMEKLDTLPESMLIVGGGVAGCEIGYIAKSYGCQVYITELQDRLLPSDIISPEISKNLLKKLNSVGIKTFFNTTVEDF
    SIEESKIKVKLSNGEIIVVDKILLTVGRKPNTQDIDTIGIEKDEKGFIKVNSYLQTNFENIYAIGDVVNSPMLAHIASYE
    AKIVLHNITSQDKKIPDYTLTPWAIFSGYEIGHVGLNEETAKKQGLEVISGYYPFTYNEKAVDELEPEGYVRLYFEKNSK
    KIIGVDVVGIGASEIIHQIAVFIKEGYTADQVHEFIYFHPSLSEIFAYASYDIAVGKLF

    >gi|225848123|ref|YP_002728286.1| thymidylate kinase [Sulfurihydrogenibium azorense Az-Fu1]
    MSKKPNRLINEKSPYLLQHAYNPVDWYPWCDEAFEKAKKEDKPIFLSIGYSSCHWCHVMEKESFEDEEVAEILNKYFVPI
    KVDREERPDIDAVYMNVCMLFNGSGGWPLTIIMTPDKKPFFAGTYFPKHSRPNRIGVVDLLLSVAKYWQENKEDLISRSE
    KVLGYLKEDNKSNYGELKKDYIHAGFYDLKGRFDNTYGGFSNKPKFPTPHNIMFLLRYYYHTKEEEALQMVEKTLTNMRL
    GGIYDHVGFGFHRYSTDRQWLLPHFEKMHYDQAMLLMAYTETYQITKKDLYKQTVQEIIEYVIRDMTNEEGVFFSAEDAD
    SEGEEGKFYTWTFQEIKDILKEESDLAIKIFNIKEEGNYLEEATGHPTGRNIIYLSKTLRDYAIDLGIDENTLKQKLEQI
    RKKLFKEREKRVHPLKDDKVLTDWNGLMIAALSKAGKAFSNQDYISYAQKAADFIIHNMIIDGKLYHLYKDKEVKIEGML
    DDYAFLVWGLIELYQATGELKYLKTAVDLTNKAIQPLYDEKNGGFFLSKSQDLIVNPKESFDGAIPSGNSVMAYNLYRLY
    LITAQEEFYKKSYETLTAFAGDIKRLPSYHTMFLIALMMHFFPTSEIVISGKGWIEALNQLNREFLPNTVIIVKTPENKE
    ELSKISHYTQSMEVPEDFYIYLCKNFACNLPTKDLEYVINMLKG

    >gi|225848136|ref|YP_002728299.1| putative lipoprotein [Sulfurihydrogenibium azorense Az-Fu1]
    MKKFLVGLLIFGLFWFGCNKQPSEPKFTVDPNPVIKQAVDNKKNLIVIFESETCQYCDKLNREVLKDMEVKQNLVKNNIE
    IAIVDVNGSRKVLDPEGKKEVDEKTLAGIYRVTGYPTIAVFNPDKNYELIGVIPGYIPKDYFIKLGDYIGSKCYEKTEFQ
    KYIENGGKC

    >gi|225848156|ref|YP_002728319.1| peroxiredoxin [Sulfurihydrogenibium azorense Az-Fu1]
    MEKAKDFCLPGIDENGREINFCLKDYLGKGKDIILYFYPKDDTPGCTTEACDFRDNFNLLKDYAIVVGVSPDSIENHKKF
    KEKYGLNFILLSDTEKKVMQEYGAYGEKTMYGKKTMGVIRSTFIIDTDGNIKKAWKNVKAKGHVDQILKFYGVKK

    >gi|225848339|ref|YP_002728502.1| thiol-disulfide oxidoreductase ResA [Sulfurihydrogenibium azorense Az-Fu1]
    MKKVFFLVLMLFSLSFSKEKTLLLDKFSNPVPLPSDKLIILNFMAYSCGHCMAEIPTIKKVLKEKEFEGKFIVIAFALDG
    KDNNFKDKDFPIYANNPKNQVLFPIFGTPTTYIINPSGKKLAVVYGALTEENLRKYLREALSKSASGRI

    >gi|225848353|ref|YP_002728516.1| OsmC/Ohr family protein [Sulfurihydrogenibium azorense Az-Fu1]
    MKVVVKQKEDFHFIGKGEAGIELPIDAAAYVGGKGRGVRPPELLFHSIAGCMGIHVYEALHKAGKKVDDIVVETDAERKD
    TYPKVFTKIYLKFTIKGDVTEQDVKDAIETSLNKTCSIAYMINQVAPISYEFKIEK

    >gi|225848500|ref|YP_002728663.1| antioxidant, AhpC/TSA family [Sulfurihydrogenibium azorense Az-Fu1]
    MALTYSIDIPLGSKMPDFELKDPFGNLYKSDELYGEKGLLVVFTCNHCPYAIAVWPRLIRLSQYAKQLGINTVAINPNIH
    PNYPDDAPEKMIEKIKEWGIPFPYLVDETQEVAKLFKAQCTPDIYLFDKQHKLVYHGRIDDNWQDETKVTREELKEAITN
    LAEGKPIDPVQYPSMGCSIKWRE

    >gi|225848515|ref|YP_002728678.1| electron transport protein SCO1/SenC [Sulfurihydrogenibium azorense Az-Fu1]
    MKKLLSFLIVLVFSTVSMAYNLQGSAKGYPKPAIEVENLVNEEGKPTKLSDFKGKVVILYFGFTNCQHVCPTVSASLKRI
    SDALVEKGLKDKFQIVFITVDPKRDTPEVLKEYKKSHEFDTFTFLTGKEEDLKKVWKAYGIEVKEKEMEMKHGDHVMKHK
    MISHTPVITFIIDKNGKIVEDYKGIYLPEDKIIQDIEYLIKK

    >gi|225848593|ref|YP_002728756.1| antioxidant, AhpC/TSA family [Sulfurihydrogenibium azorense Az-Fu1]
    MAKIIQNFELFNAEEKKVSLNQLLGEGKPIFVYIYPTDEKFRCNRSECPFKENLEKIASLGVIVVGISEDPIEVHRKFKS
    DYNITFELLSDPTLTVIKGLGAYEKVDVNGIEKEKIIRTGILVDEKGYIVKIWKPERIEESVDEIIEEIKKLKKI

    >gi|225848635|ref|YP_002728798.1| putative thioredoxin [Sulfurihydrogenibium azorense Az-Fu1]
    MIIDVNSENFSEVLEKSYENVVVIDFWAPWCGPCRALKPILEKLSKEFGFILAKVNTDENPDIAQEFGVHGIPDVRIIKD
    GKVVDKFVGALPESQVRNIISKYIKSQADKIIEEASMMVLSGNREGAYQLFKEAVEKYPENKKLVLEAAKFMIKTNHLEE
    AEKLLNSIKEYDKEYFTQAQALKEFIQLKKECETKDVNTELEKLYAQASCYAVEENYEEALKLFLEIVKQDRKFKDDGAR
    KAMVSIFTLLGESHPLTKEYRKKLAMWLY

    >gi|225848648|ref|YP_002728811.1| rhodanese domain protein [Sulfurihydrogenibium azorense Az-Fu1]
    MRKILFTILLSFVFAFAYQDLNSKAFYEMIQKEKNVIILDVRTPQEYEKDGHIPGSILIPVQVLPQYIRELEKFKDKKIL
    VY
    CRSGNRSAAASRFLEQNGFKNVYNLKYGIIDWKRNNLPVEYGMKK

    >gi|225848827|ref|YP_002728991.1| uba/thif-type NAD/fad binding fold protein [Sulfurihydrogenibium azorense Az-Fu1]
    MFLDKETYKKIHISVKELKEKIDKGEDFILLDVREPQEYNFSRIKEKEAMLVPLMSLPRVINSLPKDKDIYVLCRSGNRS
    LQVTLWLLQNGFTKVKNVEGGILAWSDEIDPTVPKY

    >gi|225848898|ref|YP_002729062.1| thiol peroxidase (Scavengase P20) [Sulfurihydrogenibium azorense Az-Fu1]
    MATTVNLKGNPVALAGPQLNVGDKAPEAVVVASDLSEKRIGGAKGKVQVIITVPSLDTPVCEKETKTFNEKCAGYDVDVT
    VVSMDLPFAEKRFCESFNIGNITVASDFRYRDMEKYGVLIAEGALKGILARAVFVVDKDGTVTYKQIVPEITEEPNYDEV
    LQAVANLLK

    >gi|225848907|ref|YP_002729071.1| molybdenum cofactor synthesis protein 3 (Molybdopterinsynthase sulfurylase) (MPT synthase sulfurylase) [Sulfurihydrogenibium azorense Az-Fu1]
    MFGFTEEQIKRYSRHIILPEVGGVGQQKLLNAKVLVIGAGGLGSPSIYYLAAAGVGTIGIVDFDVVDFSNLQRQILHNTS
    RVGVPKVESAKMTVEALNPDVKVIAYNQKITKENVLDIVKDFDIVLDGSDNFPTRFLVNDACYMLGKPLVSAAILRFEGQ
    LTVFDYRNKETSPCYRCLIPEPPPPGLVPS
    CQEAGLLGVVGGIMGTLQANEALKLILEIGEPLIGKLLVFDALKTEFRTV
    KFRKNPKCELCGENPTITDLIEYDQACEVRF

    >gi|225848915|ref|YP_002729079.1| hypothetical protein SULAZ_1107 [Sulfurihydrogenibium azorense Az-Fu1]
    MFYVISLILSLFAISLADERLYTISPKDAFNLLNNKNVVFVYTEDSETFKKEHIPSSVNLDSLLLQDIALKNNEKLKCNY
    LPLCPKTAEKIFSEKGLTPNNFYIIYYDELPNKASYVWFLLYSMGVDDKNLRILDGGFKAWKNEGLPTESGDEKPRKKAT
    FKAKPRYEVVATKEEVLKHVENYQKGLDDNTILIDTRTFLEFTGRQEMTDIKRSGHIPSAKFVYWRWFADKETTYKPFEK
    LQEDVKKLNIDFSKKIILY
    CTIGNRSSFVFIPLKALGAKNLKIYTGSWYEWGNDESLPLEKEKFRER

    >gi|225848922|ref|YP_002729086.1| copper-transporting atpase Ran1 (protein responsive toantagonist 1) [Sulfurihydrogenibium azorense Az-Fu1]
    MKDIVVLLTSLTLVSGISWFFFSKDKKKEEENQESGELEKLEVNISGMHCAGCAAGIEATLKMVSGIKYAAVNFATSKGE
    FLYDPSKITKQQIIEKIKELGYDASIDLESFEKKS

    >gi|225849210|ref|YP_002729374.1| hypothetical protein SULAZ_1407 [Sulfurihydrogenibium azorense Az-Fu1]
    MEHTNHLIMGLITGALFGFVLFKVGAVRYSRVEGMLLLRDLKIMKFAFTGIATASIIYGLADILGFSESTNLIPRIMPYL
    GVAHLIGGVMFGIAMASAGFCPGTCVARVGAGKFISAAGVVGLVLGVIIYNAIQPSLVEAGILGNKQDLTLYGVLGVPYG
    PLAVAWGVLFLVFALIADWLDPAKKLYQEKTSFNLIKDEWHWAIGGVAAGSIIAWATAQGEYLGFSGALLALVGWISHLI
    GYPISNVVPQVNETILWHSGLILGVLPGAFLAAIISGRFKFDPVPPAFARVTPIPYVRMVLVFFAGIFLALGALIGGG
    CT
    TGAFLAAYPTLSIGSMAMSGTYFIVGVLTANLIYFGRWSRFLEAKKESEEVYD

    >gi|225849211|ref|YP_002729375.1| hypothetical protein SULAZ_1408 [Sulfurihydrogenibium azorense Az-Fu1]
    MKKVLTLAAAGLLTVAASSKAADLLISVDQAKDLLGKAVFVCGDDPKVFQAGHIPNAQNAYAHDLHYLSDIKKCGGLPMC
    ENNAQKLISGLGISNNSHVIAYDDGKGPNASGVWFFLYLYGVDNVQMLDGGFATWKAKGLPVETGPAKKPAPGKFTVKVR
    KDILATKDEVLKASKDPNYVILDARRFEEYTGKTLLEALEAPGKHKQVERGGHIPGAKFFEWKKLAGNPNGEPDKPLFKP
    VDQIKKQLERAGITPDKTVISY
    CHVGLGRGSFVFAALKLAGYPKAKVYVGSWDEWGNDASLPIEQ

    >gi|225849222|ref|YP_002729386.1| hypothetical protein SULAZ_1419 [Sulfurihydrogenibium azorense Az-Fu1]
    MQTQTVNFIVTETAAKEIKRIADENQIENPILRVRVVPGGCSGFQYAMGFDDEVSENDRVVEADHGVKIVIDEFSAPYIN
    GAVLDYVMDFMGGGFTIKNPNAVGSCGCGNSFSCG

    >gi|225849249|ref|YP_002729413.1| thiol:disulfide interchange protein DsbC [Sulfurihydrogenibium azorense Az-Fu1]
    MKLKMFIAGLMFAGTTVFAAESCLGGGSSKVSAAQVEKALSGILGNAKVVSVSDSPISGLYEVIIETGNKKVPIYVDCNL
    KYLVNGEIIDVNKKVSLTRERFQQLQSQANSEKEVKLAKLLGKDKVEMLKKEGLIDLINFVDTKNLPKSNITYGNGNIVV
    YVFTDPQ
    CPFCAKLHKEIEKILKDRKDVRFEMVLYPLPFHKHARGISENIECQKDNNSKQNILNKSFDSVAKGDESGLSS
    IDKPCTAGRGIIDKNLQYAQSVSINGTPTIVFPNKGIAVSGAIPAETLNKLIDILK

    >gi|225849377|ref|YP_002729541.1| AhpC/TSA family protein [Sulfurihydrogenibium azorense Az-Fu1]
    MRKFLILLLVIFGFSFGEMRAPDFTLKDEDGKVVKLSDLKDSVVLLNFWATTCHSCKRELPELEKLYQQYKDKVKFYAIV
    IDTEDPQKIKKSKKEIGFSFPVLIGNYQVMEKYRIIGTPITYVLGKDNTIGKIFIGPQPIEKIKEAIDKQLQRQGA

    >gi|225849388|ref|YP_002729552.1| alkyl hydroperoxide reductase, C subunit [Sulfurihydrogenibium azorense Az-Fu1]
    MEEKVILVGQQVPDFEMETYEPATGKFGKFSLADAKKENKWTILFFYPADFTFVCPTELADLAEKYEELKKLGAEVVSVS
    TDTKFVHLAWHRDEKLLANVKYPMGADPTGKISRMFGVYDCNTGLALRGTFIISPEGKLVSSEVNFYNVGRNADELVRKM
    KANAYLMSHPEEACPAKWEPGKKTLKPSEELVGHVYEALQD

    >gi|225849416|ref|YP_002729580.1| hypothetical protein SULAZ_1617 [Sulfurihydrogenibium azorense Az-Fu1]
    MAEEKTAVIKLTDEGFIGMMENKDFVLNLTNTTFNATDLMLISIGYCFGITVDAYVKHKNLSISNLRINVKGKKHETENR
    YEKVDIEVSFDGNLTPEQRERIITIGKRGCTVSNSMLKAPEINVILL

    >gi|225849464|ref|YP_002729629.1| hypothetical protein SULAZ_1671 [Sulfurihydrogenibium azorense Az-Fu1]
    MKHYFLFIILVLVLGCSTANEIKWLDFEEGLKRAKKENKLILLDISAKWCHYCNLMETTTYSDKEVIKIINKKFIPVKVD
    ADLRKDINKKYNQGGLPTTAILTPDGTLIYGNLYLPPEDLKKVLLYFSSLSKEEIEKIKTEKELKSQLPFSLKETKIDKS
    VFNLVNTNILGMIDKEYGGYYDEVKFPIDNIVYYLILKYLENPNNLSLLKKTLQGYEKLIDKEEGGIFRYATKRDWTQPH
    YEKLLRDQASIALAFFNAYSVLKDKSLLDDANLILDFSKKTLYNQKEKYFYGSQGADIVDDEGKILVSGEVYFSKNKQDR
    RFLENVYRRKLPLDDNFYFGENALMVKTLAYSYLFNKNNNDLKIAENLMNKIIKEGFKQNGIIHTPKVNKYFLDNQINTL
    DALFTLYQITGKDLYLKNFKNLLDVVLKIYYSQKIGLFTDYEDTGLNLNRISYVDSIVSLNFKLAKIIYQYQLLDDNKNL
    ENIKNSILNKLTNFNTVETALGLYLYFKPPIFSIYVNKEKVFNNKVYEFFPFWNIGLSFTPEDNNFRKLGYPYEGFPIVY
    ICSLRMCFEKIKYSDIENYDFKIFFKKYLNQDTM

    >gi|225849470|ref|YP_002729635.1| sulfide dehydrogenase [flavoCytochrome c] flavoprotein chain (fc) (fcsd) (flavocytochrome c flavoprotein subunit) [Sulfurihydrogenibium azorense Az-Fu1]
    MINRRDLLKLTGLAGVSTLLGGKAFAMSSKVDESAVKGKAHVVVIGGGFGGATAAKYIKVFDKDISVTLVEPSTKYYTCP
    FSNTVIGGFKKLEDIEVDFSKLKDLYGVNIVHQTVVEIDAAGKTVTLDNGKKLKYDKLVVSPGISFNYSAVEGAKPEMAE
    TLPHAWKAGPQTVLLRKQLEAMPDGGTFVMVIPPNPYRCPPGPYERASLVAWYLKNNKPKSKVLLLDAKNEFAKQKLFME
    GWQALYGNMVEWVQADLGGKVVKVDPKEKIVYTSSGEKIKGDVINFIPHQKAGELVLKFGLADDKGWAQINPKTFESKNV
    KDIYVIGDSAATIMPKSGFSANSHGKAAAAAIVASINGKNPEDITIVNICYSLVSPDYGISVAAVYNVNEKGITAVQGAG
    GVSPAGMDEKFRKKEAIYAQVWYDNIVADTWGKV

    >gi|225849474|ref|YP_002729639.1| hypothetical protein SULAZ_1681 [Sulfurihydrogenibium azorense Az-Fu1]
    MKKVILALLVLIGFSNAQINWVPYNQAFEKAKKENKIVFIYIYSPSCHYCDIMDFNVFESKRVEELLNKHFIPVKLRKCS
    NEGIEVRKKYGFVGTPMFYFLNPDGSKIKTIFGAWEEKDFVKILNYFASGSYKEMTMDEYFMKQK