Streptomyces scabiei 87 22 uid46531

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|290955136|ref|YP_003486318.1| putative methyltransferase [Streptomyces scabiei 87.22]
    MTLLRDEDLAAAFDHASRSYDTLVAANPGYHAHLRRSARRLGLPRPGAGLRVLDLGCGTGASTAALSAVLPGAEITAVDA
    SAGMLERAARKPWREGVRFVHAPAERLVDAGVEGPFDAVFAAYLFRNVADPDAVLSTVREVLAPRGRLAVHEYTLSGRAV
    HRAVWTGV
    CRGMVLPVAALLGDGHLYRHLWRSVVDFDTADAFAARVGAQGFDTVRVLPLPGWQTGITHTIVARRPAGAGD
    GR

    >gi|290955408|ref|YP_003486590.1| hypothetical protein SCAB_8351 [Streptomyces scabiei 87.22]
    MALKKTTPDVSKAMGSLHGAAVTAAQDAKVEPEILELIRIRASQINGCAFCLDMHTKDARAQGETEQRIYALSAWRETPF
    FTERERAALALTEAVTLVTDGQVPDDVYAGAAEVFDEEQIAALIWAATVINAYNRIAIATRMVPGAYQPAQK

    >gi|290955476|ref|YP_003486658.1| hypothetical protein SCAB_9081 [Streptomyces scabiei 87.22]
    MGVAEFGELSSGHTYPPRTGRSDGMSVGEGNEAYGREPFKRSRSHFTDRVTADGRDGRPVEAGRYRLVVSRACPWASRAV
    ISRRLLGLEDALSMAVADPIQDDRSWRFTLDPDGRDPVLGIRFLKEAYDARESDYPGGVSVPALVDVPSGELVTNDYQQL
    TLDLATEWTALHREGAPDLYPRALRDEIDTVMAEVYEDVNNGVYRAGFATGQKEYEEACAGVFRRLEALSDRLSRRRYLV
    GGTITEADIRLFTTLVRFDPVYHGHFKCNRRKLTEDRVLWAYARDLFQTPGFGDTVDFDHIKRHYYQVHTGINPTAVVPL
    GPDLAGWLTPHGREDLGGSPFGDGTAPGPVPAAEAVAPQGRP

    >gi|290955603|ref|YP_003486785.1| hypothetical protein SCAB_10401 [Streptomyces scabiei 87.22]
    MAPTATLTADQAHSRLHELTVIDVRTPGEYASGHLPGAHNIPLDHLDAALPVLKTAADRGDLLIVCASGARSAEACRRLA
    DQGITAATLTGGTTTWTQLGHDTHRPAGTRAPWAMERQVRFAAGSLVLAGLIAGRRWNAARWLSAGIAGGLVYSALTHTC
    GMAAVLAKLPHNQPRATDLDDTLAALTR

    >gi|290955606|ref|YP_003486788.1| hypothetical protein SCAB_10431 [Streptomyces scabiei 87.22]
    MFSFLRRGRGRGRLTPQPAHEQTSDGTAVLLDVRETAEWNAGHAPGALHLPLTRLAAGASLPAAVQGRLVITICRSGHRS
    QQAASLLGGRGFQATDVAGGMTAWARAGLPVLGQDGSDGVIA

    >gi|290955666|ref|YP_003486848.1| oxidoreductase [Streptomyces scabiei 87.22]
    MTDTENTEGTAGDATPAEYDVVVLGAGPVGENVADRTRAAGLSTAIVESELVGGECSYWACMPSKALLRPAIARADARRV
    PGLRHLVEGPLDTAEVLARRDYETGNWKDDGQVAWLESVGAVLYRGHARLAGHRRVVVDAPDGGRRLLTARHAVVVSTGS
    RALLPDLPGLAQVRPWTSREATSARTAPGRLIVVGGGVVAVEMATAWRSLGSEVTVLVRGKGLLPRMEPFAGELIAEALG
    ESGVDVRTGTSVTAVSRENGTVVALTDTGDRLEADEILFATGRAPRTDDLGLDTVGLESGAWLPVDDSLRVTGSDWLYAV
    GDVNHRALLTHQGKYQARIAGAAIAARAAGIPLLERDPWGAHAATADHAAVPQVVFTDPEAAAVGLSLAEAEQAGHRVRA
    VDVEFSSVAGAGLYADGYRGRARMVVDLDREILRGVTFVGPAVGELIHSATVAVAGEVPVDRLWHAVPSYPTLSEVWLRL
    LEAYRG

    >gi|290955667|ref|YP_003486849.1| thioredoxin [Streptomyces scabiei 87.22]
    MHAMSSTVELTKENFDRTVTENEFVLIDFWAAWCGPCRQFAPVYEKAAGDNPDLVFGKVDTEAQPELAQAFGIQSIPTLM
    IVRDQVAVFAQPGALPEAALTDVIGQARKLDMDEVRKAVAEQQAQAEQNG

    >gi|290956225|ref|YP_003487407.1| putative ATP/GTP binding protein [Streptomyces scabiei 87.22]
    MATTRTAHTVWEGELLKGTGTVTFDSSGIGSQPVSWPSRAEQANGKTSPEELIAAAHSSCFSMALSHGLTGAGTPPTRLE
    TKADVTFQPGEGITGIHLTVRGEVPGLDAAGFQEAAEGAKKN
    CPVSQALTGTTITLTAELA

    >gi|290956291|ref|YP_003487473.1| putative methylated-DNA-protein-cysteine methyltransferase [Streptomyces scabiei 87.22]
    MKHQASQKRHTVVDSPYGPLTLVADDGVLCGLYMVEQRHRPPEENFGARDDSLFAGAEEQLKAYFAGELREFSLELRLHG
    TPFQQLVWEQLAAIPFGETRSYGDLADALGNPKASRAVGLANGRNPVSIIVP
    CHRVVGSDGSLTGYGGGVERKRRLLDFE
    RGAALF

    >gi|290956551|ref|YP_003487733.1| putative SelR-type methionine sulfoxide reductase [Streptomyces scabiei 87.22]
    MSYDVEKPDEQWRAELTPAEYAVLRQAGTEPAFVGEYTDTKTKGVYSCRACGAELFTSDTKFESHCGWPSFYDPKDTDAV
    ELLSDRSHGMVRTEVRCARCGSHLGHVFEGEGYATPTDQRY
    CINSISLTLTADES

    >gi|290956579|ref|YP_003487761.1| putative flavoprotein oxidoreductase [Streptomyces scabiei 87.22]
    MNMSRTEERSRERLVVVGGDAAGMSAASQARRLRGPEELEIVAFERGHFTSFSACGIPYWVGGDVPERDRLVARSPEEHR
    ARHIDLRMRTEVVEIDVEGARVRARDLDAGTESWTSYDKLVIATGARPIRPDLPGVDAPGVHGVQTLDDGQALLDTLAAT
    GGRRAVVVGAGYIGVEMAEALINRGYEVTVVNRGGEPMSTLDPDMGRLVHRAMTGLGITMVDDAEVTALRTGADGRVRAV
    ATKDAEYPADVVVLGIGVRPETTLARAAGLPVGDHGGLLTDLAMRVRGHENIWAGGDCVEVLDLVSGSLRHIPLGTHANK
    HGQIIGANAGGGYATFPGVVGTAVSKVCDLEIARTGLREKDADRAGLQYVTVTVESTSRAGYYPGAAPMTVKMLAERRTG
    RLLGVQIVGREGAGKRVDIAAVALTAGMTVEQMTALDLGYAPPFSPVWDPVLVAARKATAAVRSAGA

    >gi|290956879|ref|YP_003488061.1| putative thioredoxin reductase [Streptomyces scabiei 87.22]
    MTDATTADDGIRNVVIIGSGPAGYTAALYAARAQLKPLLFGSSIFVGGSLTTTTEVENFPGFPDGVDGPDLMANMRAQAE
    KFGAEMIDDDIVSVDLTGAIKEVTDSEGTVHRAKTVIIATGSGYRKLGLPKEEELSGRGVSW
    CATCDGFFFRDRDIVVVG
    GGDTAMEEATFLTRFARSVTVVHRRSTLRASQVMQNRAFSDDKISFLFDSEITELEDKDGMLSGLTVRNVITEETQHLDV
    TGLFIAIGHDPRTELFTSQLDLDAEGYLKVHSPSTRTSLPGVFAAGDVVDHTYRQAITAAGTGCAAALDAERYLAALADA
    R

    >gi|290956880|ref|YP_003488062.1| putative thioredoxin [Streptomyces scabiei 87.22]
    MALKSVTDASFIEDVLQSDKPVLVDFWAAWCGPCRQLAPSLEAIAAEHGNRIKIVKLNIDENPETAAAYGVMSIPTMNVF
    VGGRVTKTIVGAKPKAAIERELRDLLNV

    >gi|290956908|ref|YP_003488090.1| putative thiosulfate sulfurtransferase [Streptomyces scabiei 87.22]
    MNAIISAADLAGELAGPRPPVLLDVRWQLGGPNLRPEYDRAHIPGAVFVDLDAELAGPAGSGGRHPLPDTGAFGATMRAA
    GVSADRPVVVHDGGLNWAAARAWWLLGWAGHPSVRVLDGGLAAWEGPLTAEVPQPAPGTFEPAPGALPLLDADGAAELAR
    TGLLLDARAAERYRGDVEPIDPVGGHIPGAVSAPTTENVAESGRFRSAAELADRFKGLGARPGTEVGVY
    CGSGVSGAHEV
    LALAVAGIPAALYVGSWSEWSRDGSRPVATGPDPR

    >gi|290957281|ref|YP_003488463.1| putative thioredoxin [Streptomyces scabiei 87.22]
    MIRAAGVAEVTDADFEAEVIGAELPVLVEFTADWCPPCRQMGPVLSALAEQEGGRLKVVQLDVDTNPETTNAYRVLSMPT
    FMVFRGGEPLKAMVGARPKRRLLEELADVL

    >gi|290957304|ref|YP_003488486.1| putative thioredoxin [Streptomyces scabiei 87.22]
    MSGVVDLAAVKAAQEAKAKAEQARAEAARQGGGGAVSPADLVIDVDEAGFEREVLQRSTEVPVVIDFWAEWCQPCKQLSP
    VLERLAVEYAGKFVLAKIDVDANQMLMQQFGIQGIPAVFAVVAGQALPLFQGAAPEQQIRETLDQLVQVAEQRFGLTGLV
    VDPDAEAGAPVEAAPQIPAGPYDHLLEAAVHALDAGDFGGAVQAYKNVLSDDPGNTEAKLGLAQAELLQRVQGADPQDVR
    KAAAENPGDAQAQIAAADLDLVGGHVEDAFGRLIDTVRVTAGDERDAVRTRLLELFEVVGGDDPRVAAARRALARALF

    >gi|290957551|ref|YP_003488733.1| putative glutaredoxin-like protein [Streptomyces scabiei 87.22]
    MTMYSTTWCGYCRRLKSQMEREGITYNEINIEQDPESAAFVEKANGGNQTVPTVLFPDGSTLTNPSLAQVKQKIGA

    >gi|290957562|ref|YP_003488744.1| putative sulfurylase [Streptomyces scabiei 87.22]
    MSLPPLVEPASELTVDEVRRYSRHLIIPDVGMDGQKRLKNAKVLCVGAGGLGSPALMYLAAAGVGTLGIVEFDEVDESNL
    QRQIIHSQADIGRSKAASARDSVLGINPYVNVILHEERLEAENVMDIFSQYDLIVDGTDNFATRYLVNDACVLLNKPYVW
    GSIYRFDGQASVFWSEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVTEAIKVLTGTGEPLVGRLMIYDALE
    MQYRQVKVRKDPDCAVCGENPTVTELIDYEAFCGVVSEEAQEAAAGSTITPKQLKEWIDDGENIEIIDVREINEYEIVSI
    PGAKLIPKNEFLMGTALEALPQDKKIVLH
    CKTGVRSAEVLAVLKSAGFSDAVHVGGGVIGWVNQIEPSKPVY

    >gi|290957891|ref|YP_003489073.1| hypothetical protein SCAB_34251 [Streptomyces scabiei 87.22]
    MRKDGVMPNRLAHATSPYLLQHADNPVDWRPWEPAAFEEARRRDVPVFLSVGYSACHWCHVMAKESFEDKGTAAYLNEHF
    VSVKVDREERPDVDAVYMEAVQAATGQGGWPMSVFMTPAAEPFYFGTYFPPGPRQGMPSFRQVLEGVHHAWSSRRQEVAD
    VAVKITRDLAERALGAGSDGLPTGETQAQALLQLTRDVDSTSGWFKGSTKFPPSMVVEFLLRHHARTGSVAAREMAEGLC
    GAMARSSLYDQVGGGFHRYVLLAHADGPLVPHFEKMLYDNALLCRVYAHLWRATGSEPARRVALETADFMVRELRTNEGG
    FASALDADSDDGTGSGKHVEGAYYVWTPEQLTEVLGEEDAALAVRYFGVTEEGTFEEGASVLQLPQQEGVFDAERIESVR
    ERLLAARSRRPAPGRDDKVVAAWNGLAVAALAETGAYFDRPDLVDAAITAADLLVRLHLDERARLTRTSRDGQAGANAGV
    LEDYADVAEGFLALASVTGEGVWLEFAGFLLDHVLARFVDEGSGALYDTASDAEKLIRRPQDPTDNATPSGWSAAAGALL
    GYAAQTGSEPHRRAAERALGVVKALGPRAPRFIGWGLATAEALLDGPREVAVVGPEGHPGRRELHRAALLGTAPGAVVAV
    GVADGDELPLLAGRPLVGGEPAAYVCRHFTCDAPTTDADRLREVLGAAPVG

    >gi|290957994|ref|YP_003489176.1| hypothetical protein SCAB_35341 [Streptomyces scabiei 87.22]
    MVAVALGLLVAGCGQRANRDEPRVAYKELRDVPEALDEDGTTIRVGDPEAPVTVHLYEDPRCPYCEEFEQTGGGPAARER
    TLGRTVVTEYTLASFLDGKLGGSGSERAVNALRAALEKGKFAEYHAVLYDNQPEEAVDGFTDAYLLKLADEVDGLRGPAF
    DSAVRTMKYRDFVSRSEKAYERAGGSENPGGPGTPTAAINGRRIVEMYGAVLYDRSMFDRLLKTVEQDPMAWDDDRSISQ
    DMG

    >gi|290958316|ref|YP_003489498.1| putative redoxin [Streptomyces scabiei 87.22]
    MLSAGAAALVLTLSACAGGGIEGGGGQTGFITGSDGIATVKKGDRDTAPDLSGKTIDGDRLDLSAYKGKIIVLNVWGSWC
    AP
    CRAEAPNLVKVSQDLAGRGVQFVGINTRDTSTRPALAFEEQYKVTYPSLYDPTGKLLLRFEKGSLNPQLIPSTLVIDR
    EGKLAVRTQQPLSEEKLRKMLKPILAEK

    >gi|290958359|ref|YP_003489541.1| putative redoxin [Streptomyces scabiei 87.22]
    MAVMSAMFRRTPKNSGERLVTLIGKSGCHLCDDAEAVIGKVCGELGVPWEKKDIEEDAELHRQYWEQIPVVLVDGAQHTF
    WRVDEERLRKALASR

    >gi|290958882|ref|YP_003490064.1| putative redoxin [Streptomyces scabiei 87.22]
    MAIRKTARPAALCALVVVLLSGCSTSEPLVLDTDSAQSGMPQPFERVPVAERTDAPVFSGRTVDGKQVRLSDYRGDVVVV
    NAWATS
    CGPCRAEAPALERTYRTFGDRGVRVLGISTDVERRNARAFQREFGLTYPSLHDPKGRQFLELPRGMVNPQFLPF
    TLFVDRAGRIAGAVQARLDEKELAAILTPLLNEGKEAGR

    >gi|290958966|ref|YP_003490148.1| hypothetical protein SCAB_45401 [Streptomyces scabiei 87.22]
    MPTVEVGDLKDDDFLLDVREDDEWQAGHAEGALHVPISEFVARYGEVTEAAPQDGRVHVICRSGGRSAQVTMYLVQQGID
    AVNVDGGMQLWAAAGRPVVDGKGGAGFVL

    >gi|290959014|ref|YP_003490196.1| thioredoxin [Streptomyces scabiei 87.22]
    MAGTLKNVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAQEYGDKIEIVKLNIDENPATAAKYGVMSIPTLN
    VYQAGEVAKTIVGAKPKAAIVRDLEDFIAE

    >gi|290959015|ref|YP_003490197.1| thioredoxin reductase (NADPH) [Streptomyces scabiei 87.22]
    MSDVRNVIIIGSGPAGYTAALYTARASLRPLVFEGAVTAGGALMNTTEVENFPGFRDGIMGPDLMDNMRGQAERFGAELI
    PDDIVAVDLSGEIKTVTDTGGTVHRAKAVIVTTGSQHRKLGLPNEDALSGRGVSW
    CATCDGFFFKDQDIAVIGGGDTAME
    EATFLSRFAKSVTVVHRRDTLRASKAMQDRAIADPKISFVWDSEVAEIQGDQKLAGLKLRNLKTGETSELPVTGLFIAIG
    HDPRTELFKGQLDLDDEGYLKVASPSTRTNLTGVFGAGDVVDHTYRQAITAAGTGCAAALDAERYLAALADGDQTAEPEK
    TTV

    >gi|290959372|ref|YP_003490554.1| putative thiosulfate sulfurtransferase [Streptomyces scabiei 87.22]
    MSRSDVLVDADWVEANLDDPNIAVVEVDEDTTAYEKNHIKNAIRIDWTKDLQDPVRRDFVDQEGFEKLLSEKGIGNDTLV
    VLYGGNNNWFASYAYWYFKLYGHENVKLLDGGRKKWELDARELVDEVPVRPATEYKAKPQNTAIRAFRDDVVAAIGSQNL
    VDVRSPDEFSGKLLAPAHLPQEQSQRPGHVPSARNIPWSKNANDDGTFKSDDALKELYADEQVDLAKDTIAY
    CRIGERSA
    LTWFVLHELLGVENVKNYDGSWTEYGSLVGVPIELGANK

    >gi|290959375|ref|YP_003490557.1| hypothetical protein SCAB_49661 [Streptomyces scabiei 87.22]
    MAKKLVIKVTAGADAPERCSQAFTVAAVAVASGVEVSLWLTGESAWFALPGRAAEFELPHAAPLPDLLDSVLAGGRLTLC
    TQCAARRDITEKDVIEGVRIAGAQVFVQEALADDARALVY

    >gi|290959631|ref|YP_003490813.1| putative glutathione peroxidase [Streptomyces scabiei 87.22]
    MTTDHATPSPLDVEIGALKGGSADLAQYAGQAVLVVNVASKCGLTPQYTGLEALQARYAAQGFTVLGVPCNQFLGQEPGS
    AEEIAEFCSATYGVTFPLTEKVEVNGGGRHALYERLVDHADAEGHTGDIRWNFEKFLIGRDGTVVARFSPQTEPESAELV
    AAVEKAIG

    >gi|290959735|ref|YP_003490917.1| putative stress response protein [Streptomyces scabiei 87.22]
    MTDHAAVETGADGRPDTRPTKIMYVAEATAHGGRSGYITSQDGQIDLKVAMPPAMGGDGDGTNPEQLFAAGYSSCFHNAL
    VLVGRRAGYDLTGSTVAAKVGIGPNKQRGYGLAVALSVSLPVIDQGIAAKLVDAAHQV
    CPYSNATRDNIEVTILLG

    >gi|290959945|ref|YP_003491127.1| putative stress inducible protein [Streptomyces scabiei 87.22]
    MDALYTAVATATHGRDGRAVSNDGKLDLDLALPVELGGNGQGTNPEQLFAAGYSACFASALGLVGRAAKVDVSDAAVTAE
    VGIGKQGEGFALKVTLRVELPDSVDEATGRKLVEQAHQV
    CPYSNATRNNIPVELVVE

    >gi|290960061|ref|YP_003491243.1| putative redoxin [Streptomyces scabiei 87.22]
    MSERLQPGDVAPAFTLPDADGNEVSLSDHKGRKVIVYFYPAALTPGCTKQACDFTDNLELLADAGYDVIGISPDKPEKLA
    KFREKESLKVTLLGDVDKTVLDAYAAFGEKKNYGKTYMGVIRSTIIVDEEGKVAHALYNVRATGHVAKIIKDLGI

    >gi|290960258|ref|YP_003491440.1| putative cation-transporting P-type ATPase [Streptomyces scabiei 87.22]
    MTSTDTTSTLAAASEGGPLREVELTIGGMTCASCAARVEKKLNRLDGVTASVNYATEKAKVSYPAGVEVAELIATVVKTG
    YTAQEPPAPAPPATTAPAAATGSGEEGTDPELAALRQRLTVSVLLAVPVVLMSMVPALQFDNWQWLSLTLAAPVVVWGGL
    PFHRAALTNLRHGAATMDTLVSVGTLAAFGWSLWALFRGHAGMPGMRHGFTFTVTRESASSAIYLEVAAGVVAFILLGRY
    LEARAKRRAGAAFRALLELGAKDVSVLRQGREVRIPVADLAVGDRFVVRPGEKLATDGTVVEGASAVDASMLTGESAPVD
    VTVGDPVTGATVNAGGRLVVEATRVGADTQLARMARLVEDAQNGKAQAQRLADRISAVFVPAVVLIAVATFGVWLGATDD
    TTAAFSAAVAVLIIACPCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRRVDTVVLDKTGTVTTGRMTLGEAHTAED
    VTEEDVLRLAGAVEHASEHPVGRAIAAGAEERLGPLPPVEGFENLPGKGVRGRVEGRTVQVGRMTPESPLPEPLRVAKEA
    AEAEGRTAVVVTRDGVTLGVVTVADAVKETSAEAVRRLRALGLTPVLLTGDNTRVARSVAAAVGIPPEDVIAEVLPQDKV
    DVVRRLQGEGRTVAMVGDGVNDAAALAAADLGLALGTGTDAAIEAGDLTLVRGDLRAAADAIRLSRRTLSTIKGNLAWAF
    GYNVAALPLAAAGLLNPMIAGATMAFSSVFVVTNSLRLRTFS

    >gi|290960259|ref|YP_003491441.1| putative metal-binding protein [Streptomyces scabiei 87.22]
    MTAETDTQGSVTAVYQVSGMSCGHCEGAVSGEITQLPGVSSVKAVASTGEVTVVSAAPLDEEAVRAAVDEAGFELVGAV

    >gi|290960346|ref|YP_003491528.1| hypothetical protein SCAB_59711 [Streptomyces scabiei 87.22]
    MSEQTSGKTPVDFWFDPLCPWAWMTSRWVLEVEKVRDIEVRWHLMSLAVLNEPKIDELPEEYRELLEKKAWGPVRIVIAA
    QEEHGAGVLGDLYTALGTRIHNQGEGPEKETVAAALKDVGLPDSLMDHWDATPYEPQLRASHQEGIDKVGQDVGTPVIAV
    PGADGEQIAFFGPVVTPAPQGEEAARLWDGTLLVASVPGFYEIKRSRTKGPDFSNLV

    >gi|290960646|ref|YP_003491828.1| putative oxidoreductase [Streptomyces scabiei 87.22]
    MAAATPPHASDALPEGTVDAVVIGGGAAGLNGALILARSRRSVVVIDSGSPRNAPAEAVHGLIALDGTPPSEILRRGREQ
    VRQYGGRVVFGEVVSADSAAPSVDGDLRFTVTLADGRSVTARRILVATGLKDVLPEVPGLAGHWGHSVVH
    CPYCHGWEVR
    DEPIGVLATGTASIGHAYLFRQLTEDLTYFTHGTDLDEDTRARFAARGIRVIDTPVTEVVDDADGALAGVRLADGQVVAR
    RVLAVAPRMQARTHGLEGLGLPVQDLPTGRTFASGVDGTTEVPGVWVAGNVTDPVAQVGASAAAGALAGIDINKVLAVAD
    TDAALQGIAEGSPQGVTE

    >gi|290960796|ref|YP_003491978.1| putative reductase [Streptomyces scabiei 87.22]
    MKGLRNIMAIQVGDKAPDFELKDNHGATVRLADFRGEKNVVVLFYPFAFTGVCTGELCELRDNLPKFVNDDVQLLAVSND
    SIHTLRVFAEQEGLDYPLLSDFWPHGEASRAYGVFDADKGCAVRGTFIIDKEGVVRWSVVNALPDARDLNEYLAALDTL

    >gi|290961038|ref|YP_003492220.1| hypothetical protein SCAB_66811 [Streptomyces scabiei 87.22]
    MGGMEIWINPACSKCRSAISLLDAEGADYTVRRYLEDVPSEDEIRAVLDRLGLEPWDITRTQEAAAKELGLKEWARDDGS
    RDRWVKALAEHPKLIQRPIITAEDGTAVVARTDEAVRDALSR

    >gi|290961063|ref|YP_003492245.1| putative dihydrolipoamide dehydrogenase [Streptomyces scabiei 87.22]
    MANDASTVFDLVILGGGSGGYAAALRGAQLGLDVALIEKDKVGGTCLHRGCIPTKALLHAGEIADQARESEQFGVKATFE
    GIDVPAVHKYKDGVISGLYKGLQGLIASRKVTYIEGEGRLSSPTSVDVGGQRIQGRHVLLATGSVPKSLPGLEIDGNRII
    SSDHALVLDRVPKSAIVLGGGVIGVEFASAWKSFGTDITIIEGLKHLAPLEDENSSKLLERAFRKRGIKFNLGTFFSKAE
    YTQDGVKVTLADGKEFEAELLLVAVGRGPVSAGLGYEEQGVAMDRGYVLVDEYMRTNVPTVSAVGDLVPTLQLAHVGFAE
    GILVAERLAGLKTVPIDYDGVPRVTYCHPEVASVGITEAKAKEIYGADKVVALKYNLAGNGKSKILQTAGEIKLVQVKDG
    AVVGVHMVGDRMGEQVGEAQLIYNWEALPSEVAQLIHAHPTQNEALGEAHLALAGKPLHSHD

    >gi|290961081|ref|YP_003492263.1| putative iron-sulfur cluster biosynthesis protein [Streptomyces scabiei 87.22]
    MSVSDETGTVTDGIIVTDAAAAKVKALLDQEGREDLALRVAVQPGGCSGLRYQLFFDERSLDGDVEKDFDGVKVVTDRMS
    APYLGGATIDFVDTIEKQGFTIDNPNATGSCACGDSFS

    >gi|290961281|ref|YP_003492463.1| hypothetical protein SCAB_69301 [Streptomyces scabiei 87.22]
    MTTNTTGPATALPRLDFAKSARTAFRALVGFDAAAREGLDPALVELIQIRASHLNHCAYCLHMHTTDARKAGESEDRLHM
    IPVWKEARHFFTAREQAALALTEAVTLVADTGVPDDVYAEAAAHFDDTELAHVIALILTINTWNRIALATAKRAGTDTR

    >gi|290961291|ref|YP_003492473.1| putative DNA-methyltransferase [Streptomyces scabiei 87.22]
    MNSHAQDEQRVVWAVIGTDIGPLLLAATDEGLVHVAFHATDAVRERTLDRLASRLGTTPVEAPGAPRLAEAIRQVEAYFA
    GERHDFDLPLDWSLISGFNRQVLRELASGVRYGSVVGYGDLARRVGQPGAAQAVGIAMGSNPLPVVVP
    CHRVVESDGGIG
    GFGGGLETKRKLLALEGVLPEPLF

    >gi|290961417|ref|YP_003492599.1| hypothetical protein SCAB_70671 [Streptomyces scabiei 87.22]
    MRVEIWSDIACPWCYVGKARFEKALAAFPHRDGVEVVHRSFELDPGRAKDDIQPVLTMLSKKYGMSEAQAQAGEHNLREQ
    AGAEGLAYRAEGRDHGNTFDMHRLLHLAKEEGRQSELLQAFYRANFAEERSVYADADEYLVELAVGAGLEEGTVRGVLAD
    SDAYADAVRADEREAAELGANGVPFFVLDRKYGVSGAQPAEVFEQALTQAWGERPAPLRTVAAEDAEVCGPDGCAVPQQA


    >gi|290962008|ref|YP_003493190.1| hypothetical protein SCAB_76851 [Streptomyces scabiei 87.22]
    MMFLFRRNGPRVTVDEAHSRTSGDRPDAVLLDVREKPEWNSGHAPGAIHVPLTNLVAGAILPAEAQGRPLVVICRSGHRS
    QQAAKLLTDRGAQVVDVEGGMNAWAAAGHPVVDERGNSGRIA

    >gi|290962010|ref|YP_003493192.1| putative membrane transport protein [Streptomyces scabiei 87.22]
    MTSAMTTPTALATDEARTRLHELTIIDVRTPGEYAGGHLPGALNIPLDQIRRALPDIRHATDRGDVLVVCASGARSENAC
    KILAENGVTTATLSGGTGAWAADGHELHRPQGASRATWGMERQVRLTAGVTVLLGLLLGLVVHPAFQLISAGIAGGLVYS
    ALTNTCGMAAMLAKLPHNRPRAADLDNTLAALRNR

    >gi|290962105|ref|YP_003493287.1| hypothetical protein SCAB_77901 [Streptomyces scabiei 87.22]
    MSVSTSAVNAVLRVAPAAPADAAAYFRASLVLHADASDVAAALAADGDPGFVVLDSRSTASWDQGHIPGAVHLPTALIPE
    QAEQVLDRSVPVVTY
    CWGPGCNGATRAALALAELGFQVKEMLGGFEYWAREGFAYETWEGVTRRAADPLTAPEDTADCGC


    >gi|290962182|ref|YP_003493364.1| hypothetical protein SCAB_78691 [Streptomyces scabiei 87.22]
    MTEQQYEVIVIGGGAAGLSAALVLGRARRRTLVVDAGEPRNAPAAHIQGFLTRDGMPPAEFLAVGREEIARYGVEPVRGR
    AVDVTRDEDGGAFTVSLADGRSARGRRLVVATGLKDDLPAVPGVAERFGRDVLH
    CPYCHGWEVRDRPFGVLATGPMSVHQ
    ALMVSQWSEDVTLFLHETPESDLSDDDLRRLAAAGVQVVPGAVAGLVVEDDRLTGVRLADGTAHARSVIFTAPRPIPRTS
    LLEKLGAAMNETPFGAYPVVDPTGLTTVPGVWAAGNAIGFSEQVVNAASSGYRAGATINGDLLMADLDAAPPR

    >gi|290962560|ref|YP_003493742.1| putative thioredoxin [Streptomyces scabiei 87.22]
    MLALASAYGVLHRRRSGRVRVRGRDGDKRLDAAELGEGLGERATLVQFSSAFCAPCRATRRVLAEVAAMVPGVAHVEIDA
    EEHLDLVRRLDILKTPTVLVLDADGRIVRRASGQPRRADVIAALGEAV

    >gi|290962752|ref|YP_003493934.1| thioredoxin 2 [Streptomyces scabiei 87.22]
    MQATNVTCPHCGRTNRVPVAAEGRPTCGNCKQPLPWTADAGDDDFTEVVEQATVPVVVDLWATWCGPCRMVSPALEKVAA
    DLAGKIKLVKVDVDKNPRLAQRFEVQAVPTLLVLDKGRTIARQAGVAPAPALRRWVEQSIAGREPAGKG

    >gi|290962893|ref|YP_003494075.1| putative cysteine synthase [Streptomyces scabiei 87.22]
    MRYDTITDAIGDTPLVRIDPAVHGLRNIDLYAKLEMLNPFGSLKDRAAWGMTRRELAGAKERGETIVELSSGNTAKALAL
    IAGLHGLPFKSVTNRMRVPEIKDLLLLLGAEIEELPGRTECLDPTDTDDPLTVFHQRLNGPGGAHLHTDQYFNALNAEAH
    ATGTGPEIIADLDGRAPDWFIACVGTAGSSTGVARALRAHDPAVRVVGLVGQKGDFIPGIRTVDEVREVGLFDPATYDTL
    EAVGSDEAIEGMLTLLRRCGLLAGPTGGAAYFGGVRHLRSLDAGLTERRTAVFIVCDRVESYLDYVRRRRPDLLGRPPVL
    NSVATLTDTEIRAAAVVDVEDAQKWIAAQRPLVVDLRGPFAYAALHIDGSINIVDELFDELLRGGLPFGTRQPVLLA
    CPV
    GEKSARYAALLTRMGHTDVRSLAGGIIAWRDAGAPLVRD

    >gi|290963304|ref|YP_003494486.1| putative ferredoxin reductase [Streptomyces scabiei 87.22]
    MRRIVVVGGSIAAVTAASWLRVRGFDGTLTLLSAETEQPYTRVPLSKTVLSGEATDASTALPPLDDSVVVRLGTRAVSLD
    TRARRVIIDNGDPVPYDGLVIATGGRARRLSPPGMTGERVLRTLAD
    CVALREDLTRARSVLVVGAGLLGMEIASTCRTRG
    LQVTVVDRDPALRRVLGPRLAEVVTDAAREHGVSLRTVPAGVRLVGSRTLEGVDADGDLLTADVIVSAVGDVPAVDWLTG
    SGLTLDRGVVTDSRGRVADGIVAAGDAAVVRGACRRPHWTNAVEQARVAADALLGEDVSKTSLPAYFWTNQFGVDIKVAG
    EPAGLGEPDLVDVDGSSMVLRWSAGAAATVNHTMPVRKLRQLASAP

    >gi|290960607|ref|YP_003491789.1| putative FAD-dependent pyridine nucleotide reductase [Streptomyces scabiei 87.22]
    MTSNERVVVIGSGLAGVRLARRLGELGMPATLVGEEEHPPYNRVLLAEVLAGRYAPEVIALPAPAEPTRTVNGRVVRIDR
    EVRAVHLADGTEIPYDRLVLATGSNPVLPPLRGLWDPERHEFPDGVHAFRTMDD
    CLRLSEAVRPGARAVVIGGGLLGVSA
    ARALALRGAQVVLAQQGERLMERQLDPSASKLVRRHLTDLGVEVHTETRVRAVRSVGGAVRSVSMADGYTLDADLVVIAC
    GVHPRVGLAQEAGLAVHKGVIVDEELRSSDPRIHAIGDCAQFEGTVYGLATPALEQADVLAELIAGVASPAARYTGTRAL
    TRLTLAGADFLDLAAFGEPEPLPGDDVIQLADATRGTYRKVVVRDDRLVGGVLVGELGTVGALARAWEGAEPLPADGAPL
    LHLLTNDGGS