Streptosporangium roseum DSM 43021 uid42521

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|271961627|ref|YP_003335823.1| heavy metal-transporting ATPase [Streptosporangium roseum DSM 43021]
    MTSVTDDLQNAVELSIGGMTCASCANRIERKLNKLEGVTATVNYATEKAKVTFPEGIDPQELIATVESAGYTAALPAPPK
    SEAAAGEQGPEDELRPLRSRLITSVVLAVPVIAMAMIPPLQFTNWQWLSLTLAAPVVVYAGWPFHKAAWTNLRHGAATMD
    TLVSLGTIAALGWSLWALFFGTAGTPGMIHPFAFTIERTDGSGNIYLEAAAGVTAFILAGRYFEARSKRRAGAALRALLE
    LGARDVAVLRDGTEVRIPTDQLAVGDRFVVRPGEKIATDGVVEEGSSAVDASMLTGESVPVEVRPGDAVTGATVNAGGRL
    VVRATRIGSDTQLAQMAKLVEDAQTGKAQVQRLADRISGVFVPVVIALALGTLGFWLGTGDGVGAAFTAAVAVLIIACPC
    ALGLATPTALLVGTGRGAQLGILIKGPEVLESTRRIDTVVLDKTGTVTEGRMTLTDVHLADGEDENEVLRLAGALEHASE
    HPIAQAVAKGASERVGALPTPEDFANVEGLGVQGIVDGHAVLVGRPKLLAEWSQHLNADLERSLHAAQAAGRTAVAVGWD
    GKARAVLVVADTVKPTSKEAIQRFRALGLTPVLLTGDNEAVAKSVAAEVGIDEVIAEVLPADKVDVVRKLQGEGKVVAMV
    GDGVNDAAALAQADLGLAMGTGTDAAIEASDLTLVRGDLRVAADAIRLSRRTLGTIKGNLFWAFAYNVAALPLAAMGLLN
    PMIAGAAMAFSSVFVVTNSLRLRRFK

    >gi|271961629|ref|YP_003335825.1| alkylhydroperoxidase [Streptosporangium roseum DSM 43021]
    MRRLTALDPANAPEKSRELLNDIVERRGSVGEMVSTMAHSPALLQGYLDFSRAMRRIKVPRALSEKISLAVQEWIGCAYC
    LDAHAEAGRAAGLSETDIALARQGTSTDTREAALIAVAVRVLAEPSSLTDEDVAELRAHGWSDRIIAEIVGLVTLNLLTG
    AFNLLAGLEPAERTA

    >gi|271961726|ref|YP_003335922.1| Rhodanese-related sulfurtransferase-like protein [Streptosporangium roseum DSM 43021]
    MDAMSVPEVEVQDVPDGAFLLDVRENDEWRAGHAPAAVHIPLGELQARVGEVPKDAPVYVVCRAGSRSAHAAAWLGHVGW
    DAINVGGGMQSWEVAGRPMVSESGQDPFVA

    >gi|271961728|ref|YP_003335924.1| Methylated DNA-protein cysteine methyltransferase-like protein [Streptosporangium roseum DSM 43021]
    MSSGDIDALLRVTSPDYIGKTHPDIAFGTLDGPVGRLILAVTNRGVVACSYEDENVVFERVSREVGSFIGPDPRRLDPVR
    RELDAYFSGRLRAFTITADLRLATSFARTVLQMMIAVPYGTVTTYREIAERIGRPRALRAVGNALGSNPVCVIVP
    CHRVV
    ENEAVLGGYAGGATAKGRLLRVEGANGSRSPGGS

    >gi|271961917|ref|YP_003336113.1| OsmC family protein [Streptosporangium roseum DSM 43021]
    MTSALYTAQAHVTGGRADGHGRTADGRLEVDLRQPKELGGDGEGTNPEQLFAIGYAACFAASLALVGQRKQVRADDAAID
    AKVMLIPAGNGGFKLGVELEIGLPSIADATQASDLVRVAHQV
    CPYSNATRGNIDVALVVNGTRL

    >gi|271962117|ref|YP_003336313.1| glutaredoxin 2 [Streptosporangium roseum DSM 43021]
    MAPQDHRITLLGKPGCHLCDDARTVIERVATELGVPWEERDITASEEDQDKYWEMIPVTLVDGVQHDFWRVDENRLRAAL
    RA

    >gi|271962143|ref|YP_003336339.1| thiol-disulfide isomerase and thioredoxins-like protein [Streptosporangium roseum DSM 43021]
    MRAQSFAAAVLLLTVAGCAGNQGNQPQSGDTRFVAGDGKITVFEAADRKPAPAVEGETLDGGSVTLATHKGKVVVLNFWA
    SW
    CAPCRAEAPVLKDIAAKTKAGGVEFIGIDFKDRKADAIAFERTQQSGYPSIFDQPGKVALSFQGTVPPAAIPSTLIID
    RQGRIAARALGAVKYNDLLSAVNKVGDEK

    >gi|271962171|ref|YP_003336367.1| Peptide-methionine (S)-S-oxide reductase [Streptosporangium roseum DSM 43021]
    MGWLFGKDKTSMVSPENALPGRDTGMAVPARHAVLDAPLAPPYPEGSEIADFGLGCFWGAERKFWQTPGVVSTSVGYAGG
    YTRNPTYEEVCSGQTGHTEVVRVVFDPSKVSYEELLRVFWEAHDPTQGMRQGNDVGTQYRSAVHFHSPEQEKSALTSRDA
    YQKVLTESGYGKITTEIVPAGDYFFAEDYHQQYLFKNPGGYCGIGGTNVKLGDPSEWAACQTGLVPTEE

    >gi|271962186|ref|YP_003336382.1| dihydrolipoamide dehydrogenase [Streptosporangium roseum DSM 43021]
    MSTHYDVVVLGAGPGGYVAAIRAAQLGLSVAVVEERYWGGVCLNVGCIPSKALLRNAELAHIFTHEAKTYGIRVEGQVTF
    DYGEAFKRSRKVADGRVKGVHYLMKKNGITEYDGRGTFVDANTLQVAGRDGGAETVTFDHCIIATGATTKLLPGTSVTER
    VVTYEEQILSDKLPESIVIAGAGAIGVEFAYVLHNYGVKVTIVEFLDRVVPLEDEEVSAELARRYKRLGIEVLTSTRVES
    IDDSGEQVRVTVSREGQQQVIEADKVMQAIGFQPRVEGYGLERTGVALTERGAIDIDGRGRTSVPHIFAIGDVTAKLMLA
    HAAESMGIIAAETIADEETMELDYVMIPRATYCQPQIASFGFTEAQARELGYDVKVAKFPFTANGKAHGLGDVTGFVKLL
    SDGEHGELIGAHLIGPEVTELLPELTLAQQWDLTVHEVARNVHAHPTLGEAVKEAVHGLAGHMINM

    >gi|271962315|ref|YP_003336511.1| hypothetical protein Sros_0749 [Streptosporangium roseum DSM 43021]
    MASLTVYSAPWCGHCHRLKEGLTRADIPFTEVDVDRTPGAIELITELNNGSWLIPTVVLPDGSALVNPSVREIEARLA

    >gi|271962329|ref|YP_003336525.1| peroxiredoxin [Streptosporangium roseum DSM 43021]
    MLETGSPAPDVVLEDTDGKTVRLSDYQGRHAVLVYFMRATSCPICARHVQDLIQRRDEFAAGNIQVLVAVPEDRQAAAAW
    KAKRQIPFPVLIGRRTTPHEVVGLSRKVFGSMQQSGSVLIDSQGIVRHAHGATMPTSAYDRKGITAAVQALRTGG

    >gi|271962452|ref|YP_003336648.1| hypothetical protein Sros_0900 [Streptosporangium roseum DSM 43021]
    MAWCGRVLSCSVTGLTVVLVTLVAATLVGVVMRRRSGVPREVRGDVEQLTSGDLEADLGERATLVQFSSAFCQPCRATRR
    VLAEVTEMVPGVAHVEIDAESRLDLVRSLNILRTPTVLILDASGHVVKRASGQPRKVDVIGALGLAVGE

    >gi|271962454|ref|YP_003336650.1| rhodanese-like domain protein [Streptosporangium roseum DSM 43021]
    MSRSAALVDADWVEANLDTDGIVLVEVDEDTSAYDKGHIRGAVKIDWKQDLQDPVRRDFVDREGFQALLSARGIGNDDTV
    VLYGGNNNWFAAYAYWYFKLYGHENVRLLDGGRKKWELDSRELVKDVPSRAATDYKAKEQDHSLRAFRDDVLAAIGKLNL
    VDVRSPDEFTGKLLAPAHVPQEAAQRGGHVPTARNIPWSKAANDDGTFKSDEDLKALYEGEGVDFGKDTIAY
    CRIGERSA
    HTWFVLHEILDQASVKNYDGSWTEYGSLVGVPIELGEAR

    >gi|271962456|ref|YP_003336652.1| dithiol-disulfide isomerase involved in polyketide biosynthesis-like protein [Streptosporangium roseum DSM 43021]
    MKRIEVWADMVCAWAYIGKRRLEKAGFGEDVEIVWHPFQIDPMAPATAEPLYEALRAPVADGALQACHPDLTPAENRVRV
    SLVAAEEGLGPPWGAVWRPNTFDAHRVIALAYQRGGPALQDAVVERILRAHFIEAADIGDRATLVALAAEAGLDGMAGAL
    DAGEGASEVRSQLLRGKAIGVATSPTYVVGGTAVAGAQSPEVLRDLVRQAAPERELPDEVRLLRQAESLLDVRDPLGALR
    TLEPLLANHGDDPAVRLLAARAYFGSAQLTRARETLESLLDRAPGDHYARFLLGRTLERANRHVEALPHLRLAAVMSPDP
    GYTDALRRVESRVP

    >gi|271962467|ref|YP_003336663.1| hypothetical protein Sros_0915 [Streptosporangium roseum DSM 43021]
    MARSLVIKVTAGEDAPERCNQAFTVAAAALASGVPVSLWLTGESAWFALPGRAKEFTLPHAAQLGDLLDAVLAAGRVTLC
    TQCASRRDIKVDDVIEGVRIAGAPTFVEEVLGEGVQALVY

    >gi|271962830|ref|YP_003337026.1| dihydrolipoamide dehydrogenase [Streptosporangium roseum DSM 43021]
    MTRIVIIGGGPGGYEAALVAAQLGAQVTVVEQDGPGGACVLTDCVPSKTLIATSVRKQALLDASMLGVHYTGGPDGDAGG
    VIADMPLVNKRVKELAQAQSADIAVRLAAEGVEVVRAAGRLVDPQVVRAGDRTIRADVVIVATGATPRILPSAEPDGERI
    LTWRQIYDLEELPEHLIVVGSGVTGAEFAGAYRSLGSEVTLVSSRDRMMPNEDADAAEVLEEVYRRRGMNVMGRSRAESV
    KRTADGVVVTLEDGRTAEGSHCLMTVGMIPNTAGLGLEEAGVTLDRGGFIQVDKVSRTSAPGVYAAGDCTGVLMLASVAA
    MQGRIAVWHALGEAVQPLRLATVASNIFTDPEIAAVGVAQKAIEAGEIEANVVKLPLATNARAKMQGFNDGFVKLFCRPH
    TGIILGGVVVAPRASELILAVSVAVQQRLTVDQLAHTFAVYPSMSGSITEAARRLMQPMTPSGI

    >gi|271962861|ref|YP_003337057.1| O6-methylguanine-DNA methyltransferase [Streptosporangium roseum DSM 43021]
    MIEAQVLPTPTGPLTLLSHEGVVVAAGFTADPHQMFLRLPSRLQAYGLRRVEDLGHPAQAVRDYLDGELTALDSVALTQP
    GTPTRQRLLTALREVPAGTTIGYAELAERAGLPRTAARAAGAACAQNLIAPFVP
    CHRILPSAGGFGGYYYGTPVKQWLLT
    HEKALAQTSVL

    >gi|271963287|ref|YP_003337483.1| thioredoxin-dependent thiol peroxidase [Streptosporangium roseum DSM 43021]
    MKLEPGDAAPDVTLPAADGTTVSLDAYRGKRVILYFYPAAMTPGCTKQACDFRDSLASLTSAGFVVLGVSKDTPAKLAKF
    VEHDALTFPLLSDPGLEVHKAYGAHGEKTMYGKTTVGVIRSTFVIDADGKIEKALYNVKATGHVARLRRELGLD

    >gi|271963436|ref|YP_003337632.1| Rhodanese-related sulfurtransferase-like protein [Streptosporangium roseum DSM 43021]
    MSVKTSIDVPAARALIAADPGVLVVDVRTPGEFASAHISGAVNLPLDQVDTHLRRIVADAGGTMLLICQSGGRATRAHTT
    LTRAGLVDVVVLEGGMNAWTGAGAPTTSTSCPIPGTRARRWGLERQVRLVAGGIVATSVLASIRWPQARFIAGFVGAGLT
    FAAVTDTCAMGMALAKLPYNRTRDFDIDAVIARLRGGEARP

    >gi|271963688|ref|YP_003337884.1| peroxiredoxin [Streptosporangium roseum DSM 43021]
    MGGSLAVGDVVEDFELLDETGTPRRLSDLVATGPVVLFFYPAAMTSGCTAESCHFRDLAEEFAAVGATRVGISRDTVDRQ
    RRFADTHNLGFPLLSDPDGAVARQLGARRNIAVGPFLTRRMTFVIDVDRRLLEVIHSETSMQAHADRALEVLRSRTGA

    >gi|271963761|ref|YP_003337957.1| methylated-DNA--protein-cysteinemethyltransferas e [Streptosporangium roseum DSM 43021]
    MVGTVAFGSVPTPLGEMLAAVTETGVAGVGWSGREGLRGRFLEGLGLAEVDDPGRTAAVLGELADYYAGRLRVFGVPVDW
    RLTSPVQRKVLGTLYETVAYGKAVTYGELAARSGTGVPARAIGSIMGANPIPIIVP
    CHRVVAGNGLGGFSGGEGVESKRW
    LLTMEGYLQPTLDWD

    >gi|271963842|ref|YP_003338038.1| redox protein regulator of disulfide bond formation-like protein [Streptosporangium roseum DSM 43021]
    MSHDGRSGRERPGTGAAGRPYRPMASDYSGPGVEAELTGVIGGGEAGYDTLYTARASSTGGRSGRVRTDDGLLDLEMRAP
    EQLGGPGGASNPEQLMAAAYAACFHSSLTLVAGQEGVDTTNASVDTVVELRRRGRRDDYVIGVDVTVHLPEVEPRLAGHI
    AERAHEH
    CPYSRALLGNVDVGLHLA

    >gi|271964026|ref|YP_003338222.1| rhodanese-related sulfurtransferase [Streptosporangium roseum DSM 43021]
    MTTLITRDELSTAIEAGTVVVVDALGGDYYAQQHLPGAIALVESEVATRAAELLPDRDAAIVTYCSNPACGNSEAVARRL
    IALGYTDVRKYREGIQDWTEAGLPVETGATVG

    >gi|271964158|ref|YP_003338354.1| alpha keto acid dehydrogenase complex, E3 component, lipoamide dehydrogenase [Streptosporangium roseum DSM 43021]
    MADGSGPYDIVVLGGGSGGYACALRAAELGKTVALIEKDKIGGTCLHRGCIPTKTLLHSAEVADETRESATFGVKARFEG
    IDMDGVHAFKDKIVTRAWKGVQGLLKSKGITIIEGEGRLAGPNRVAVGSEVYEGRNIVLATGSAPRSLPGLDIDGERVIT
    SEHALKLDRVPTSVIVLGGGVIGVEFASVWRSFGAEVTIVEALPHLLPLEEESSSKLLERAFRRRGIKQELGVFFEGVKS
    TDTGVIVTLANGKTLDAELLLVAVGRGAVSSGMGFEEAGIAIERGTVTVDEFCQTSVPGVYAVGDLIPTLQLAHAGFAEG
    ILVAEHIAGLNPVPIDYDGVPRITYSDPEVASVGITSAQARERGHEVVEFTYDLAGNPKSQILQTQGAVKIVTEKDGPVL
    GVHMVGRRIGELVTEGQLIYNWEALPSEVAQLIHAHPTQSEAVGEAMLALAGKPLHVHN

    >gi|271964178|ref|YP_003338374.1| iron-sulfur cluster insertion protein ErpA [Streptosporangium roseum DSM 43021]
    MSVESSETTAQGLILSDAASAKVKSLLEQQGEEGLQLRVAVQPGGCSGLRYQLFFDDRSMDGDIVTDFNGVSVVTDRMSA
    PYLVGATVDFVDTIEKQGFTIDNPNATGSCACGDSFN

    >gi|271964295|ref|YP_003338491.1| putative arsenate reductase [Streptosporangium roseum DSM 43021]
    MTTVWHNPRCSKSRAALTALTDSGREVTVRRYLDDPPTPAELSEVLDLLGLEPWDLTRMGEDRAGELGLATAERERDRWI
    AILVANPVLIQRPIVLTEDGRAVVARDREALKDLL

    >gi|271964773|ref|YP_003338969.1| thioredoxin [Streptosporangium roseum DSM 43021]
    MATIEVTEKNFNEIADEGIVLLDFWAAWCGPCRTFGPIFEKSSEKHDDIKFGKIDTEAEQALAQGFEITSIPTIMAIRDG
    IVVFAQPGALPAPALEDLIGQVRALDMDAIRAELANEMGVQNN

    >gi|271965169|ref|YP_003339365.1| heavy metal-transporting ATPase [Streptosporangium roseum DSM 43021]
    MSSLTDDRPPSAVELSIGGMTCASCANRIERKLNKLDGVTATVNYATEKAKVTFPEGVDPQTLIAEVEKAGYTAELPAPP
    SAEGAPQEPHDELRSLRARLITSVVLAVPVIAMAMIPPLQFTNWQWLSLTLAAPVVVYAGWPFHKAAWTNLRHGAATMDT
    LVSLGTIAALGWSLWALFFGSAGTPGMTHPFAFTIERTDGSGNIYLEAAAGVTAFILAGRYFEARSKRRAGAALRALLEL
    GAKDVAVLRDGREVRIPSDQLKAGDRFVVRPGEKIATDGVVEEGSSAVDASMLTGESVPVEVRPGDTVTGATVNAGGRLV
    VRATRVGSDTQLAQMAKLVEDAQTGKAQVQRLADRISGIFVPIVIALAVGTLGFWLGTGGGAGAAFTAAVAVLIIACPCA
    LGLATPTALLVGTGRGAQLGILIKGPEVLESTRAIDTVVLDKTGTVTEGKMTLTDVHLADGEDHDEVLRLAGALEHASEH
    PIAQAIARGAAERVGELPAPEDFANVEGLGVQGIVDGHAVLVGRPRLLAEWSQHLSAELERALQEAQAAGRTAVAVGWDG
    KARAVLVVADTVKPTSAEAIRQLRALGLTPVLLTGDNEAVARSVAAEVGIDEVIAEVLPADKVDVVKRLQAEGRSVAMVG
    DGVNDAAALAQADLGLAMGTGTDAAIEASDLTLVRGDLRVAADAIRLSRRTLRTIKGNLFWAFAYNVAALPLAALGLLNP
    MIAGAAMAFSSVFVVSNSLRLRGFK

    >gi|271965201|ref|YP_003339397.1| selenide, water dikinase [Streptosporangium roseum DSM 43021]
    MEATTERGAPASPSSPGPGRETVRLTQYAHGGGCACKIPPGELEAVVAGLLDAPDDRALPSPAGELIIGLDDGDDAAVVR
    IDGDRAIVATADFFTPVVDDPYDWGRIAAANALSDVYAVGGEPLVAVNLLGWPRERLPMDLAKEVLRGGLDVARAAACHV
    AGGHSVDDPEPKYGMAVTGLADPGRLLRIDGGRVGLPISLTKPLGIGVLNTRHKATGEVFPEAVATMTTLNRDASRAALA
    AGARCATDVTGFGLLGHLYKLARACGVTAVLDVAAVPYLGGAREAVRDGYVSGGTRRNLAWVEPHLDPGRHGEEDLLLLA
    DAQTSGGLLVAGEVPGAPIIGELVVSDGRALRLR

    >gi|271965303|ref|YP_003339499.1| alkylhydroperoxidase [Streptosporangium roseum DSM 43021]
    MPRLPQLTEDPDGLLEETRRQLGRVPNLYAALANGPAALRGYLAMRDALTGGVLPARLREKIALLVAQENHCTYCVSAHT
    MRGTRMGMSEEELKLTRDGHDADLHADAVLQITQEVVRAGGRVSDESLARARQAGVTDAELAEIVAHVALNTLSNSFNHL
    AQPDLDFPEVTV

    >gi|271965336|ref|YP_003339532.1| organic hydroperoxide resistance protein OhrB, OsmC family [Streptosporangium roseum DSM 43021]
    MSTLYTAVATASGREGRAVTSDNRLDVTLAPPKELGGSGEGTNPEQLFAAGYAACFASALQLVGRRMKLDVSDAAVTAEV
    GLVPDGQAFGLTVTLRVELPEELRGESGTALVEATHQV
    CPYSNATRGNISVTLVVE

    >gi|271965339|ref|YP_003339535.1| peroxidase family protein [Streptosporangium roseum DSM 43021]
    MPHIDLPTDAPGIGGLFHYRPQTALPMAQLAEVLLCGEHSLSRGERELIATYVSSLNDCGFCTRSHAAFAAAQLPGGMDL
    VCQVTDDPDGAPITEKMKTLLDIAGAVQRGGLEVTSDHVGAARKAGATDVEIHDTVLIAAAFCMYNRYVDGLAALTPEDP
    AVYESIAERMVTGGYLPAAAAPGG

    >gi|271965482|ref|YP_003339678.1| thioredoxin [Streptosporangium roseum DSM 43021]
    MSSNILQCKNCGQKNRVPAVGSSAPRCGRCHRPLPWLAEAGDDDFAEVAEGSPVPVIVDFWAAWCGPCRMVSPALDRVAE
    DLAGTVKLVKVDVDRSPKLSERFTVRNIPYLMVMRGGRVVAERAGAAPAAELRTWVDGAIATAGREGG

    >gi|271965659|ref|YP_003339855.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptosporangium roseum DSM 43021]
    MFDVVVVGGGPAGMSATLTLGRAHRAVLLLDAGEGRNAPAEAVHNFLTRDGTPPSRLRELGRDELSAYPGVQVRDGAVTG
    VGVPDGGGFRLSLSGGGTVDARRLLLATGLADEMSDLRGVGPLWGRSAFH
    CPYCHGYECTGKPVAVIGAEPARVRLALQL
    SRFASDVVLCTGGAPVDPALRAKLEAHGVPVRCEAISRLEATGDALERIVFESGPPLAREAVFVVNVPRQRSDLAARLGC
    AAFADACVEVDEFGRTSVPGVYAAGDMARRATVPVPLAAVISAAASGTVAAAVIDQDLLGADFGLSNPFPRRVDEPRVP

    >gi|271965869|ref|YP_003340065.1| Methylated DNA-protein cysteine methyltransferase-like protein [Streptosporangium roseum DSM 43021]
    MTTTPPNPVDGGELLGRLPEADQATQARLHARLAAAAERAGILDVAYRTLDTPVGPLLLAATAHGLVRVAYAGEDHDKVL
    DRLAETVSSRLLRAPARLDDAARQLEEYFTGRRSLFDLPLDLRLAHGFRREVLSHLRDIGYGTTASYAAVAAAAGSPRAV
    RAVGTACATNPLPVIVP
    CHRVIRSDGTLGHYVGGAEAKKLLLTLEAAP

    >gi|271966135|ref|YP_003340331.1| DSBA oxidoreductase [Streptosporangium roseum DSM 43021]
    MKLEIYADVLCPWCYIGKRRLTAALAQQTGRTSIEIVWRGYELAPDEGRTPGPTAAEAMAGWWGEQAPARIARIRSLGAA
    EGLELNLHLARPVNTFDAHRLVKLATDRGRADQMMELLLHAYHTEGHNVADAQVLQRLGGEAGLDAGEVLAVLDGDDYAD
    EVRADRRRAAEHGVTGVPSLVIDGRPPVSGVQPVADLHVLLRNDPTGSPGVVIKPGRPG

    >gi|271966324|ref|YP_003340520.1| Protein-disulfide isomerase-like protein [Streptosporangium roseum DSM 43021]
    MTTNLKITLIIAAGMAAVIAAIVLFGRPEGSATEPVTGTASGQPVPAEYLVRADSHKLSTAADNKVTLVEFLDFECESCG
    AAFPHMERIRAEYDGKINFVVRYFPLPGHRNGELAARVAEAAGKQDRFEAMYAKLFQTQSQWGEASESKEEFFLDLAKQT
    GLDMAAFQKDLKAPETAERVKKDQDDGFALSIQGTPTVFFNGALLDGEPSYENLKAKIDAALAP

    >gi|271966546|ref|YP_003340742.1| alkylhydroperoxidase [Streptosporangium roseum DSM 43021]
    MTNVAIPARMNLSLVAPKVFKAVLALDAVARQGLDPVLVELVQIRASQVNRCAYCIDYHTGDARRAGESEARIYQLSAWH
    ESSLYTAKERAALALTEAMTLLPQGITDAVYDEAARHFDDKELAQLIALIFTVNAWNRMNVTTRKTPGTE

    >gi|271966575|ref|YP_003340771.1| hypothetical protein Sros_5259 [Streptosporangium roseum DSM 43021]
    MTEKTIADFWFDPSCPYTWVTSRWLLEVEKVRPVEVRWRVMSLSVLNEGRDDDPEGDPEGYLWVPVRVCAAVRQEYGQEA
    LGRLYTAMWTSGRDRGDHDWMGSLHDALAAAGLPLELAEAGASTAYDEAVRASHAEGIGLIGDHVGTPVVAVTGAGGERV
    VFFGPVISRAPTGEQAGRLWDGTLLVAGTPGFHELKGAPHEKPRLGDPM

    >gi|271966606|ref|YP_003340802.1| hypothetical protein Sros_5291 [Streptosporangium roseum DSM 43021]
    MNSTPPGQQAATVADMWFDPRCPWAWITSRWLLEVEQVRSIEPRFHVMSLSVLNEGREVPEKYRRGMVEGWGPVRVCIAA
    EQQHGPEVLRPLYTAMGTRIHHREAGLGRDMLLAALADADLPAELAEAADATEYDEALRASHHAGMDLVGAEVGTPVIHV
    PGADGELIAFFGPVVSPIPRGEAAGRLWDGVLAVAGTDGFFELKRTRTREPVFD

    >gi|271966667|ref|YP_003340863.1| FAD dependent oxidoreductase [Streptosporangium roseum DSM 43021]
    MVTDQLMDGYDVVVVGGGAAGLSGALMLARARRSVVVIDGGAPRNAPAAGVHGLLARDGMRPAELLERGRAEVRRYGGHV
    VPGEVGAVAREDDGEDTGFAVALADGRAIRARRLLVATGLVDELPDIPGLWARWGRDVVH
    CPYCHGWEVRDQAIGVLGGG
    PLAVHRALLFRQWSADVTLLSHTMAPPTGEEAEQLAARGVSVVDGEVASLEIVEDRLVGVRLSNGTVVSRQVLAVAPRMA
    ARVGFLAELGLRPAEHPGGVGEHIPSDAAGRTGVPGVWVAGNVTDLAAQVGAAAAAGAAAAAQINADLVAEDTRQAVAAW
    RVSSAESEARAGELAMGERRPGR

    >gi|271966720|ref|YP_003340916.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptosporangium roseum DSM 43021]
    MTERLVVIGGDAAGMSAASQARGRRDPQDLRIVAFEKGRHASYSACGIPYLVGGEVSDPQELIARRPEVFRDELDIDLRL
    RSEVTEIDLDRRAVAVHDHHGGGRYWEPFDQLVIATGGLPHRPDLPGAQARGVYGVQTLDDGIALLDALESERPRRAVVV
    GAGYIGLEMAEALVRRGLEVSLIDGGDQPMGTIDPDMGALVADALRGLGVKVFLGEPVEGFSESGGRVTAARTGSRSVQA
    DLVVLGLGSRPNTALAEAAGVPVGETSGIRTDRRMRTAVEGVWAAGDCVETFHLVSRRPVAIALGTHANKQGRAAGINIG
    GGYAAFLGVVGTAVSKICEYEVARTGLTTAEAAEAGFETVGEIVESTTRAGYYPGARRMRTKMIADRRTGRLLGAQIVGQ
    EGAAKRIDALAIAVWHEMSVEDVSGLDLSYAPPFAPVWDPILIAARKTAERLERLGGRE

    >gi|271966815|ref|YP_003341011.1| pyridine nucleotide-disulphide oxidoreductase domain protein [Streptosporangium roseum DSM 43021]
    MQHFDVAIIGGGPAGLTAAMALSRSLRRVVVLDSVRPPRNVFSKEVHGIVGLDGVSPGEYRRRAWDDLKKYGMAELHELT
    GTDVTPDPEGGFTVTAEDGRPRWARRVLLTAGMLDVHPGIEGFGECWGKTVIH
    CPFCLGWENRGRTWGVVTGDPEFAATV
    VAGFSAWSDDVIVLTDGAAAAGEWGGEVVEGKIRRLHHAGGDLRAVELADGTVVDRQTLLWQLDQRPVPLVAHLAERLGL
    GLDEDGHVEVDGSFHTSVPGVYAAGDLITEAQAAIESAAGGSGAAFQIIADTGKP

    >gi|271967128|ref|YP_003341324.1| mercuric reductase, truncated [Streptosporangium roseum DSM 43021]
    MSDEFDVIVVGAGPAGENAAARAARGGLSVAVVEEELAGGECAYWACIPSKALLRPVELAADVGRVPGLALRPIDVDAVL
    ARRDEAVSHLDDGKQVQWIKSVPAEFFRGRGRLRGPRQVEVTAPDGSTRLLRARHAVVLATGSRPVIPPTPGLAEASPWT
    SREATGVRAVPKRLAVLGGGVVACEMAQALHGLGAEETTMLVRGRTLLGRMEPFAGELLVASLRDGGVQVRTGAQVTRVE
    RPEPGGPVTVHLAEGAPVEADELLVATGRRPATGDLGLDTVGLPDTDPVRVDDSMRATGVDGGWLYAVGDVNGRNLLTHM
    GKYQARVCGDVIAARARGERDDLPAMRDTADGYGAPQVVFTDPQVCAVGRTEAAARAEGFDVRVVEYDLGAVSGAYLLGD
    GYRGRAKAVVDEDRRVLLGVTFAGPGVAELLHSATVAVTGEVTLDRLWHAVPSFPTVSEVWLRLLEEYGL

    >gi|271967484|ref|YP_003341680.1| monooxygenase FAD-binding protein [Streptosporangium roseum DSM 43021]
    MIRPGPWRSGFAGPYRGRLTWVDDVWDLVIVGGGPAGSAAALRAKQLRPAARVLLLDRADFPRDKACGDGVAAHGRDELA
    LLGVPDLIADYRPTRRLTVVSPGGARVCATVARPNHVVPRTVFDARLVDAARARGVEVRRHRVRALAAHGGHIVVDGAFT
    ARAVVAADGANSTVRRLIGVPASPARHTAIAVRGYADVPDDDDVQFIAMQKEGWPAYAWSFPIGDGTANVGFGMLLPRLH
    ATGLPGREVLHGRLAELLPHLPARDLRAHHLPLSPGRPRPGAGRVMLAGDAAGLVNPLTGEGIYYALVSGRLAGEAAVQA
    AGDPLPAYRNALRKALGRHLRTTDVLARAAQSPGFIDAAIDTADRRQEVFDLLVDVGLGAGTVPLRLGCAVLGRWILNGV
    RRG

    >gi|271967588|ref|YP_003341784.1| soluble pyridine nucleotide transhydrogenase [Streptosporangium roseum DSM 43021]
    MWDFDVLVLGSGPGGQKAAIAAAKLGKRVAVVEKKHMLGGVCINTGTIPSKTLREAVLYLTGLNQRELYGASYRVKDEIT
    VADLGMRTQHVIGREIQVIRSQLGRNHVTVLQGTGRFLDAHTIGVTGDEERKVTAEKVVIATGTSPARPSSVEFDDKMVI
    DSDAILHLDRVPETLVVVGAGVIGIEYASMFAALGTKVTVVERRERMLEFCDLEIVEALKYHLRDLAVTFRFGESVAAVE
    RRPRGALTVLESGKKIPADCVMYSAGRQGKTAELCLAAAGLAADDRGRIEVDENYATPVPHIYAVGDVIGFPALAATSME
    QGRLAAQHACGEPVTEMHELSPIGIYTIPEISFVGKTEDELTRDKIPFEVGISRYRELARGQIIGDSYGMLKLLVSSEDR
    RLLGVHVFGTGATELVHIGQTVMGCGGTVDYLVNAVFNYPTLAESYKVAALDAMNKMRVIARLTAEL

    >gi|271967779|ref|YP_003341975.1| Peroxiredoxin [Streptosporangium roseum DSM 43021]
    MSIRGISVRTLSDAPTTLAELAGDRAVLIVNVASKCGLTPQYTGLVELHRAYADRGLTVVGVPCNQFMGQEPGSAEEIQE
    FCSTTYGVDFPLLAKTDVNGEDRHPLYASLTQAPDADGQAGDVQWNFEKFLVSREGEVLARFRPAVEPGDPALIAAIEKS
    L

    >gi|271967826|ref|YP_003342022.1| alkylhydroperoxide reductase C [Streptosporangium roseum DSM 43021]
    MLTVGDRFPEFELTACVSLDADSAFAEINHKSYEGKWKIYFAWPKDFTFVCPTEIAEFGRLEGEFADRDAQVLGFSVDSE
    YVHHAWRKDHPDLRDLPFPMLSDIKRELCTELGILGADGVAQRATFIVDPNNEIQFVMVTAGSVGRNVKEVLRVLDALQS
    DELCPCNWNKGDKGLDDKKLMAG

    >gi|271967897|ref|YP_003342093.1| DsbA oxidoreductase [Streptosporangium roseum DSM 43021]
    MKVEIYSDVVCPWCYIGHTRFARAVERYRAKGGEVEVELRPFQLAPDAESNGEPTLTWAAAKFGGAERAAQMFGHVTGVA
    AEDGLALDFDHSIQANTFDAHRLIRLAGEQGKGEEALYALFRAHFTDGLDVGSREVLAKLAAELGVRADLGGEDGAAAVR
    EELAQARALGVSSVPLFLFEGQFAVSGAQPEDTLLAALEEVAERTGQAVKAVKTAGADGDACDEDEGYCAV

    >gi|271967961|ref|YP_003342157.1| OsmC-like protein [Streptosporangium roseum DSM 43021]
    MATTRTATTQWKGALLNGSGTVSLDSSGVGTFDVSWPSRAEQANGKTSPEELIAAAHSSCFSMALSHGLAQAGTPPQTVE
    TKADVTFQPGEGITGIVISVRAQVPGLSAEEFQKAAETAKAN
    CPVSKALAGTTISLNAELLS

    >gi|271967971|ref|YP_003342167.1| Peptide-methionine (R)-S-oxide reductase [Streptosporangium roseum DSM 43021]
    MDKVVKSDAEWRVQLSPEEFHVLRQAGTERPFTGEYVDTKTEGVYSCRACGAELFRSDTKFESHCGWPSFYEPSESEAVT
    LIEDRSLGMTRVEVRCAACDSHLGHVFHGEGYATPTDDRY
    CINSVSLRLEPTD

    >gi|271968238|ref|YP_003342434.1| hypothetical protein Sros_6991 [Streptosporangium roseum DSM 43021]
    MGRILTPVARRSALSQVRHVSPVRPGAAREIVAGVYEQAERDFGMLAPPVILHSPAPEPLAACWLILRESLLAHGTVNRA
    IKEAVAAAVSLGNTCPY
    CVDVHSATLGSLVRGDYAAEIAGDRIEAIADPGVRRIAAWARASGTREAAARHDLPLPAEQVA
    ELVGVAVTFQYFNRMVNVFLDESPVPPQVPAGVRPGLMRLLGLFMRPAARRAHAPGASLDLLPAAPPPADLSWADGAANI
    AEAFARAAAAVDRAGHRSVPEPVRDLVTAELAGWNGAPAGLSRSWVTDAVSGLPAAQRPAGRLALLTAMASYQVDQPVID
    EFRRTEPGDRALIELTSWASLAAARRIGSWVLPARPDGPRQTAPDGCPVAARLS

    >gi|271968286|ref|YP_003342482.1| Peroxiredoxin [Streptosporangium roseum DSM 43021]
    MAVEVGSPAPDFELKDQHGTPVKLSDYRGRKVVLIFYPLAFSGVCHGELCAIRDEFIATAPEDVQVVTVSVDSVFTHRAW
    ADREGYTFPLLSDFWPHGQVAQAYGVFDEEKGLATRGTFIIDGEGVVRWSVVNPIPEARDVAEYRKALAELS

    >gi|271968310|ref|YP_003342506.1| thiosulfate sulfurtransferase [Streptosporangium roseum DSM 43021]
    MSPLITPSELADLAGATVLDVRWKLGGPPGADSYREGHVPGAVFCDLNADLAAPAGPLGRHPLPSADLFQDAMRRLGVSG
    SRPVVVYDGADSTAAARAWWTLRYFGHPDVRVLDGGFRAWAAEGLPVSTGEEAAAPGDFVARPGGMPVLDAAQALELAAD
    GVLLDARAAERYRGEVEPIDPVAGHVPGAVSAPTGDNVDPAGRFHLPDFLRERFNTLGAVPGVRVGAY
    CGSGVTAAHEVL
    ALELAGIPAALYVGSWSNWVADPSRPVATG

    >gi|271968364|ref|YP_003342560.1| rhodanese domain-containing protein [Streptosporangium roseum DSM 43021]
    MTVTIAAPSAVTAVPAAGNAAALAHFAGRLAFETDVSDVAADLAAEAPGIIVVDSRNLESWEQGHVRGAVHLPTAEIAAR
    AADVIPAGVTVVTY
    CWGPGCNGATRAALEFAKLGYPVKEMIGGFEYWAREGFATETSAGVSRRGVDPLTAPVSGIACAC

    >gi|271968533|ref|YP_003342729.1| FAD dependent oxidoreductase [Streptosporangium roseum DSM 43021]
    MTGFDGVIIGGGHNGLTCAAYLARAGLSIAVVERNDEAGGGCSTQELTLPGFRHNTHSSYHFLEEGPVPADLELQRYGLR
    YVYPETQHSTIFRDGRAITVYTDPKRTAESFARFSRADADRWLELYERYAEAARDLMNGFLYSGPLPPHVLAERLRGDLG
    RDLLSYMPLSLYEAVDKNFESEQVRVLFKSFLHAISIENVPGTGGFLPRLLSRIARLGVPVGGAVNVANALRGVIEEHGG
    IVVTGAHAERILVDDGRAVGVKLATGEVLSARRFVASAVDAPQTVRLAGPENFGADIAAKVENYKWAGHSLVTLHLALDE
    APRYLAAEFEPDVDRAFLVVLGADDSEQLGRTFDQIHEGRLPDRLAGNGACPSLFDPSYAPDGKHVAFWWPWAPYDLDGD
    AGNWDRQREEVGELLLAEWSEYAPNLSRGAVLGKRVFSPLDIERHCVNMVRGSHHVGAYEPAQLGGNRPVPELGQYRTPI
    TGLYLCGASSHPGGSVSGAPGYNGANAIAEDLGLSPWWTPVPAPRWSE

    >gi|271968558|ref|YP_003342754.1| hypothetical protein Sros_7324 [Streptosporangium roseum DSM 43021]
    MTERTPVDLWFDPFCPYAWMTSRWLLEVEKIRPIEPRWHIMSLNVLNEDKEVPDKYREQIAKAIGPVRVVTAVQEKYDSE
    TVGRLYTELGTRFHNQGRLKELDRLRETVEEALEAAGLDPAFADAMDSEEFDEALRASHNDGIDRVGQEVGTPVIAVEGV
    AFFGPVVSPAPKGEEAGKLWDGVRLVAGIDGFFEIKRSRTRGPIFE

    >gi|271968711|ref|YP_003342907.1| putative sodium/proton antiporter [Streptosporangium roseum DSM 43021]
    MTEPREAGAPFSGRTAWAQGLTTPLREFLRTETGSALILLAATLAALAWANAGPSSYEAVWRTVLSIRLDGLDVSQDLRQ
    WVNNGLMTFFFFVVGLEARREFDMGELRDRRRLVLPLVAGVGGMAVPVAIYLTVNAGSPSAHGWGAAMSTDTAFALGMLA
    LFGSRFPARLRTYLLTVTVVDDLVALGVITIFYSERVVPAALLAAAGIFAVILLVRAAGVRRGLPYALLGAAAWVALLKS
    GVEPIVIGLAMGLLTYASPAARGDLARATDLFRLFREQPTPELARSASVGLASTISPNERLQQLYHPWVSYLVVPLFALS
    NAGVTISGEFLARALTSPITLGILLAYVVGKPVGVIGSSWLVTRLSRGRVRPPVGWAAVAAGGTIAGIGFTVSLLIATLA
    FDGPQLEEAKLGILTAALCAPLMTWAVHRVTTLLPKRLRIRALLGTAESIVDLAAPVDPDRDHVRGPQVAPVTVVEYGDF
    E
    CPYCGQAEAVVRELLADLGDVRYVWRHLPLHDVHPYAQLAAEAAEAAAEQEAFWEMHDLLLDHQDELRIRDLIGYAGEL
    GLDVERFRDSLRGHAGAARVAEDIDSADLSGVSGTPTFFINGRRHHGAYDIATLSAAVRAARARAALRT

    >gi|271968805|ref|YP_003343001.1| rhodanese domain-containing protein [Streptosporangium roseum DSM 43021]
    MAALVDPHWLAERLDDPKTVVVEVQYEPDIDEYSTGHVPGARHVFWKDLCWDPDEREFVTPRQAAGILGALGVGPDTTLV
    LYSGRGQFAVYGHWVFGTLNGHPDVRVLNGGRGAWTRAGFELSTEEPDVAAVPYEPVRAARDDASRIGRDELLGLVGSPD
    TLLLDGRYPEEYRGERVKPGAGFDHGAERHGRIPGAVNLFFRDLLDERFTIRPPEELERVFRAAGAAPDQTRQVVAY
    CRL
    GHRASLLRFTMHELLGWDHVRVYDGSWTEWGSIVGSPIEREAR

    >gi|271969129|ref|YP_003343325.1| FAD dependent oxidoreductase [Streptosporangium roseum DSM 43021]
    MIKATNDQNGGAPHAAGDEDYDVVVVGAGAAGLNAALILGRARRKVAVIDAGEPRNAPAAHMHGFLSRDGLPPAMLLELG
    RAEVARYGVRLIQGRVEQIDEGYHVRMVGGPVIRARRVLVATGLRDELPDIPGVRERWGKDLLH
    CPYCHGYEVRDRPLAV
    LGTHPGAVHQALLLRAWSDDVVFFPHALELTAQDRERLEARGLRIVEGEIKRLVVDGDRLHGIELADGRAVPRAAAFLFP
    RMVPRDELLTRLGCDKGDNGWVTTDRTGRTGVAGVWAAGNVIDPRAQVITAAGMGSAAAFAMNTDLLDEDVDRAVEQHRA
    SAAVAVRGDGR

    >gi|271969223|ref|YP_003343419.1| hypothetical protein Sros_8021 [Streptosporangium roseum DSM 43021]
    MITLLADGHEEKIDGLVVPHGVPILGWERKPHGWCRGDACIPSFRAVAAETEDGVDLVRFAELLGRQAVADLDEGVVVVG
    EPAAPALGRAPEFGPLAGLRGTKVALVFWASW
    CGCRYDLPAWEALHRELGGYGFSVVSVSLDRDPQDAREWLADVTHPAV
    IDADGRIAELYNVINVPTVVWIDEEGRIARPQDTMTATDTFRSMNGLSSERATAALRRWVIDGDAGTALRELRAPTGDER
    LARLHGRLAAWLFRDDRRAAGERHLARAAELAPHDLAIRRGLMPLNGVDPFGEAYFDLRQELEDSGVAIYRPLPDWHEEA
    PR

    >gi|271969362|ref|YP_003343558.1| hypothetical protein Sros_8164 [Streptosporangium roseum DSM 43021]
    MTVRIKVWSDYVCPFCLLAKQPLAEATAGHDVAVEWMPFELRPEPTPTLRPEGDYLRDIWSRVVYPMAERMGVAIRLPDV
    SPQPHTRLAFEGYQFAKEHYLADAYNDRMLRAFFEDGLDIGDLDVLEKLAAGLGLPATAYRAALESGRYAQAHRAALAEA
    AAHRITAVPTILIEDIRIEGMPSQAALHEAIERAATRQGDHLAPRLACSIEGC

    >gi|271969555|ref|YP_003343751.1| Glutaredoxin and related protein-like protein [Streptosporangium roseum DSM 43021]
    MALTVYTTTWCGPCKRLKSQLTREGISYQEIDIERNPDAAQFVMSVNNGNQTVPTVLFEDGTAVTNPSVREVKARLSV

    >gi|271969577|ref|YP_003343773.1| molybdopterin/thiamine biosynthesis family protein [Streptosporangium roseum DSM 43021]
    MSLPPLVEPAAELTVDEVRRYSRHLIIPDVGMAGQKRLKNAKVLCVGAGGLGSPALLYLAAAGVGTLGVIDFDVVDESNL
    QRQVIHGQSDVGRLKAESAAASVREINPLVDVVVHNVALTTDNVMEIFSGYDLIVDGTDNFATRYMVNDAAVLLGKPYVW
    GSIYRFDGQASVFWAEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVNEAIKLLTGIGEPLVGRLMIYDALE
    MNYRSVKVRKDPECVLCGKNPTVTELLEDYEAFCGAVSQEAQEAASGSTITATDLKAMQDADENIYVIDVREPNEYEIVS
    IPGAVLIPKGEFLNGSALEKLPQDKRIVLH
    CKSGARSAEVLAIVKNAGFSDAVHVGGGVLSWVKTVDPSLPSY

    >gi|271969730|ref|YP_003343926.1| hypothetical protein Sros_8541 [Streptosporangium roseum DSM 43021]
    MNRLKDATSPYLLQHADNPVEWFEWGEDAFAEAARRNVPLLISVGYSACHWCHVMAHESFEDEGTAALMNEHFVNVKVDR
    EERPDVDAVYMAATQAMTGQGGWPMTVFATPGGHPFYTGTYFPRPQFQRLLAGVSNAWNGDREAVLEQSSKIVEALNERS
    ALPSGPLPTPDTLARAVQSLSRSFDQVRGGFGGAPKFPPSMALEFLLRYGAAAEPRTGAEGGEPEDRREPGAGAGAGAGA
    PTATAMAGRTLEAMARGGIYDQLGGGFARYSVDADWVVPHFEKMLYDNALLLRVYAHWWRLTGSALGRRVALETADWLLA
    EMRTPEGGFASALDADSEGVEGKFYAWTPEEIHEVLGEEDGAWAVALYEVTGTFEHGTSVLQLLSDPDDAERSARVRAEL
    LAARAHRVRPGRDDKVVAAWNGLAIAALAETGALFDRPDLVEAARAAAVLLDGSHMDGDRLLRTSRDGRAGANAGVLEDY
    ADLAEGLLTLYGVTGEVRWFHRAGALLETVLDRFADGSGGFFDTADDAERLFQRPQDPTDNATPSGQFAAAGALLSYAAL
    TGSARHREAAEAALGTVTVLADKHARFAGWGLAVAQAAVSGPVEAAIVGPLDDPATSALHRTALLSPAPGLVVALGEPGS
    AEVPLLEGRGLLDGAPAAYVCRGFTCRMPVTTPAGLRAELAS

    >gi|271969959|ref|YP_003344155.1| peroxidase family protein [Streptosporangium roseum DSM 43021]
    MPHITLNTDEPGIRGLLRFRPETAGPLNDLAEVLLRGESTLSRGERELIATYVSGLNECRFCTSSHAAFAAAQLSEGMAL
    VEQVRADPDGAPVSAKLKALLGIAAAVQQGGRQVGDHHIAAARAEGATDVEIHDTVLIAAAFCMFNRYVDGLATFAPEDP
    ADYATAADRVIAYGYTTTSPVAEPRG

    >gi|271970253|ref|YP_003344449.1| peroxidase family protein [Streptosporangium roseum DSM 43021]
    MPHITLNSDAPGIRGLFMFRPETARPLNELVEVLLRQESTLSRGERELIAAYVSALNECRYCFSSHAAYAAAQLPEGMAL
    VEQVRADLGAAPVSEKLRALLAIAAAVQQSGQKVSEQEIAAARETGATDLEIHDTVLIAAAFCMFNRYVDGLATIAPDDP
    ASYTARAQRIVSDGYLALLAESQRQT

    >gi|271970255|ref|YP_003344451.1| hypothetical protein Sros_9085 [Streptosporangium roseum DSM 43021]
    MTNAVAYPARPNVAEKLSDILSSRAPSCDVEWADRTRPGQFNHEGDSTPHIALNSDEPGIRGLFKYRPDAAFPLNGLVEV
    LLFRENSLSRGERELIATYVSALNECRF
    CFFTHAAIAAAHLPEGMTLVEQVRADLDAAPVSEKMRALLVIAAAVQQGGKK
    VSRADVDAARAAGATDMEIHDTVLIAAAFCMYNRYVDGLGTIATDDPAHYAVRAQRSDGYLAVLTDALSQG

    >gi|271970310|ref|YP_003344506.1| thioredoxin [Streptosporangium roseum DSM 43021]
    MIMITLTAENFAEQVLQSDKPVLVDFWAEWCPPCRMIAPILEQIEAEHGDRVTIAKLNYDEHQEIAARYGVMGLPTLNLY
    KGGEVVQQIVGAKPKRMLLADLEDHI

    >gi|271970541|ref|YP_003344737.1| thioredoxin reductase [Streptosporangium roseum DSM 43021]
    MDVRNVIIIGSGPAGYTSAVYSARADLKPLIFEGSVTAGGALMNTTEVENFPGFPDGIMGPDLMDNMRKQAERFGAELIA
    DDVVEVDLTVTPKVVRTATDTYHAKAVILAMGSGYRELGVPNEKRLSGHGVSW
    CATCDGFFFRGQDIVVVGGGDTAMEEA
    IFLTRFAGSVTVVHRRDELRASKIMQDRAFANEKIRFVWDSEVADVLGESKVSGVRLRNLKTGEESELPATGLFIAIGHD
    PRTELVKGQVELDDEGYIKVDSPSTRTNLDGVFAAGDVVDHTYRQAITAAGTGTAASLDAERWLSDHDDN

    >gi|271970542|ref|YP_003344738.1| thioredoxin [Streptosporangium roseum DSM 43021]
    MGAIKNVTDASFDADVLKSDKPVIVDFWAEWCGPCRQVAPILEEIANEQADKLTIVKLNVDENPSTAGNYGVLQIPTLNV
    YKNGEVVKQIIGAKPKAMLLRELEGII

    >gi|271965293|ref|YP_003339489.1| phytoene desaturase [Streptosporangium roseum DSM 43021]
    MSPIVVIGAGLGGLSSAVRLAAAGRDVTLVEARETPGGCCGTASVGDYRFDTGPSVLTMPDVLADVFAAAGEDMESLLPL
    RRLDPYYRLRYHDGSHLDIVPGEEAMTEQVRQLCGAAEADRYRRFRARLGELFACEWPSFVDRDMTRLRSLAQPGVLARL
    AALGGFRRLDRLVKGHLTDARLIKAHTFQSLYVGLSPQRALGIYAVIAHMDTVGGVFFPRHGGMHAIPRAMAAVAEKAGA
    QIRYGVRAVGIETGPSGVSAVRLDTGERLAAAHAVVACDLPHAHTGLLPGAARDWRLRRPRYSPSCLVLHFGLDRRLAGQ
    AHHTLHFGREWSSTFSALNAGRPQPDPSLLVTYPESDTGAAPTGHATLTVLEPTANLDGANGVNGWDGLTSRLEDRLLGR
    LADLGYGDLTTALRLTVDPPAWARLGHSAGTPFAMDHRFTQTAWFRPAGTARRVPGLHFAGMYTAPGVGVPPVLISGKLA
    AERILETSR

    >gi|271968369|ref|YP_003342565.1| hypothetical protein Sros_7127 [Streptosporangium roseum DSM 43021]
    MEARMKSPANADVMTAIQGLYKAMHSGGVDPRVLGLVHLRASQINGCSPCVFAGIASAKKHGETDERLHNVVTWRETPFF
    TEGERAALALTEAATRIQDGAPGVTDEIWDAAATHFDEKQLSAITLNIAMTNFFNRINHTNREQAGKTW

    >gi|271968355|ref|YP_003342551.1| hypothetical protein Sros_7113 [Streptosporangium roseum DSM 43021]
    MKARMNVAQLAPEGYQAMLGLEKFLAGSKLPHATLELVKLRASQINGCGFCVDMHSHDAKKAGETDERLFSVAAWREAPY
    YTDAERAALALAEEATRLSDRGETVPDHVWDEAARHYEPEMLATLVIAIAAINAWNRIAVTTRAVAGSLRNQTG