Bacillus megaterium DSM319 uid48371

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|295702513|ref|YP_003595588.1| organic hydroperoxide resistance protein [Bacillus megaterium DSM 319]
    MKALYETTVVNTGGRTGEVHSLDNIFNLDVATPPALGGEATTATNPEQLFAAGYSACFNSALEFMLKKHNVEIKSSEVKA
    TVQLLPDKADQGVKIGVALEAHIEGLDLETAKKYVDLAHSY
    CPYSKAISGNVDVTVEVV

    >gi|295702544|ref|YP_003595619.1| methionine-S-sulfoxide reductase [Bacillus megaterium DSM 319]
    MEKATFAGGCFWCMVTPFEELEGIHGIVSGYMGGTVDNPTYGQVKSGTSGYYEVVQITFDPEVFPYKRLLDLYWPQIDPT
    DDGGQFQDRGSQYRTAIFYHNDSQKQAAEETKLEVAESGRFKKPIVTSILPASTFYEAEEYHQDFHKKNPKHYKEDRAKS
    GRDEFIETNWK

    >gi|295702601|ref|YP_003595676.1| putative thioredoxin peroxidase [Bacillus megaterium DSM 319]
    MTAVVGEKAPDFVLMSTNGEQVSLASMKGKNVVLYFYPKDMTPGCTTEACDFRDQHENFEELDAVILGVSPDPIDKHHKF
    IDKHGLPFLLLADEDHSVAEEYGVWTLKKNFGKEYMGIERSTFIINKEGMLVKEYRKVRVKGHVEEALSFIKEKMA

    >gi|295702716|ref|YP_003595791.1| adenylyltransferase ThiF [Bacillus megaterium DSM 319]
    MINRYSRQELFQPIGKGGQQQIQEKHVLIVGAGALGTGNAEALARAGVKKITLIDRDYVEWSNLQRQQLYSEKDADKRIP
    KAIAAKKRLHDINHDVKVEAHVADGTPQVLEQLVEGVDVMIDATDNFDTRLVMNDLSQKYDIPWIYGACVGSYGISYTII
    PSETPCLSCLLESVPLGGLT
    CDTVGIISPAVQMVVAHQVTEVLKILVGDWNALRRELVSFDVWKNEYTSINVNVFRKSAC
    RSCGSEQTYPFLQYENQTKTAVLCGRNTVQIRPGKSAKQPLQSLGERLKEKGYKIEQNPYLLSFYVDDYRLVMFQDGRVF
    VHGTNDIVEAKSLYHRYIG

    >gi|295702852|ref|YP_003595927.1| competence regulatory protein Spx [Bacillus megaterium DSM 319]
    MVTLYTSPSCTSCRKAKAWLEENDIGYTERNIFSEPLSIDEIKEILRMTEDGTDEIISTRSKTFQKLDVQVDAMPLQDLY
    ELIQQNPGLLRRPIIIDEKRLQVGYNEDEIRRFLPRKVRTFQLREAQRLVNG

    >gi|295702862|ref|YP_003595937.1| hypothetical protein BMD_0724 [Bacillus megaterium DSM 319]
    MHQLCQGSNKKPLEIYVFVDPLCPECWALEPILKKLQIEYGQLLSLKHVLGGNLQQLNIGAQQKFEHIAKSWEKTGSRSG
    MSCDGNLWLENPIDTPYAASIAIKAAGLQGKKQGIRFLRRLQEVVFLEKQNVTEESVLIQCAKHVGLDVDEFVKDLHSDY
    AAKAFQCDLKITSEMDVDEIPTLVFFNEKVEEEGIKISGYYSYETYVHIIKEMLEIDPDPACLPPLRSFLSYFQFVASKE
    VAVVYGLSLEEAEKELKKLQLQQVVERVPVKYGTFWRSTEKSC

    >gi|295702899|ref|YP_003595974.1| DSBA-like thioredoxin domain-containing protein [Bacillus megaterium DSM 319]
    MKAHIEFYFDFVCPLCFLATKPLREVMKEQKAEIEWKPFELCPEPAQQMEQIEDFLERPWNQSIAPLAQQLHVEINMPES
    PPVPRTHLAHEGFHFAKKHGQESAYVDAVFKAYWEDEKDISQTEVLAEIADSLHLDQEIFIRILKDRTFEQVHKDSLVHA
    YENAHITKVPTLKIGSRVFQGFASKKTIEKELLHERSAKDREK

    >gi|295702915|ref|YP_003595990.1| nitrate reductase electron transfer subunit [Bacillus megaterium DSM 319]
    MTKQKLILIGNGMAGMRCIEEILIHSPDCFDITVFGSEPHVNYNRILLSTVLQGSTKLEDINIHSLAWYKENNITLFKGE
    SVTHIDTKRKIIKTDKNRETSYDKLIIATGSSPYMLSVKGADKEGVLGFRTIED
    CQEMIKISKQYKKAAVIGGGLLGLEA
    ARGLLNLGMDVQVIHHSGFLMERQLDRAASAMLREELEKQGMSFLLNKHTDEIIGENRAEGVLFNDSSKIAADLVVMATG
    VRPNVNLAKKSGIETNRAIIVNDYLETSIPDIYAIGECAEHRGMTYGLVAPLYEQGKVLARHLCQIKNDGYRGSVLSTRL
    KISGIDVYSVGEFKENQGAKAITISNMLDGIYKKVVFREGKIVGAVLFGDTSEAIKLSQMINEKKDLSQAEKVQLFPSQH
    EKENAVTSMPLTDIVCNCNGVTKGAIIEAVQKNDLTTVDEIKNCTKASGSCGGCKLLVTDLLTYIQSDEFDEVIEKKTFC
    TCTHLSEDELVREMQQYQFETVQQVRKILKFKDMKGCSLCEGGLHYYLDMMNPHYENNRHSLFTTENDQAVLLHDGTYAV
    VPQIHGGLTNVQELRNIANVAERYNISNIRLTSDQRIQLIGVKKEYLPLVSEEIDRGLQQLYERTVKNVSVYIGKGTCIC
    QYEPALALSNELDKQLEYVKTPCDIKISIASCSHIAENVTTNDIGLRRIDRGWEIYVGGSRAEARSGELFYVAETNEEAV
    EISCSLIQYYRETGNYLETVGSWIERVGIVHVREVLFEVDNREYLIKQLSSERSRAITYLL

    >gi|295703126|ref|YP_003596201.1| 2-cys peroxiredoxin [Bacillus megaterium DSM 319]
    MAERMVGKQAPRFEMEAVLANKEFGKVSLEENMKNGKWTVLFFYPMDFTFVCPTEITALSDRYEEFEDLDAEVVGVSTDT
    IHTHLAWINTDRKDNGLGDLNYPLAADPTHAVARDYGVLIEEEGVALRGLFIINPEGELQYAVVNHNNIGRSVEETLRVL
    QALQTGGLCPANWKPGQKTL

    >gi|295703127|ref|YP_003596202.1| antioxidant, AhpC/TSA family [Bacillus megaterium DSM 319]
    MKLREQMPELTGATSWINDEVTKEDLVGDKATLIHFWSVSCHLCKEAMPEVNDLRDEYDDQLNVVAVHMPRSEDDLDMGV
    IEAMAMGHDITQPIYVDSEHKLTDAFENKYVPAYYVFDKEGQLRHFQAGGNGMPMLRKRINRVLGEE

    >gi|295703337|ref|YP_003596412.1| peptide methionine sulfoxide reductase MsrA/MsrB [Bacillus megaterium DSM 319]
    MTEQYEVATFAGGCFWCMVKPFDEQPGIIKVVSGYTGGHKENPTYKEVCSETTGHYEAVQITFDSEVFPYEKLLELYWPQ
    IDPTDAGGQFADRGDSYRTAIFYHNEHQKALAEESKQQLEASGRFSEPIATQILPAKPFYEAEEYHQGYYKKNKFRYAMY
    RRGSGRDRFIKENWKDFGRDEQLKTTLTPIQYEVTQNDATEPPFRNEFWDHTEDGIYVDIVSGEPLFSSTDKYDAGCGWP
    SFTKAINKDEVKENMDVSHNMVRTEVRSKTANSHLGHLFDDGPQDAGGLRY
    CINSAALRFVPKEDLEKEGYGEYTVLFNK


    >gi|295703364|ref|YP_003596439.1| O6-methylguanine DNA alkyltransferase [Bacillus megaterium DSM 319]
    MYYGEMNLFSDLKIYIVASETGVQHIWFDSDDHNEQLKELVHDENYHHVKEAKRQLQDYAEGRTLTFDLPLDIKGTDFQK
    EVWLTLKGIPYGQTWSYSDVAESVNRSKAVRAVGQANRRNPLPIILP
    CHRVIGKNGALTGYAGSQTHIKEKLLMLERNVA
    KGALELK

    >gi|295703377|ref|YP_003596452.1| NADH dehydrogenase [Bacillus megaterium DSM 319]
    MKRVVIIGGVAAGMSAASQLRRMKEKEEVEILVFEKGGDISYSACGMPYYLSGVVKEKDDLVARTKQEFEERNISVHLFH
    EVKEVNHTKKYIVVQNVKTQTEKEVTYDELIIATGTTAVEPNFMSDNMPNVCTLKSLADSERIYTYLQAHSVEKVTIIGG
    GYVGMEVAEAMKALGKEVRVIEQGKQILSILDQEMAEHLQKQLDDDILFHFEEEVEALLHSDGFVTHVQTNSQTYQTDLV
    IVNVGVRPNTQFLERNGLRMLENGAILVNEKLETNVPHIYAAGDCATSYHRVLKKDVHIALGTIANKQGRVLGYRLGGEK
    REFPGVVGTSIVKVMDYEIGKTGISEREARENSLLYKAITAEAPSHASYYPGAEKIVIKLVYHPETKEILGVQMIGKEGV
    SKRIDVFATAITCRLTTDEITMLDLSYAPPFATVWDAVQIAAQKAE

    >gi|295703442|ref|YP_003596517.1| glutaredoxin [Bacillus megaterium DSM 319]
    MRSIELYTQPACPPCEIVKQFLQHHHVSYKEFDVSKDASARKRMTTELESYSTPTIRIDQEIIRGFDLQALEKLLNIG

    >gi|295703450|ref|YP_003596525.1| putative 2-cys peroxiredoxin [Bacillus megaterium DSM 319]
    MPERMVGKQAPRFEMEAVLSNKEFGKVSLEENIKNDKWTVLFFYPMDFTFVCPTEITALSDRYDEFEDLDAEVIGVSTDT
    IHTHLAWINTDRKDNGLGDLKYPLAADTNHVVSREYGVLIEEEGVALRGLYIISPEGELQYSVVNHNNIGRDVDETLRVL
    QALQTGGLCPANWKPGQATLNA

    >gi|295703451|ref|YP_003596526.1| thiol-disulfide isomerase [Bacillus megaterium DSM 319]
    MKLRQPMPELTGATEWLNGEVTKEQLIGEKPTLIHFWSVSCHLCKEAMPQVNEFRDQYKDQLNVVAVHMPRSEDDLDLSK
    IKEVAAEHDITQPIFVDSEHKLTDAFENQYVPAYYVFDKTGQLRHFQAGGSGMKMLEKRVNRVLGENE

    >gi|295703465|ref|YP_003596540.1| pyruvate dehydrogenase complex E3 component, dihydrolipoamide dehydrogenase [Bacillus megaterium DSM 319]
    MVVGDFPIETDTLVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALIAAGHRFEHAKHSEDMGIIAEN
    VTVDFSKVQEFKNGVVNKLTGGVEGLLKGNKVDIVKGEAYFVDSETVRVMDENSAQTYKFKNAILATGSRPIEIPGFKFS
    ERVINSTGALALKEVPKKLVVIGGGYIGTELGTAFANFGTEVTFVEAADEILAGFEKQMSSLVKRNLKKKGNVEIYTKAM
    AKGVEETADGVQVTFEVGGESKVIDADYVLVTVGRRPNTDELGLEQVGVKMTDRGLIEIDNQTRTSVSNIFAIGDIVTGP
    PLAHKASYEGKIAAEVIAGEPAEIDYLGIPAVVFSEPELASVGYTEAQAKEEGLAVKASKFPFAANGRALALNAAEGFLK
    LITRKEDGVVVGAQIAGPSASDMIAELGLAIEAGVTAEDIALTIHAHPTLGEITMEAAEVAIGSPIHIVK

    >gi|295703631|ref|YP_003596706.1| protein disulfide isomerase [Bacillus megaterium DSM 319]
    MKIEVWSDFVCPFCYIGKRRLEQALRQFAHKDDVQVEFKSFELDPNAPVNTGKTINEALAAKYGMTIEQAKQANEGIGQQ
    AASVGLSFNFDDMKPTNTFDAHRLAKFAKAQGKEAAITEKLLYAYFTESKHLGEEETLVAVAEDAGLDREEARQILADKN
    AYANEVRSDEATAQQYGISGVPYFVVNQKYAISGAQPVETFVGALQQVWEEENPTPALKSLSPEGADDAFCADGQCAVPD
    SSKNQQ

    >gi|295703700|ref|YP_003596775.1| hypothetical protein BMD_1567 [Bacillus megaterium DSM 319]
    MTNQKETGWNLRNSYAELPNIFFTPLDPNPVSSPKIVKFNDSLAASLGLQKEQLQSPEGVSILAGNSFPKGAFPLAQAYG
    GHQFGHFNMLGDGRAMLIGEQVMPSGKKVDLQLKGSGRTPYSRGGDGRAALGPMLREYIISEAMHALGIPTTRSLAVVTT
    GEAIVREKELPGAILTRVASSHLRFGTFQFAAKWGTVENLQALADYALERHFPYIEKNEKKYLSLLQEVIKRHATLVAKW
    QLIGFIHGVMNTDNMTISGETIDYGPCAFMDTYDPETVFSSIDVQGRYAYQNQPGITGWNLARFAEALLPLLDQDIEKAV
    EIAQSAVTEFPKFYRENWLAGMQAKLGLFNEEKEDEALFQDLLTIMKTYKADYTNTFRALTAEKLENSDLFESKEFAQWH
    ELWQKRLGRQQQSKTESQELMKNNNPAVIPRNHRVEEALDAAQKKDYSVMETLLEVISSPYESPGQPEYCTPSAPSNQPY
    QTY
    CGT

    >gi|295704003|ref|YP_003597078.1| acetoin dehydrogenase E3 component (dihydrolipoamide dehydrogenase) [Bacillus megaterium DSM 319]
    MKPLVVIGGGPAGYVAAITAARQGKQVTLIEQKDLGGTCLNEGCMPTKSLLASAETYEKIKQAEQFGINLPLEQVKINWD
    GVQHHKTTIVKNLVKGISYLMKKNSIKVIKGEASFLTNHCLAVRNEYHVEEIEAEQFIIAAGSEPASLPSAPFDGKWIIH
    SKQAMSLPAIPSSLLIVGGGVIGCEFASIYSQMGTKVTIVEAADQLLPGEDADIAFTLQEELEKKGVAIYTSSSLTEMQP
    KDKTALFKHKEELHELHAEYALISIGRKPRVLGLGLEQVGVHFSKQGIDVNEHMQTNIPNIYACGDVVGGIQLAHVAFHE
    GTVAALHACRKDKSVNYRAVPRCIYTHPEIASVGMTEKQARSEYGDIRVGEFSFTANGKAMIANESVGKVKVIVEPQFNE
    IIGLSIVGSYATELIGQGTIMMHGELTTDIMEDFIAAHPTLSEAIHEALLQSAGQAVHS

    >gi|295704024|ref|YP_003597099.1| copper-translocating P-type ATPase [Bacillus megaterium DSM 319]
    MSDKQKEATLQITGMTCAACSNRIEKGLKKIEGVKEANVNLALERSTIIFDPSKTSPQAFEEKIEKLGYGVVSEKAEFAI
    TGMT
    CAACSTRIEKGLNKLDGVTRASVNLALETASVEYSPSQIAPQDITQRVEKLGYGAKLKSEEKEEEQSYREKELSKQ
    KGKFWFAFILSVPLLWAMVSHFTFTSFIPLPHMLMNPWVQLALATPVQFVVGKQFYVGAFKALRNKSANMDVLVALGTSA
    AYFYSLYFSLKSLGSSAHTNQLYYETSAILITLILLGKLFEANAKGRSSEAIKKMMGLQAKTAVVIRDGAEVEIPVEEVQ
    KGEVIFIKPGEKVPVDGEIIEGQSALDESMLTGESVPVDKNIGDKVIGATLNKNGFLKIKATNVGRETALAQIIKVVEEA
    QGSKAPIQRLADYISGIFVPIVVGIALLTFFVWYIWIAPGEFAPALEKLIAVLVIACPCALGLATPTSIMAGSGRAAEFG
    ILFKGGEHLEATHKIDTILLDKTGTVTNGTPELTDVRIAQGCEENELLQLVASAERLSEHPLAQALVAGIKNKGIEIQDP
    LSFEAIPGYGVKATVQERELLVGTRKLMNQHKVNIDTALEEMTNLEREGKTAMLVALDGKYAGMLAVADTIKATSKEAVS
    RLKEMGLEVMMITGDNSQTAQAIAMQAGIEHVIAEVLPEGKAEEVKKLQQQGKKVAMVGDGINDAPALALADIGMAIGTG
    TDVAMEAADITLMRGDLMSIADAIEMSRKTISNIKQNLFWAMGYNTLGIPIAAVGLLAPWVAGAAMAFSSVSVVLNALRL
    QRVRL

    >gi|295704056|ref|YP_003597131.1| 3-mercaptopyruvate sulfurtransferase [Bacillus megaterium DSM 319]
    MNTIISPVDLHTALQQPQHSIVLLDCRFTLGNSEAGASAYQNEHLPDAHYLDLEKDLSSAAASLGGRHPLPDVQKLAQKL
    GSLGINADSKVVVYDEQNGMMASRAWWLLRYIGIEDVKILNGGFNNWNQSGYETTKNVPEASPQTFVPFVQQDWGLAGVE
    YVKENLHNPNVILIDSREKRRYLGLEEPIDFVAGHIPGAIHSFWQDVLTSEGLWKTDKEWKEMFSAIDSHAEIIVY
    CGSG
    VSACPNVLALKSAGFPNVKLYAGSWSDWISYRDNPIEKTR

    >gi|295704068|ref|YP_003597143.1| glutathione peroxidase family protein [Bacillus megaterium DSM 319]
    MSVYEYSAKTIKDEDVSLSNYQGDVLLIVNTASKCGFTPQYKDLQALYEEEKENGLTVLGFPCNQFGGQEPGSSNDIEQF
    CELNYGVSFPMFAKVDVKGEHAHPLFTYLAEQAPGLLGSKGIKWNFTKFLVNRQGEVVKRYAPQTAPKDIQKDIKELL

    >gi|295704076|ref|YP_003597151.1| Thioredoxin [Bacillus megaterium DSM 319]
    MKQFTEEKQFREQIKNETLSVGIFTTTWCPDCKRLDMFIDEIVDENTDKAWFKIDKDEFEELSAENNVMGIPSLLVYKNG
    EKIAHLHSANAKTPEAVREFLATL

    >gi|295704131|ref|YP_003597206.1| methionine-S-sulfoxide reductase [Bacillus megaterium DSM 319]
    MKEYATFAGGCFWCMVAPFDQLTGILSIRSGYARDEQISSEASALVKKENEYVEAVQIVWDSSHITFEELLNLYWQQIDP
    TDSAGQFSDRGPSYRAIIFYHNEKQKEAALDSKRKLVQSGRFKNPIVTPILPFSSFYEAEEQQQDYYRKNTFHYKLYKEG
    SGRTDFLTQHWPKDRSYLKKILTPMQYFVTQENGTEPPFTNLYWNNKKQGIYVDLLTGEALFKTSDQLPSHTGWPVFKRP
    ILYGNIKKVPMQHETVLKSKEGNNYLGLLLTEENSEYYQVNSAALRFIPKEKLKEEGYEDFLILF

    >gi|295704148|ref|YP_003597223.1| glutaredoxin family protein [Bacillus megaterium DSM 319]
    MSAKILLWNRKGCHHCEELKAYFHEKGYQYESIDVEGKDYLRDLLEIRYGIRHVPVVEIGAEGQFKGVIEKDYEQIEKLI
    EDYSPIVK

    >gi|295704318|ref|YP_003597393.1| NADH dehydrogenase [Bacillus megaterium DSM 319]
    MKIAVVGCTHAGTAAVKNMAELYPEAKITVYERNDNVSFLSCGIALYVGGVVKDAKGLFYSSPSELQEMGVNMKMKHEVT
    NIDTEGKKIAVRNLETNEEFEDTFDKLVMTTGSWPIIPNLEGIDLNNVVLCKNYQHANHIIEKAKQAKKIAVIGAGYIGA
    ELVEAFEVYGKEVTFIDSADRILNKYLDPEFTNLMETEFENRGVKLALNQAVTKFVGSEGSVEKVMTTDGEYEADLVILC
    VGFRPNTDLVKGQVDMLPNGAIVVDEYMQTSKKDIFAAGDSCAIYYNPIKKHAYIPLATNAVRMGTLVAQNLVKPTIKYM
    GTQGTSGLHIYDYNVASTGITETAASLFDMNVKSITISENNRPEFMPTYENITLKVVYEEETRRIVGAQVISKIDATQAI
    NTLSVCVQQEMTIDELGFIDFFFQPHFNKPWHFLNQAGLQALQA

    >gi|295704354|ref|YP_003597429.1| organic hydroperoxide resistance protein [Bacillus megaterium DSM 319]
    MSDVLFTSKATAVGGRDGRVKSDDGIIDLTLVNPSPNNKEEGTNPEQLFAAGYSACFDGALNLIAKKQKKDIDSSITAEV
    SLLKDHTDDGFKIGVVLNAHIKGVSQEVAEKLVEDAHQF
    CPYSKATRGNVNVTLNTTAE

    >gi|295704502|ref|YP_003597577.1| rhodanese domain-containing protein [Bacillus megaterium DSM 319]
    MTERKPYQVLLYYLYTPIENPEEFTAEHLAFCKELELKGRILIAAEGINGTVSGTVEQTDKYMETMKNDPRFEGIVFKID
    EADEHAFKKMHVRHRKELVTLRLEEDVNPLRVTGNYLSPKEFYQAMQDENTVVIDARNDYEYDLGHFRGAVRPDIRNFRE
    LPEWIRDNKDQFEDKKILTY
    CTGGIRCEKFSGWLLEEGFEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERISVPVNQ
    KEHVIVGKDHFTGEPCERYVNCANPECNKKILASEENEHKYLRACSHECRVSPRNRYVKEHGLTEEEFAARVKELEKEHV
    TL

    >gi|295704658|ref|YP_003597733.1| hypothetical protein BMD_2538 [Bacillus megaterium DSM 319]
    MKLTVTEAAATWYKDEMMLEGNETIRFFVRYGGCSNVQKGFSLGVNTDSPKNVGVETKVDGLTFFVEDEDLWYFDGHDLT
    VNYNEETKEPDFHYEA

    >gi|295704665|ref|YP_003597740.1| AhpC/TSA family protein [Bacillus megaterium DSM 319]
    MVKKIIAVLLLVGFLSYALWQGLSPNGASDNSNLSEYKDLNIKKGDSARQASGQAYGLEPKDTAPPFTLSDTSGKSVQLS
    DFKGKKVILNFWATW
    CPPCQKEMPDMQAFYEKYGNDVQLLAVNLTSSEGSKQAVSKFLKEKQFTFRVLLDDQDSVGSKKY
    RVSTIPTSYFIDEEGKIVQRVNGPMTLKQMENFAQQAAN

    >gi|295704892|ref|YP_003597967.1| alkylhydroperoxidase AhpD family core domain-containing protein [Bacillus megaterium DSM 319]
    MSDDTLYKKSYLNRLGELKERSPKVAAKFMQFEHEVFNTGTIPPKIKELIAIAVAHTTGCPYCIEAHVAKYKKLGGTMDE
    ILEAVTVAAALKAGAAISHSVNAINAFERE

    >gi|295704920|ref|YP_003597995.1| pyridine nucleotide-disulfide oxidoreductase family protein [Bacillus megaterium DSM 319]
    MTDKYDCVIIGGGIAGLQAAIQLGRYKRSVLVIDSNDGRSNLCKNYQNILGWSEGISGQTLRETGRQQAKSYGIQFAEER
    VLQCEKEIEGFNVITNSANYEAATLLFATGVVDRIPPKLQQELYPCMGTTVYV
    CPDCDGYEVNNRRVLVLGSGKAGASLS
    LTLTYWTNDITYINHDKKEIGPLADTLMQKGITYKEAAVKKVIAEADMLKGVILENDEFIYGEKGFLAFGGNKVRTELAH
    KLGAELLENQHIIVNPRTKETNVSNVWAAGDIVAHSEQVTVAMGEGLQAAIWIHKRLLELYEK

    >gi|295704954|ref|YP_003598029.1| hypothetical protein BMD_2838 [Bacillus megaterium DSM 319]
    MAQTLHSSYKSKPTTVVTELSPMQKPLFAGGVIAAVILFLAIVLTTNWTQGVLFIIGLALGMTLLYARFGFTSAFRRLVS
    VGNVQGLQAHMLMLAIASTLFAIILSTGFSFTGVTPKGYVSPVGVSVIVGSFMFGIGMQLGNG
    CASGTLYSLGGGSSSMI
    LTLLAFIVGSMFGAYHLPFWQKQPSLPPISLAESTGLGYFGAWIIQLIAFAAIYWITIQIAKKKNPPMMKQLPTTKGWKK
    IIRGSWPLFTAAIVLAVLNALTLAVRGNPWGITSAFALWGGKAMMAAGIDVSSWGFFQGANGEALTQSVLADSTSVLNFG
    IILGAFISATAQGTFKPGKIKPGVAGAAVVGGLLMGYGARLAFG
    CNIGAYFGGIASFSLHGWVWMVMAMLGTGLALFIRP
    IFGLKNPKSNDSIC

    >gi|295705045|ref|YP_003598120.1| OsmC/Ohr family protein [Bacillus megaterium DSM 319]
    MAKHHFHLQANWPGGRNEVGTIESGQLKTQISIPPEMDGPGVGTNPDEMLLGAAATCYIITLAAMFERSGIRQEALTMES
    EAVVDVTNGVFTYEKIIHKPHVIITPELTAQEEKISRLIKKAETS
    CMISRAIQGNVEIELEPRLTVKA

    >gi|295705130|ref|YP_003598205.1| hypothetical protein BMD_3015 [Bacillus megaterium DSM 319]
    MHITPEAKQLINNILEEQEITGIRLYFKGISCEIPNIGLAFEEPFENDEMYEVDGVQVAMEASIVPYTNELMLDVHTTPY
    GPGLALVGAKEAE

    >gi|295705279|ref|YP_003598354.1| cadmium-translocating P-type ATPase [Bacillus megaterium DSM 319]
    MKHEDKKSHQHTGSCCSGSSSVEIESKTCCSSSSEAASTEEPSSCGTKSHEHSHSCCSDTIALTTDKGQHSCCSDHDIVP
    GDSDIEETAEYRVYGMD
    CPSCAATIEKSLKTLNDIQHVTLNYNTGKLQVAAASESALSLIPSSVEKLGFNIEAIQSNKKM
    KTYLIEGMD
    CAACANTIVNHLKTVPAVKDVRVNFSTGKAQIEHDNEANDIIKEVSKAGYTATLVTSSRQSAESRHHKGQN
    GPIVFSGIFIALGFIGSHTGIASYMTTVLYAIAMIVSGYKPAKSAYYGIKSRSLDMNVLMTVAALGAAVIGEWLEGATVV
    WLFALGVALQTRSIEQTRNSIRGLMDLAPSEAWVKENGQLIKKAAGDISIGTTIVVKPGDRIPLDGEIINGESSINQAPI
    TGESIPVDKVIGDTVYAGTINENGSLEIKVTKLVEDTTISKIIHLVEEAQEKKAPTQAFVDKFATIYTPIVFILALFIMV
    IPPLFDGAWSEWFYKGLELLVVACPCALVISTPVAIVSAIGNAAKNGVLIKGGTFLEKAGAINAIAFDKTGTLTEGKPAV
    SEIVSLAAEENQLLAITKTLEDYSNHPIARAIVDYAAEKKVVSLQGSNYKILTGKGVQATIKDTVYYAGNAKLFSDLETP
    LSHCWSHIEKLQNEGKTIIIIGTAKSVLGIISVADTIRHTTVSALESLKQNGMQQIVMLTGDNEGTAKMIASQSRVDRYF
    ADLLPEDKVKAIQQLQDEGYQTAMVGDGINDAPALATADLGIAMGGAGTDTAMETADIVLMADNLEKLPHTMKLSRKALA
    VIKQNIWFSIIVKVIALAFIFPGWLTLWIAVLSDTGAALLVILNSLRLLKMKN

    >gi|295705305|ref|YP_003598380.1| thiol-disulfide oxidoreductase BdbD [Bacillus megaterium DSM 319]
    MSKAKKKKKVTPNQQTSSSKWIFWVIGIIAVCILGLIVLSNMSKGGGDEKAALTYDNQPYLGKESAPVEVVEFGDYKCPA
    CKNFTESFFPLIQKDYVDTGKVKFYFMNYAFINNDSSRAAEFAETVYKELGNDTFWKFHELLYKKQNAADEKKDVLTESY
    LEDTLKEVSRDADAKKVASAFKDGKGKDAFDQDMKTANNLGITGTPTIYVGGKKFEGKTIDDFDQMVKDAAKENK

    >gi|295705460|ref|YP_003598535.1| hypothetical protein BMD_3345 [Bacillus megaterium DSM 319]
    MMQANVVLDAKGLACPMPIVKTKKKMNELEAGQVLKIQATDKGSTADLQAWAKSTGHEYLGTETAGDVLHHFLRKGYAEK
    NVTPIPEISLEEFAKKVENDEHLLILDVREVEEYDEAHIPGVVHIPLGEVEKRSNELNKENEIYII
    CHSGRRSEMAGQTM
    KKQGFKNVINVVPGMRDWTGKVE

    >gi|295705461|ref|YP_003598536.1| rhodanese domain-containing protein [Bacillus megaterium DSM 319]
    MKTIAAQEVEQLVKKQEQIHILDVREVEEVKTGKIPNALNIPLPLLEFRMQELDKTNNYIVVCRSGGRSGMAARFLEQQG
    YSVTNMTGGMMEWKGETV

    >gi|295705462|ref|YP_003598537.1| putative rhodanese domain-containing protein [Bacillus megaterium DSM 319]
    MIINALIIIFLLWFLYQRFAPVKGIQQIATTELKAKLKNKNNQFIDVRTPHEFRTKHIKGFRNIPLSELPAQTGQLSKDR
    EVVVI
    CQSGMRSMKASKLLKKQGFTSITNVKGGMNTWR

    >gi|295706462|ref|YP_003599537.1| cytochrome c biogenesis protein [Bacillus megaterium DSM 319]
    MKKKRLIIRTVILAVLLCAVGYTLYAQFFADKQKVSVGDKAPDFILRDVNGEIHQLSDYKGKGVFLNFWGTWCKPCKQEM
    PAMEKQYASYKKQGVEILAVNVAETNIAVEQFAKQYELSFPILMDKDSQVLGAYGIDPLPTTFLIDKNGKIVDSFIGGLE
    ESKIKEYMEEIKP

    >gi|295706501|ref|YP_003599576.1| hypothetical protein BMD_4396 [Bacillus megaterium DSM 319]
    MNITFTDKAIAKVQEKYGKDSSLYLKLKYDTDGCGCVVSGVTTLWIVDEKESDDVIIETNFVPVLVEKTKQVFLDDNMTI
    DYNESAYAFMLKCPSQILNPRMSFIDKTKEAL

    >gi|295706531|ref|YP_003599606.1| branched-chain alpha-keto acid dehydrogenase complex dihydrolipoamide dehydrogenase [Bacillus megaterium DSM 319]
    MAKEYDLVILGGGTGGYVAAIRASQLGLSVAVVEKNKLGGTCLHAGCIPSKALLRSAEVYQTAKKSSEFGVETSNVLLNY
    ARVQERKSEIVSQLHNGVKQLMKKGKIHVYEGIGRILGPSIFSPMPGTISVELKSGEENEMLIPKNVIVATGSRPRTLPG
    LTIDGEKVITSDEALKMETLPASIIIVGGGVIGIEWASMLTDFDVDVTVVEYSDRILPTEDQDISREMTKLLKAKGVNII
    TSAKVMADTLSIDGQVKISAQVGDNMQEYEAEKLLVSVGRQANVEGIGLENTDIVVENGVIATNDFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHLHGEKPLKIDYTTISKCVYSSPEAASVGLTEQEAKQHGFQLKVGKFPFKAVGKALVYGEA
    EGFVKIIADADTNDVLGVHMIGPHVTDMISEAGLAKVLDATPWEIAHTIHPHPSLSEAMGEASLAVDGKAIHF

    >gi|295706572|ref|YP_003599647.1| rhodanese-like domain-containing protein [Bacillus megaterium DSM 319]
    MSAITAVLILLGVIIIYSVVMFFVQRRIMKTLTEEEFRSGYRKAQLVDIREPNEFENGHILGARNIPLSQFRMRIKEFRP
    DQPVYIY
    CQSGMRTGRAAQMLRRHGVQEIYDLKGGFKMWNGKVKKKK

    >gi|295706586|ref|YP_003599661.1| regulatory protein Spx [Bacillus megaterium DSM 319]
    MEEIKFYTYPSCTSCRKTKKWLVKEDVNFKERHLFRETPTHKEMLELLSMTTEGMDELLAKRSQEYKKLNVDVDSMTLSE
    VVNLLIEHPRLLRRPILTDGKKLVVGYNESALKNLVKKKTSLASLVV

    >gi|295706813|ref|YP_003599888.1| thioredoxin [Bacillus megaterium DSM 319]
    MAIAHATDKNFTDEIKSGLVLVDFWAPWCGPCKMIAPVLEEIDGELNDKVKIVKVDVDENQETAGKFGVMSIPTLVLFKD
    GEKVDQVVGFQPKEALTELINKHA

    >gi|295706879|ref|YP_003599954.1| thiol peroxidase [Bacillus megaterium DSM 319]
    MTKFKGNDVTLLGNQVKVGDKAPNFTVLANDLSEVTLDSTKGSVRLISVVPSIDTGVCDAQTRRFNEEAAKLDNVKVLTV
    SVDLPFAQKRWCGANGIDNVQTLSDHRDLSFGEAYGVAIQELRLLARSIFVVDSNDNVTYVEYLPEVTEHPNYEAAIEAA
    KTAK

    >gi|295706913|ref|YP_003599988.1| thioredoxin [Bacillus megaterium DSM 319]
    MEKMQTIEQYKEIIKEGKHIMMFSADWCPDCRVIEPVLPEIEANHSEYTFHYVDRDDFIDLCAELSIFGIPSFVGYSNGE
    ETGRFVSKDRKTKEEIEEFINGLNA

    >gi|295706929|ref|YP_003600004.1| FAD dependent oxidoreductase [Bacillus megaterium DSM 319]
    MIYDVVVIGGGPSGLMASIAAGESGANVLLIDKGNKLGRKLAISGGGRCNVTNRLPIDELIKHIPGNGRFLYSAFSVFNN
    EDIISYFEGLGIKLKEEDHGRMFPVSNKAQSVVDALISELHRLRVTIRTNTAVKRVHYENNTVKEVVLQNGEAIQTKSVV
    IAVGGKSVPHTGSTGDGYQWAKDAGHKITELYPTEVPITSSEHFIKTKTLQGLSLRNVGLSVLNKKGKPVITHQMDMIFT
    HFGISGPAALRCSQYVVKELKKQKSNTVQMSLDLFPSQNDEDIFQKLVKTTKEEPKKAIKNVLKGFVSERYLLFLLEQAS
    IDSQALAGQLQHEKLREFARLCKRFEFAVNGTLSLEKAFVTGGGVSVKEIHPKEMSSKFMQGLYFCGEILDIHGYTGGYN
    ITSALVTGRLAGSNAGEFATSLA

    >gi|295706931|ref|YP_003600006.1| rhodanese-like domain-containing protein [Bacillus megaterium DSM 319]
    MEEVKVITPEELQKRVENGEELHLVDVREDEEVAEGMIPTAKHIRMNDIPGNVDYFDKDKEYIFICRSGRRSENVCYYLQ
    EQGYKVTNMVGGMLEWEGKTVNK

    >gi|295707029|ref|YP_003600104.1| iron-sulfur cluster assembly accessory protein [Bacillus megaterium DSM 319]
    MSQDILTITEAASFQIKDMMKEHEEENAYLRVNVNGGGCSGLSYGMGFAHEVNENDTLFEQHGIKILVDSESAPILKDVK
    IDYKQSMLGGGFTIDNPNAIAACGCGSSFRTASNAGAPEEC

    >gi|295707056|ref|YP_003600131.1| hypothetical protein BMD_4981 [Bacillus megaterium DSM 319]
    MMGADVMQQEARHSTEQALHDYKMGVGKFSEKLPEVTKTFNAFTEACFGEGSLSKKEKQLIALGISVVAQDEYCMIYHTK
    GCIDQGATEQEILEACGVSAAFGGGAAMSQSVTLVQECISELTSHTH

    >gi|295707060|ref|YP_003600135.1| putative thiol-disulfide oxidoreductase [Bacillus megaterium DSM 319]
    MQEWSEKQLDDQLKEGQRAFIFFHTPFCGTCQLARKMLTVAEAMLPGVTIGMSNLNYMPSKAEVFSIESVPCLIEVKNGE
    MVKKLYAFHSIEHVLEELR

    >gi|295707064|ref|YP_003600139.1| hypothetical protein BMD_4989 [Bacillus megaterium DSM 319]
    MSLFFYSYPKCGTCRKAKKWLDDNGVAYEEIHIVENPPTKEQLQSYYQNSGLELKKFFNTSGKKYRELGLKDKVSSASED
    ELLSILESDGMLIKRPLLTDEQKVTLGFKEEQFEDVWK

    >gi|295707096|ref|YP_003600171.1| molybdopterin biosynthesis protein MoeB [Bacillus megaterium DSM 319]
    MTERYSRQQLFQPVGNKGQQQIRSKHVLVVGAGALGSASAEALVRAGIGKLTLVDRDYVEWSNLQRQQLYTEQDAQNKLP
    KAVAAKNRLRQINMEVKIEALVMDAQPANLESIVQTADVIIDATDNFDIRFILNDLSHKYEVPWIYGSCVGSYGATYTVI
    PNVTPCLHCILKKVPGGGAT
    CETAGIISPAVQIVAAYQITEALKILVEDVEALRHTFLTFDVWNNQHAEFKTGKMKSDKC
    SSCGSTQTYPYLAYENQLKTEVLCGRETVQIRPSQRHLYNFDELEKRLKKQGKVDRNPYLLSCQLPEQRFVIFQDGRVFI
    HGTNDIQFARSLYYRLLG

    >gi|295707115|ref|YP_003600190.1| hypothetical protein BMD_5040 [Bacillus megaterium DSM 319]
    MEVVLYTKNSCHLCDDAKKLLAELQSDFPFQLIERDIYKNDEWLEKYHLTIPVVEMDGEEVEYGKITGIPLRKRLLLKIG
    NT

    >gi|295707124|ref|YP_003600199.1| thioredoxin-disulfide reductase [Bacillus megaterium DSM 319]
    MTEEKIYDVIIIGAGPAGMTAAVYTSRADLSTLMIERGIPGGQMANTEDVENYPGYDHILGPDLSNKMFEHAKKFGAEYA
    YGDIKEIIDGEEYKTVRAGSKEYKTRSVIVATGAEYKKLGAPGEKELGGRGVSY
    CAVCDGAFFKGKELVVVGGGDSAVEE
    GVYLTRFATKVTIIHRRDELRAQKILQQRAFDNEKVDFIWNTTVKEVNEKDGKVGSVTLVDTKTGEEREFGADGVFIYVG
    MVPLTKPFESLNITNKEGYIETNEQMETKVPGVFAAGDVREKALRQIVTATGDGSIAAQAAQHYVEELKEKLKAIQH