Streptomyces coelicolor A3 2 uid57801

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|21218701|ref|NP_624480.1| hypothetical protein SCO0142 [Streptomyces coelicolor A3(2)]
    MVKHARVRAPELVGRGGWINTGDRELSLAALRGRIVVLDFWTFCCVNCLHALDELRELEERHRDTVVIVGVHSPKFTHEA
    EHRAVLDAVERYSVEHPVLDDPERVTWRQYAVRAWPTLAVIDPEGYVVAQYTGEGHAHAIQRLVEELEARHAAKGTLRRG
    DAPYVAPEPEPTTLRFPGKAVSLPSGTFLVSDTTRHQLVELAEDGESPVRRIGSGRRGFTDGPADRAEFSEPQGLALLGD
    GSVVVADTVNHALRRYEPVTGEVTTLAGTGRQHRPGEPSRGAARAVSLSSPWDVALWNDRVWIAMAGVHQLWAYDPRDGS
    VTVTAGTGNEGLVDGPGPEAWFAQPSGLSATDDRLWVADSETSALRWVELDGTVRTAVGTGLFDFGHRDGPAARALLQHP
    LGVAALPDGSVVVADTYNHALRRYAPPTGEVSTLATDLREPSDAVVVGGDVLVVESARHRLTRLRLPHDALGTGSGEAVL
    RGTTEAAPGTLRLEVAFRALAGQKLDQRYGPATRLLVSATPPELLRAGEGAGTELSRSLDLDPSVPEGMLHVSATAASCD
    DDLDVPYPACHVHQKDWKIPVRLVEGASDRLPLVLTGVDTA

    >gi|21218711|ref|NP_624490.1| hypothetical protein SCO0154 [Streptomyces coelicolor A3(2)]
    MTTTPIADQAAVLAEGMADQTPSEALEAFGAEQAELDAAGVPSGIATAGSLMPDASLLDVHGNATTLQQVREGRPAVVVF
    YRGAW
    CPYCNLALRTYERELAPRLAERGVSMIAVSPQRPDGSLTMAQTNDLSYDVLSDPGNHIGRALGIVTRPTDRVQHA
    QASLGLDLTEVNADGTPDILMPTVAIVDAEGVLRWIDVHPNYVTRSEPARILEALARAVR

    >gi|21218835|ref|NP_624614.1| sodium/proton antiporter [Streptomyces coelicolor A3(2)]
    MIIGVVSGQEPEEATPSLSARSTVRWRTFVRTETSSAVFLLAAVAAALVWANVGPHSYEAVWQARFTVGFDTRRLSLTVH
    EWINSGLMSLFFFVVGLEARRDFDMGELRDRRWLLLSAIAGLGSMIVPALIFVLVNAGRESVHGWGTAMSTDTAFALGVL
    AVFGSRLPASLRAFLLSVSVVDDLVALLVIAVFYSDEIRLPALLVAVCALLAIALLRLAGVRGALYCAVLSVVVWVALHE
    AGVDPVVAGLAVGVLVAAYPAPRGDLEQASRLFRLFREQPTPELHRSAVQGLDAAISPNERLEQRFLPWVSFGIVPLFAL
    ANAGIELSGPALADAFTSPVTLGIVLGCVVGKVIGTVGSMAAARLLSGGRLRPNVGWGSVTVGGAIAGSAFTVSLLIASL
    AFDGAELEEARIGILVTLVGAFLTSWAVTAVIGLLPERRRARALLGDVDPLTDLAVPVDRRHDRIRGPESAVVTVVEYGD
    FE
    CPYCGQAEPVVRDLLGQESDVRYVWRHLPLRDVHPRAQLAAEASEAAARQDRFWEMHDLLLERQNALAAPDLLRYAGE
    LGLDVERFRQDLRDHLGARRVAEDVDSADLSRVSGTPTFFINGRRHHGAYDIAALTRAVELARQRALTG

    >gi|21219009|ref|NP_624788.1| hypothetical protein SCO0469 [Streptomyces coelicolor A3(2)]
    MTQTPVRADAGAPGSTGSTGERRVFVDKQSPEAYAALRATAEAVRGVAEAAGLDRILVELVNIRVSQLNACAYCLNAHTR
    AALRGGETTQRLGVLPAWRDTELFSPRERAALALAEATTHPADAGAQSTAYAEARGVLSDDEISAVIWVAISINAFNRVS
    VLSKHPVRGAPRA

    >gi|21219300|ref|NP_625079.1| hypothetical protein SCO0777 [Streptomyces coelicolor A3(2)]
    MSGDDGTPGNSGYGKKAFKRSRSHFADRITADGRDGWPVEAGRYRLVVSRACPWASRALVSRRLLGLEDALSLAVADPVQ
    DDRSWRFTLDPDGRDPVLGIRYLGEAYDRRETGYPGGVSVPAVVDVPSGALVTNDYQQITLDLATEWTALHRPGAPDLYP
    RALRDEIDEVMAGVYEDVNNGVYRAGFATGQEEYEAACAGVFRRLEQLTPRLERQRYLVGDTITEADIRLFTTLVRFDAV
    YHGHFKCNRWKLTENPVLWAYVRDLFQTPGFGDTVDFDHIKRHYYQVHTGINPTGIVPLGPDLAGWLTPHHRQELGGRPF
    GEGTPPEPVRAEEEVPARGRP

    >gi|21219381|ref|NP_625160.1| cation-transporting ATPase [Streptomyces coelicolor A3(2)]
    MAGEPTSVQEVTDLAVGGMTCAACVTRVERKLAKLDGVSASVNLATGRARVHHPPEVLPEQLVAAVEQAGYTAALPQSVE
    ERRRGSDDDAGTEAQRERDRLTVTALLAVPVLVLSMVPAWQFRNWQWLCFVLAAPVVAWGAWPFHRRAARALRHSTSTMD
    TLVSLGVVASFAWSSYALFLGGAGDPDLRMPFSLVPTASDGVAHIYLEAAVGVPLFVLAGRYLEARARRGTGAALRALAE
    LAVKEVAVRDGTGGRRIPIEELRVGQVFVVRPGERVATDGTVVEGSSAVDLSLVTGESEPAEVAPGTAVIAGGVNVGGLL
    AVRATAVGADTRLARITHLVTEAQAGKARAQRLADKVAGVFVPVVLTLAATVLGFWLGAGADPQAAITASVAVLVVACPC
    ALGLATPTALMAATGRGAQLGVLVSGPQALEGLRHIDVVVLDKTGTLTSGHMSVARVTAMPRGIGEEQAVRLAGAVEQGS
    EHPLGQAVTAYARRTMPTGSLPEVTDFAALPGRGVRGRVEGRLVEVTAPDDELPVPLDEAMSGAESAAHTPVVVRVDGVT
    EGLIEVGDVLRPGSYRAVDRLRRLGVRPVLATGDREAPARAVATALRIDDVHARRTPEDKARLVRELREEGHRVAVVGDG
    VNDAAALAGADLGIAMGTGTDAAIGAADVTLVRGDIDALADAVRLSRSTLATIRVNLLWAFGYNVVTMPPAMVGLLSPMP
    AAAVMSVSSLLVVGNSLRLRAWQPARTRSRPSASPARGESLR

    >gi|21219404|ref|NP_625183.1| oxidoreductase [Streptomyces coelicolor A3(2)]
    MTQSDSLTYDVVVIGAGPVGENVADRTRAAGLSTAIVESELVGGECSYWACMPSKALLRPVLARADARRLPGLAQSLQEP
    LDATAVLARRDEFTSHWKDDGQVQWVEGIGADLYRGQGRLAGPRTVEVAGPDGTRRTLSARHAVAVCTGSAAALPPLPGL
    AEVRPWTSREATSAERAPGRLIVVGAGVVAVEMATAWQALGSRVTMLVRGDGGLLARMEPFAGELVAEALTEAGVDIRTG
    VSVESVTRENGTVVAVTDTGDRLEADEILFATGRTPRTGDIGLDTVGLKPGSWLPVDDSLRVEGSDWLYAVGDVNHRALL
    THQGKYQARIAGAAIAARASGVPILESDPWGAHAATADHDAVPQVVFTDPEVASVGLTLAEAEQAGHRVRAVDVPIAVAG
    SSLYGDGYKGRARMVVDLEDEIVRGVTFVGPGVGEMIHSATIAVAGRVPISRLWHAVPSYPTISEVWLRLLETYRDN

    >gi|21219405|ref|NP_625184.1| thioredoxin [Streptomyces coelicolor A3(2)]
    MTSTVELTKENFDQTVTDNEFVLIDFWAEWCGPCKQFGPVYEKAAEANPDLVFGKVDTEAQPELAQAFGISSIPTLMIVR
    EQVAVFAQPGALPEAALTDVIGQARKLDMDEVRKAVAEQQAQAGQNGQEGQEGQ

    >gi|21219562|ref|NP_625341.1| metal transporter ATPase [Streptomyces coelicolor A3(2)]
    MTTSTTSAPAEVELTIGGMTCASCAARIEKKLNRMEGVTATVNYATEKAKVSYAGDVSVPELIATVEATGYTAREPEPVR
    TGAGSGPGGAETVDELRPLRERLVTSVVLAVPVIAMAMVPALQFEYWQWLSLTLAAPVVTYAAWPFHKAAFTNARHGAAT
    MDTLISVGTSAAFLWSLWALFLGTAGTPGMTHPFELTIARGDGSGNIYLEAAAGVTAFILAGRYFEARSKRKAGAALKAL
    LELGAKDVTVVRGGREERIPVGDLTVGDRFLVRPGEKIATDGTVVEGSSAVDASMLTGESVPVEVAAGDGVTGATVNAGG
    RLVVEATRVGADTQLARMARLVEDAQNGKAAAQRLADRISGVFVPVVIALALATLGFWLGNGSGPAAAFTAAVAVLIIAC
    PCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRKVDTIVLDKTGTVTTGRMTLLAVHTADGTDEADVLRLAGALEHA
    SEHPIAQAVAAGATERAGALPTPEDFANVPGLGVQGVVEGHAVLVGREKLLAEWAMELPAELGRAKTRAEAAGRTAIAVA
    WDGEARAVLEVADAVKDTSGEAVTRLRALGLTPILLTGDNRAVAEAVAAEVGIAPAHVIAEVMPEDKVAVVKRLQGEGRS
    VAMVGDGVNDAAALAQADLGLAMGTGTDAAIEAGDLTLVRGDLRAAADAIRLARRTLGTIKSNLFWAFAYNVAALPLAAA
    GLLNPMIAGAAMAFSSVFVVGNSLRLRGFKAAD

    >gi|21219599|ref|NP_625378.1| thioredoxin [Streptomyces coelicolor A3(2)]
    MPRWRRNGGALVRGQDDGKRSEGTAVRVDAADLGAELGPRATLVQFSSAFCAPCRATRRVLGEVAGLVPGVAHVEIDAEG
    HLELVRALDVLKTPTVLVLDADGRVVRRATGQPRRADVIAALGEAV

    >gi|32141135|ref|NP_733526.1| reductase [Streptomyces coelicolor A3(2)]
    MTQNTNLKDPKDPSGRYDVVVVGGGAAGLSAALVLGRSRLRTLVVDAGEPRNAPSDHMQGYLTRDGMSPAEFLALGREEI
    ARYGVDLVRDRAVDVSSDGDFAVELGGGDTVHARRLIVTTGLRDELPAVPGVAERYGRDVLH
    CPFCHGWEVRDERFGVLA
    SSPLSVHQALMVSGWSDDVTLFLHTVAERELSDDDLRRLAAAGVKVVPGEVAALRVEDDRLTGVRLADGTAHDRTVVFVA
    PKAVPQTGLMERLGAELQETPFGAYPVVDPTGRTSVPGVWTAGNAMGFAEQVVHAASGGYRAASAVVGDLIMSALDAALA
    E

    >gi|21219805|ref|NP_625584.1| hypothetical protein SCO1298 [Streptomyces coelicolor A3(2)]
    MRQDMVHRFLAGRSTEERPHHERHHRRRRHVNPVLRVSPAPPAEAAAYFRASLAFHTDVSDVADALAAGGDPGFVLVDCR
    STESWDQGHVPGAVHLPTALVPERAGELLDPAVPVVTY
    CWGPACNGATRAALALAELGYPVKEMLGGFEYWVREGFGFDT
    WQGAERRAADPLTVPVDAADCGC

    >gi|21220357|ref|NP_626136.1| hypothetical protein SCO1869 [Streptomyces coelicolor A3(2)]
    MRVEIWSDIACPWCYVGKARFEKALAAFPHRDGVEVVHRSFELDPGRAKDDVQPVLTMLTAKYGMSQEQAQAGEDNLGAQ
    AAAEGLAYRTRDRDHGSTFDLHRLLHLAKERGRHEALLDAFYRGNFADERSVFNDDERLVELAVGAGLDAEEVRAVLADP
    AAYADEVRADEREAAQLGATGVPFFVLDRAYGVSGAQPAEVFTQALTQAWGERTPLKLIDDGGAEACGPDGCAVPGH

    >gi|21220426|ref|NP_626205.1| secreted protein [Streptomyces coelicolor A3(2)]
    MGNRRRRSVASAVVMVVLSLALGACGTRAKASDADAGRAGAPYASLDDAPEKLGEDGTTIMVGDPDAPVTVHLYEDPRCP
    VCEEFEQRGGGPVLRDALLRGKVKTEYTLASFLDDRMGGSGSKKAVNALRAALEAGKFTEYHEVLYDNQPEEAVDGFTDA
    FLLRLAGRVEGLRGPAFDAAVKDMKYRSFVTASEKAYDRAGGPKEPTGPGTPTAVINDVRVPAEYGGLLFDTEGFTSLLA
    LIAQRPQEWGEDLFT

    >gi|21220453|ref|NP_626232.1| DNA-methyltransferase [Streptomyces coelicolor A3(2)]
    MDSHGQYEQQVVWTVVGTDIGPLLLAATHDGLVNVVFHATDATRGRALERLAARLGTEPVEAPGSPLLAEAIRQVEAYFA
    GRRRDFELPLDWSLISGFNRQVLRELASGVPYGSVVGYGDLAGRVGQPGAAQAVGMAMGANPLPVVVP
    CHRVVESDGGIG
    GFGGGVDTKRRLLALEGVLPEPLF

    >gi|21220638|ref|NP_626417.1| hypothetical protein SCO2161 [Streptomyces coelicolor A3(2)]
    MSVSDETTTVTDGIILTDAAAAKVKALLDQEGRDDLALRVAVQPGGCSGLRYQLFFDERSLDGDVVKDFGGVKVTTDRMS
    APYLGGATVDFVDTIEKQGFTIDNPNATGSCACGDSFS

    >gi|21220654|ref|NP_626433.1| dihydrolipoamide dehydrogenase [Streptomyces coelicolor A3(2)]
    MSGRTPAADRSLETGVAHMHGGRDVANDASTVFDLVILGGGSGGYAAALRGAQLGLDVALIEKNKLGGTCLHNGCIPTKA
    LLHAGEVADQSRESEQFGVKTSFEGVDMAGVHKYKDEVIAGLYKGLQGLVASRKITYIEGEGRLSSPTSVDVNGQRVQGR
    HVLLATGSVPKTLPGLEIDGNRIISSDHALTLDRVPKSAIVLGGGVIGVEFASAWKSFGSEVTVIEGLKHLVPVEDENSS
    KLLERAFRKRGIKFNLGTFFQKAEYTQDGVKVTLADGKEFEAEVLLVAIGRGPVSQGLGYEENGVATDRGFVLVDEYMRT
    NVPTISAVGDLVPTLQLAHVGFAEGILVAERLAGLKTVPVDYDGVPRVTYCHPEVASVGLTEARAKEVYGADKVVSIKFP
    LGGNGKSRILKTAGEIKLVQVKDGAVVGVHMVGDRMGEQVGEAQLIYNWEALPAEVAQLIHAHPTQNEALGEAHLALAGK
    PLHMHD

    >gi|32141161|ref|NP_733563.1| hypothetical protein SCO2206 [Streptomyces coelicolor A3(2)]
    MVNEFRHPPATVSGMEIWINPACSKCRSAISLLDAEGADYTVRRYLEDVPSADEIREVLTRLGLEPWDITRTQEAAAKEL
    GLRDWPRDEASRDRWITALTEHPKLIQRPIITADDGTAVVGRTDEAVRDALSR

    >gi|21220837|ref|NP_626616.1| thiol-specific antioxidant protein [Streptomyces coelicolor A3(2)]
    MAIQVGDKAPDFELKDNHGATVRLSEFRGRKNVVLLFYPFAFTGVCTGELCEVRDNLPQFSDRDTEVLAVSNDSIHTLRV
    FAEQEGLEYPLLSDFWPHGNVSRAYGVFDEDKGCAVRGTFVIDQEGVVRWTVVNALPDARDLAEYVKALDAL

    >gi|21220863|ref|NP_626642.1| hypothetical protein SCO2396 [Streptomyces coelicolor A3(2)]
    MPIQQSEVLYTAVATAENGRDGRVATDDGRLDVVVNPPKEMGGNGAGTNPEQLFAAGYSACFQGALGVVARQEGADISGS
    TVTAKVGIGKNDDGFGIIVEISAEIPTVDAATARSLVEKAHQV
    CPYSKATRGNITVTLA

    >gi|21220950|ref|NP_626729.1| nitrite reductase large subunit NirB [Streptomyces coelicolor A3(2)]
    MTATPGNPPTIVLVGHGMVGQRFLEALAERGLTGTHRVVVLCEEPRPAYDRVQLTSYFSGKTPEDLSMTDPAFIAEHGIE
    LRVGDPAETIDREARRVTARSGLVVEYDVLVLATGSYPFVPPVPGKDAEGCFVYRTIEDLLAIEAYARTRATTGAVVGGG
    LLGLEAAGALNGLGLTSHIVEFAPRLMPVQVDEGGGAALLRTIEEMGLSVHTGVGTQEITTGEDGAVTGMKLSDGSELAT
    DLVVFSAGVRPRDQLARDCGLAVGERGGISVDERCRTVTDERVFAIGECALAADGRVYGLVAPGYEQAETAAATIAAQEA
    SFTGADLSTKLKLLGVDVASFGDAHGTTEDCLDVVYSDSRAGLYKKLVVGRDGTLLGGILVGDAEAYGTLRAFTGSVPPV
    SPESLVLPAGAGAPAQLGPAALPDDAVICSCHNVTKGTIRGAVTEHSCTTVPEVKKCTRAGTGCGSCVKVLGQLVTAELE
    ASGVEVDKGLCGCFAQTREELYEIVGALRITSYRELLDRHGREGARGGEGCEVCKPAVGSIIASLAPSIGASGYVLEGEQ
    AALQDTNDHFLANLQRNGSYSVVPRIPGGEIAPEKLIVIGEIARDFGLYTKITGGQRIDMFGARVEQLPLIWARLVDAGF
    ESGHAYGKSLRTVKSCVGQTWCRYGVQDSVRMAIDLELRYRGLRSPHKLKSAVSGCARECAEAQSKDFGVIATSNGWNLY
    VGGNGGATPRHADLLAQDLSDAELVRLIDRFLMFYIRTADKLERTSTWLERIPGGLDHVRDVVVHDSLGICDELESLMRA
    HVSHYRDEWAETVNDPEKLARFVSFVNAPDVPDPVVGFVPERDQIKPDLPLLDIGRRPASADDLLEGSTRR

    >gi|21221091|ref|NP_626870.1| hypothetical protein SCO2634 [Streptomyces coelicolor A3(2)]
    MRRDMSEKTPVDFWFDPLCPWAWMTSRWVLEVEKVRDIEVRWHLMSLAVLNEDKLDELPAEYRELLETKAWGPVRVVIAA
    QEEHGADVLGDLYTALGTRIHNQEEGPGRETVAAALKDVGLPESLMDHWDGTPYEPQLRASHKEGIDKVGQEVGTPVIAV
    PGADGGQLAFFGPVVTPAPKGEDAAKLWDGTLAVASVPGFYEIKRTRTKGPDFSNL

    >gi|21221184|ref|NP_626963.1| cation-transporting P-type ATPase [Streptomyces coelicolor A3(2)]
    MTSTTADTRTSTTATGPDPGVAEVELLIGGMTCASCAARVEKKLNRMDGVTATVNYATEKARVSYPATTGVADLIATVVK
    TGYTAEEPAPPPEPADEAGAGERGTGDGGSDPELSALRQRLLVSVLLAAPVVLLAMVPALQFDNWQWLSLTLAAPVVVWG
    GLPFHRAAWTGLRHGAATMDTLVSLGTLAAFGWSLWALFFGDAGMPGMRHGFDLTVSRTDGTSAIYLEAAAGVTAFLLLG
    RWLEARSKRRAGAALRALMELGAKDVAVLRAGREVRIPVARLAVGDRFVVRPGEKIATDGTVAEGASAVDASLLTGESVP
    VDVAVGDTVTGATVNAGGRLVVEATRVGADTQLARMAKLVEDAQSGKAQVQRLADRISGIFVPVVLLIAFATFGGWLGAT
    GDTVAAFTAAVAVLIIACPCALGLATPTALLVGTGRGAQLGILIKGPEVLENTRRVDTVVLDKTGTVTTGRMTLHEVYAA
    EGTDEEELLRLAGAVEHASEHPVARAIAAGAEARLGTLPGAEDFENVPGRGARARVAGHEVAVGRLHDTLPPEVSRARDE
    AEQRGRTAVVVGWDGAARGVLAVADAVKETSAEAVAGLRRLGLTPVLLTGDNRRVAESVAAAVGIDEVIAEVLPEDKVAV
    VERLRAEGRTVAMVGDGVNDAAALATADLGLAMGTGTDAAIEAGDLTLVRGDLRVAADAIRLSRRTLATIKGNLVWAFGY
    NVAALPLAAAGLLNPMIAGAAMAFSSVFVVTNSLRLRAFR

    >gi|21221348|ref|NP_627127.1| hypothetical protein SCO2901 [Streptomyces coelicolor A3(2)]
    MSERLQPGDPAPAFTLPDADGNEVSLSDHQGRKVIVYFYPAALTPGCTKQACDFTDNLELLTGAGYDVIGISPDKPEKLA
    KFREAESLKVTLLADPDKKVLDAYGAFGEKKNYGKTYMGVIRSTIVVDEQGKVERALYNVRATGHVAKIIKDLGI

    >gi|21221430|ref|NP_627209.1| hypothetical protein SCO2986 [Streptomyces coelicolor A3(2)]
    MDALYTAAATATHGRDGRAVSSDGTLDLALGIPVEMGGNGQGTNPEQLFAAGYAACFGSALGVVGRAAKVDVSDAAVTAE
    VGIGKQGEGFALAVTLRVELPEGLDEETGRKLVEQAHQV
    CPYSNATRGNIPVDLVIE

    >gi|21221433|ref|NP_627212.1| integral membrane protein [Streptomyces coelicolor A3(2)]
    MRRAWTGPVLLLIAGAGAATGPIVQGRPGTGAVLSVVFVLLAGLTSPLVFPRSVGALEARRRSAADGRPVVFWRPGCTYC
    LRLRLRLGRRARRLHWVDIWRDEAGAEAVREVNDGNETVPTLLVAGRAYTNPDPAWVREQVSSTR

    >gi|21221752|ref|NP_627531.1| redoxin [Streptomyces coelicolor A3(2)]
    MAGMSPLFRRKPTQPPEHSENHLVTLIRKPGCHLCDDAQLVVEKVCAELGVPWEGKDITEDRQLHDQYWEQIPVVLVDGR
    QHTFWRVNEERLRKVLTDQYK

    >gi|21221868|ref|NP_627647.1| hypothetical protein SCO3442 [Streptomyces coelicolor A3(2)]
    MPAPVRPDPAKVQMYWRPGCPYCAMLRRQLRRTGLSYEPVDIWKDQSGAAYVRSVNNGNETVPTVAVAGHPLTNPSARQV
    LEAVQRHAPHLLPETAPADAARRWRPRWPWRRTR

    >gi|21221877|ref|NP_627656.1| methyltransferase [Streptomyces coelicolor A3(2)]
    MATTDVSTDQQAAEASVAQSVRDYYGKVLASSADLKTTACCTDVAPPPHIAAALAEVHDEVMERFYGCGSPIPPALEGAT
    VLDLGSGSGRDVYVLSQLVGPTGRVIGVDMTEEQLAVARRHQDWHAERFGHANTDFRHGYIEDLAGAGIPDASVDVVVSN
    CVVNLSPDKPRVLSEIFRVLKPGGELYFSDIFSDRRLPASLLDDPVLVGE
    CLAGALYTEDFRRALERVGCPDARTLAASP
    VTISDPDIEVKIGFATFTSRTIRAFKLPLEDRCEDYGQVAVYHGTIAEHPHAFDLDDHHRLHTGKPALV
    CGNTADMLAAT
    RYAAHFTVTGDKSQHFGLFPCTPAEGAAAPGLGAAPGCC

    >gi|21221885|ref|NP_627664.1| oxidoreductase [Streptomyces coelicolor A3(2)]
    MEAGKGRNRLRQRVPLPSHARAPAIPRRRTDREFRAMKRYDLVVIGGGSAGLTAARTAGRLGARTLLVERDRLGGDCLWT
    GCVPSKALLHVAADVQAARRATAYGLPPVTGPADLTAALAEVKRAIGAIEPHDSAEALAPYGVDVTHGAASFTGPGTLTA
    GEREVSFRYALIATGSSPALVPIPGLVESGPLTSDTVWELSELPHLLVVLGGGPIGCELGQAFARLGSQVTLVEAMDRLV
    PREEPRASQVLRERLQSEGVTVLTDYRAERVDADAVHGPGGPLPYDALLAVTGRRSHTHGLGLEAAGVELTDAGHIRTDG
    RLRTTNHRIYAAGDVTGRSAFTHLGGTQGGAAAVDALLGVRRPIDYRAAPRVTYTDPEIAGVGLTLDEAHAKYGDRARVH
    TLENDRVDRAVADGRTEGFTTLVLGPRGKIVGATVVSPRAGETVAHLAAAVRLGWTPSDYARTVHPYPTYADGPWHTALT
    DVYARLARGSGPIGALLKLRRGVIR

    >gi|21222248|ref|NP_628027.1| hypothetical protein SCO3839 [Streptomyces coelicolor A3(2)]
    MPTVGIEDLADGDFLLDVREDDEWQAGHAAGALHIPLSEFVARYGELAEAAPQDARVHVLCRVGGRSAQVTMYLVQQGVD
    AVNVDGGMQEWAAAGRPVVDDKGAPGHVL

    >gi|21222296|ref|NP_628075.1| thioredoxin [Streptomyces coelicolor A3(2)]
    MAGTLKHVTDDSFEQDVLKNDKPVLVDFWAAWCGPCRQIAPSLEAIAAEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLN
    VYQGGEVAKTIVGAKPKAAIVRDLEDFIAD

    >gi|21222297|ref|NP_628076.1| thioredoxin reductase (NADPH) [Streptomyces coelicolor A3(2)]
    MSDVRNVIIIGSGPAGYTAALYTARASLKPLVFEGAVTAGGALMNTTEVENFPGFQDGIMGPELMDNMRAQAERFGAELI
    PDDVVAVDLSGEIKTVTDTAGTVHRAKAVIVTTGSQHRKLGLPNEDALSGRGVSW
    CATCDGFFFKDQDIAVIGGGDTAME
    EATFLSRFAKSVTIVHRRDTLRASKAMQERAFADPKISFVWDSEVAEVQGDQKLAGLKLRNVKTGELSDLPVTGLFIAIG
    HDPRTELFKGQLDLDPEGYLKVDAPSTRTNLTGVFGAGDVVDHTYRQAITAAGTGCSAALDAERFLAALSDEDKAEPEKT
    AV

    >gi|32141228|ref|NP_733629.1| thiosulfate sulfurtransferase [Streptomyces coelicolor A3(2)]
    MSRSDVLVDADWLQDHLDDTDIAIVEVDEDTSAYEKNHIKNAIRIDWTQDLQDPVRRDFVDQEGFEKLLSAKGIGNDTLV
    VLYGGNNNWFASYAYWYFKLYGHENVKLLDGGRKKWELDARELVPGDEVPQRAATDYKAKPQNTAIRAFRDDVVKAIGAQ
    NLVDVRSPDEFSGKLLAPAHLPQEQSQRPGHVPSARNIPWSKNANDDGTFKSDDELKQLYTDEQVDLAKDTIAY
    CRIGER
    SALTWFVLHELLGVENVKNYDGSWTEYGSLVGVPIELGANK

    >gi|21222570|ref|NP_628349.1| hypothetical protein SCO4173 [Streptomyces coelicolor A3(2)]
    MIKVTAGADAPERCSQAFTVAAVAVASGVDVSLWLTGESAWFAVPGRAAEFELPHAAPLPDLLDSLLAGGRVTLCTQCAA
    RRDLTEKDVIEGVRIAGAQVFVQEALADDTQALVY

    >gi|21222832|ref|NP_628611.1| glutathione peroxidase [Streptomyces coelicolor A3(2)]
    MRARPRDPGKIQTAPPSILCMTSAPNTRNDDNLPLDVEIGALQGGAADLSQYAGRVVLVVNVASKCGLTPQYAGLERLHE
    RYAEQGFTVLGVPCNQFMGQEPGSADEIAEFCSATYGVTFPMTGKAEVNGEGRHPLYDRLTGFADAEGHSGDIRWNFEKF
    LIGRDGKVAARFSPQTEPEAAEVVAAVEERLAG

    >gi|21222859|ref|NP_628638.1| secreted protein [Streptomyces coelicolor A3(2)]
    MSAASRAPLRSNRTAERFTERTADARARVRSRAARAAVGAAAAALLVSACSSGGTSGGGGQTGFITGSDGIATAKKGERA
    DAPELSGETVDGGQVDVADYKGKVVVLNVWGSW
    CPPCRAEAKNFEKVYQDVKDQGVQFVGINTRDTSTGPARAFEKDYGV
    TYPSLYDPAGRLMLRFEKGTLNPQAVPSTLIIDREGKVAARTLQALSEEKLRKMLAPYLQPEK

    >gi|21223210|ref|NP_628989.1| hypothetical protein SCO4834 [Streptomyces coelicolor A3(2)]
    MTARTQLLDREVGKALSALSAAAKKGLGDPVLAELVMIRASQLNHCAFCLDMHLALARKNGEGEERLGLLAAWEEAADLY
    DGRERAALALTEAMTVLTEGFVPDEVYEEAAVHFDDGELAHLIGLITVINSWNRLMVSRRVPPGGYTP

    >gi|21223211|ref|NP_628990.1| hypothetical protein SCO4835 [Streptomyces coelicolor A3(2)]
    MTTPTDDTKTTDYAAEVPVRLNWSQHAPEVYKAMIRLETVAKRGLDPALYELVKIRASQINHCAFCLDMHTKDALAAGES
    VERIVQLAAWEESRHFYTEKELAAIELTEAVTVLTDGFVPDEVYEKAAKHFDEPELAQLIAAITTINAWNRFGVTCRMTP
    GHYTPGGNA

    >gi|21223329|ref|NP_629108.1| methionine sulfoxide reductase A [Streptomyces coelicolor A3(2)]
    MAAQTQRAVLAGGCFWGMEELIRRLPGVTATRVGYTGGDVPNATYRNHGTHAEAIEILFDPEATDYRALLEFFFQIHDPS
    TKNRQGNDIGLSYRSAIYYVDDEQKRIAEDTIADVDASGLWPGKVVTEVEPVGPFWEAEPEHQDYLQRYPDGYTCHFPRP
    GWRLPARSGSEG

    >gi|21223348|ref|NP_629127.1| hypothetical protein SCO4975 [Streptomyces coelicolor A3(2)]
    MRKDGGMPNRLAQATSPYLLQHAENPVDWWPWEAEAFEEARRRGVPVLLSVGYSACHWCHVMAHESFEDGPTAEYLNSHF
    VSVKVDREERPDVDAVYMEAVQAATGQGGWPMTVFLTPDAEPFYFGTYFPPEPRHGMPSFRQVLQGVQQAWAERRDEVDE
    VAGKIVRDLAGREISYGDAEAPGEEQLGQALLGLTREYDERRGGFGGAPKFPPSMVIEFLLRHHARTGAEGALQMAADTC
    ERMARGGIYDQLGGGFARYSVDREWVVPHFEKMLYDNALLCRVYAHLWRATGSDLARRVALETADFMVRELRTAEGGFAS
    ALDADSDDGTGKHVEGAHYVWTPAQLTEVLGAEDAELAAQYFGVTQEGTFEHGASVLQLPQQESVFDAARIASVRERLLA
    ARDGRPAPGRDDKVVAAWNGLAVAALAETGAYFERPDLVEAAVAAADLLVRLHLDEQVRLTRTSKDGRAGANAGVLEDYA
    DVAEGFLALASVTGEGVWLDFAGFLLDHVLTRFTDESGSLYDTAADAERLIRRPQDPTDNATPSGWSAAAGALLSYAAHT
    GSAPHRAAAERALGVVKALGPRVPRFIGWGLAAAEALLDGPREVAVVAPDPADPAARGLHRTALLGTAPGAVVAFGTEGS
    DEFPLLADRPLVGGAPAAYVCRNFTCDAPTTDPDRLRTALGVAPTG

    >gi|21223405|ref|NP_629184.1| alkyl hydroperoxide reductase [Streptomyces coelicolor A3(2)]
    MLTVGDKFPEFDLTACVSLEKGKEFQQINHKTYEGQWKVVFAWPKDFTFVCPTEIAAFGKLNDEFADRDAQILGFSGDSE
    FVHHAWRKDHPDLTDLPFPMLADSKHELMRDLGIEGEDGFAQRAVFIVDQNNEIQFTMVTAGSVGRNPKEVLRVLDALQT
    DELCPCNWSKGDETLDPVALLSGE

    >gi|21223547|ref|NP_629326.1| molybdopterin biosynthesis-like protein MoeZ [Streptomyces coelicolor A3(2)]
    MSLPPLVEPAAELTVDEVRRYSRHLIIPDVGMDGQKRLKNAKVLAVGAGGLGSPTLMYLAAAGVGTLGIIEFDEVDESNL
    QRQVIHSQADIGRPKAESARDTIQGINPLVDVILHQERLEADNVMDIFSQYDLIVDGTDNFATRYLVNDACVLLNKPYVW
    GSIYRFDGQASVFWSEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQTNEAIKLLQGIGEPLVGRLMIYDALE
    MTYRQVKVRKDPNCAVCGENPTVTELIDYEAFCGVVSEEAQAAAADSTITPKQLKEWIDDGENIELIDVREPNEFEIVSI
    PGARLIPKNEFLMGSALENLPQDKKIVLN
    CKTGVRSAEVLAVLKSAGFSDAVHVGGGVIGWVNQIEPEKPVY

    >gi|21223556|ref|NP_629335.1| glutaredoxin-like protein [Streptomyces coelicolor A3(2)]
    MSGTVTMYSTTWCGYCRRLKSQMDREGIAYTEVNIEQDPESAAFVEKANGGNQTVPTVLFPDGSTLTNPSLAQVKQKIGA


    >gi|21223779|ref|NP_629558.1| thioredoxin [Streptomyces coelicolor A3(2)]
    MSGVVDLAAVKQAQEAKAKAEQARAEAARTGGAGAVSPADLVIDVDEAGFESDVLQRSTEVPVVIDFWAEWCEPCKQLSP
    VLERLAVEYNGRFLLAKIDVDANQMLMQQFGVQGIPAVFAVVAGQALPLFQGAAGEQQIRQTLDQLVQVGEERFGLTGLV
    VDPEAEPGAERPAAPERPAGPHDAALDAAVQAMDAGDLGGAVQAYKNVLAEEPGNTEAKLGLAQAELLQRVQDADPQKVR
    REAADKPGDAQAQIAAADLDLVGGHVEDAFGRLIDTVRVTAGDDRDAVRLRLLELFEVVGADDPRVAAARRALARALF

    >gi|21223797|ref|NP_629576.1| thioredoxin [Streptomyces coelicolor A3(2)]
    MPEVTDADFAAEVIGSELPVLVEFTADWCPPCRQMAPVLSALAEEEGDRFRVVQLNVDQNPATTNAYKVLSMPTFMVFRG
    GEPVKSMVGSRPKRRLLEELADVV

    >gi|21224117|ref|NP_629896.1| hypothetical protein SCO5771 [Streptomyces coelicolor A3(2)]
    MSGPTGIDALLERVRAGYRRIAPDEAYDAAEAGTALLVDIRYAALRERDGVIPGALVIERNELEWRLDPLGSHRVPEATD
    HDVRVVVV
    CDEGYASSLAAESLHRLGLHRATDLIGGFQAWRTAGLPVAARDQ

    >gi|21224198|ref|NP_629977.1| thiosulfate sulfurtransferase [Streptomyces coelicolor A3(2)]
    MNAIISASELADELAGPNPPVLLDVRWQLSTAKAAGAPPFDGRAEYAAGHLPGAVYVDLDRELASAPGVNGRHPLPEVGE
    FGAAMRRAGVSHGRPVVVYDGGQGWAAARAWWLLRWTGHPNVRVLDGGLPSWEAPLSADVPAPAEGDFTPAPGATGLLDA
    DGAAALARSGVLFDARAGERYRGEVEPIDPVGGHIPGAVSAPTTANVAPDGHFLPAEELRARFKTLGATEDGAVGVY
    CGS
    GVSAAHEVLALTVAGIPAALYVGSWSEWSSDPARPVAVGPDPQ

    >gi|21224330|ref|NP_630109.1| hypothetical protein SCO5993 [Streptomyces coelicolor A3(2)]
    MTGSTPSSSASPSSSRPPSASRRSRRRTVAALAVLAAAAVTAAFALTLDDADNREEKAGEPAAVTASAAPAPADEGLLAL
    ARRDASDPLAIGRADAPVVLIEYSDFQ
    CPFCGRFARETKPELLRSYVDKGTLRIEWRNFPIFGEESEQAALAGWAAGRQN
    KFWEFHDVAYGKPRERNTGAFDAENLVAMAREAGIADIERFQADMASDEARGAVRADQEEGYTLGVTSTPAFLVNGRPIL
    GAQPTDTFEEAVETAATAAKTANTTEGAGR

    >gi|21224371|ref|NP_630150.1| flavoprotein oxidoreductase [Streptomyces coelicolor A3(2)]
    MNMSAGDGKSERLVVIGGDAAGMSAASQARRLKGPDELEIVAFERGHFSSFSACGIPYWVGGDVTGRDALIARTPEEHRA
    RDIDLRMRTEVTEIDVAGGRVRARDVDSGARSWMSYDKLVIGTGARPVRPELPGIDAPGVHGMQTLDDGQALLDTLTRTR
    GRRAVVVGAGYIGVEMAEALINRGYEVTVVNRGREPMSTLDPDMGRMVHGAMEGLGITMVNDAEVTGVLTGDDGRVRAVA
    TEDAEFPADVVVLGIGVRPETGLAAAAGLPLGAHGGLLTDLAMRVRGHENIWAGGDCVEVLDLVSGQERHIPLGTHANKH
    GQVVGTNVGGGYATFPGVVGTAVSKVCDLEIARTGLREKDALRAGLRFVTATVESTSRAGYYPNASPMTVKMLAERRTGR
    LLGVQIVGREGAGKRVDIAAVALTAGMTVEQMTALDLGYAPPFSPVWDPVLVAARKAAREVERQR

    >gi|21224391|ref|NP_630170.1| oxidoreductase [Streptomyces coelicolor A3(2)]
    MSYDVEKPDEQWRAELAPAEYAVLREAATEPAFTGEYTDTKTEGVYSCRACGAELFTSTTKFESHCGWPSFYDPRDTDAV
    ELIEDRSHGMVRTEVRCARCGSHLGHVFKGEGYPTPTDQRY
    CINSISLRLEPKAG

    >gi|21224477|ref|NP_630256.1| methylated-DNA-protein-cysteine methyltransferase [Streptomyces coelicolor A3(2)]
    MTTTTPTTTTTSIPAETYWHEVDSPVGPLLLTAGSDGALTSLSVPGQKGGRSVRDGWRHDAGPFRVAEEQLGAYFAGELT
    EFSLPLRAQGTAFRERVWAALDDVPYGATTTYGEIAARIGASRPAVRAVGGAIGANPLLILRP
    CHRVIGADGSLTGYAGG
    LERKTRLLSLEGAPLSRPVPLPATPR

    >gi|21224727|ref|NP_630506.1| DNA-binding protein [Streptomyces coelicolor A3(2)]
    MPTPFRHTEPLPPKAATGRVAEVYAQAARDFGISEPAPFVALSSAPALVAPAWALMRESLLAGPGDRTGKEVAAFGVSQA
    NKCRF
    CVDAHTMLLHATGDHALAERLAGGLEPADERHARVLDWARRTRVPGAAREPHPFPPEEAPGYLGTVLAFHFINRV
    VSSLVTETLLPAGAQRLRPVRSLAGRSLSRTVRRTAVPGASLPLLDDPGRGPAWAAGTPVGPAYAALSSAAPMGAGLLDA
    DDQDLVRATLRDWDGSHPPRTPDPFPDRRERPGARLALLVALAPYRITDADVAAWRRPEHTDHCLVHLVAYGAFAAVDRV
    ETALTAPTARPAPRETS

    >gi|21224768|ref|NP_630547.1| methylated-DNA-protein-cysteine methyltransferase [Streptomyces coelicolor A3(2)]
    MKQHTVIDSPYGALTLVAEDGALCGLYMTDQRHRPDEETFGARDERPFAETEEQLEAYFSGELKDFTLGLRLNGTPFQRM
    VWTQLRKIPYGETRSYGELAAALGNPAASRAVGLANGRNPIGIIVP
    CHRVIGASGGLTGYGGGLERKQRLLDFERGTAVP
    EALF

    >gi|21224833|ref|NP_630612.1| ATP/GTP binding protein [Streptomyces coelicolor A3(2)]
    MATTRSAHTVWEGNLLEGNGVVTFDSSGIGEQPVSWPSRAEQANGKTSPEELIAAAHSSCFSMALSHGLAGAGTPPTKLT
    TSADVTFQPGEGIKGIHLTVEGTVPGLDNDAFVAAAEDAKKN
    CPVSQALTGTTITLSAKLA

    >gi|21225126|ref|NP_630905.1| thioredoxin reductase [Streptomyces coelicolor A3(2)]
    MSTAKDVRDVIVIGSGPAGYTAALYTARASLNPLVFGGAIFVGGSLTTTTEVENFPGFPDGVQGPELMENMRAQAERFGA
    EMVDDDIVAVDLTGDVKTVTDTAGTVHRARTVIVATGSGYRKLGVPKEDELSGRGVSW
    CATCDGFFFRDRDIVVVGGGDT
    AMEEATFLTRFARSVTVVHRRSALRASQVMQNRAFSEDKISLAFDSEVATLHEENGMLSGMTLRDTLTGETRELATTGLF
    IAIGHDPRTELFKGQLHLDSEGYLMVESPSTRTNVPGVFGAGDVVDHTYRQAITAASSGCAAALDAERYLAARSDTSVSA
    EVVAVA

    >gi|21225393|ref|NP_631172.1| hydroperoxide resistance protein [Streptomyces coelicolor A3(2)]
    MTVHGGAASHGRASGHARSADGALDLDLRMPAELGGDGRGTNPEQLFAAGFAACFHGALSLLARQEALDPAAISVVATVA
    FGRDPEDGGYLLRVDLVVRWPGVDPATADELIGKADAL
    CPYARMAWRGTPTTITLAS

    >gi|21225411|ref|NP_631190.1| hypothetical protein SCO7129 [Streptomyces coelicolor A3(2)]
    MDARINYFGNALAGKVMKHLNSAGAAVQAALPVATQELVKIRASQINGCGFCTDMHTKDAAAAGEDQQRLNLVAVWREAT
    VFSDAERAALAVTEEGTRIADASGGVSDEVWAEAAKHYDEDQLAALISLIAVINAYNRINVINQQPAGGYKPGMFG

    >gi|21225417|ref|NP_631196.1| hypothetical protein SCO7135 [Streptomyces coelicolor A3(2)]
    MTTRIVTVAEGVRLTRSVSIGTHHLTADEPEPIGADEGPTPGELVLAALGSCTSMAVRALADRHEWPLERIDVAVRFGKQ
    GEIVKNVGLTGDLEPAQREQLLAAAGRCPVHRLLAREAKIVTVPALLAEPEASHV

    >gi|21225627|ref|NP_631406.1| hypothetical protein SCO7353 [Streptomyces coelicolor A3(2)]
    MSALPAVGDTVEDFTLPDETGTPRRLSELLADGPVVLFFYPAALTTGCTAEACHFRDLAAEFAAVGARPVGVSGDPVERQ
    QEFAGRHTLGMPLLSDTDGAVRERFGVKRGFSLAPTKRVTFVVGQDRTLLEVVRSEIRMNTHADRALAALRAHRP

    >gi|21225783|ref|NP_631562.1| integral membrane protein [Streptomyces coelicolor A3(2)]
    MTTASPAGPSPAAPPRPSTPLFAPSPTSSARPEAPPLPPVRRTPLAVSGLLAVALTAYVWSAHGAKPGVLLLLGLGLGLA
    LFHSRFGFTSAWRQLVAVGNGTGLRAHALLLGTTATLFALVIGTESGLFGSQPAPSAGPIGVGLFAGSALFAIGMQLGGA
    CASGTLFAVGSGQTSIVLTLGGFVAGATLAAWQFDLWKDLPAWEPVVLSEHLGWFGSWAVTVAALLLVVLVSRRIQARRN
    PPPLGAVPSARRAVVRAVRGSWPLAVGALALALLGAGVLLVSGGAWGVTSAFSLWGSELVGALGGHPENWTWWQRPGNAE
    MLAGPVLADKTSLTDIGIMIGAAVAASLGGTWALHRGIPWRTAVAAVLGGVLMGIGARLAGG
    CNIGAYLAGIASGSLSGW
    LWGAFALAGTWVGLKLRPLFGLGNPKPGDGVC

    >gi|21234043|ref|NP_639620.1| putative oxidoreductase [Streptomyces coelicolor A3(2)]
    MAVATPAYASDALDEGTVDAVVIGGGAAGLNGALMLARSRRSVVVIDSGSPRNAPAEAMHGFIVLDGTPPSEILRRGREQ
    VRQYGGRVVSGEVVSAESAAPSADGDLRFTVTLADGRGITARRILVATGLTDALPEVPGLAEHWGHSVVH
    CPYCHGWEVR
    DEPIGILATGPASIGPALLFRQLTEDLTYFTHGTDLDEDSRARFNARGIRVIDTPVTEVVNDEDGVLAGVRLADGQVVAR
    RVLAVTPQMQARIKGLEGLGLPVQDLPTGRTFASGIDGTTEVPGVWVAGNATDPVAQVGTSAAAGALAGIEMNKMLAIAD
    TDAALQKLSGGSPKGATG

    >gi|21234307|ref|NP_639918.1| putative oxidoreductase [Streptomyces coelicolor A3(2)]
    MAVATPAYASDALDEGTVDAVVIGGGAAGLNGALMLARSRRSVVVIDSGSPRNAPAEAMHGFIVLDGTPPSEILRRGREQ
    VRQYGGRVVSGEVVSAESAAPSADGDLRFTVTLADGRGITARRILVATGLTDALPEVPGLAEHWGHSVVH
    CPYCHGWEVR
    DEPIGILATGPASIGPALLFRQLTEDLTYFTHGTDLDEDSRARFNARGIRVIDTPVTEVVNDEDGVLAGVRLADGQVVAR
    RVLAVTPQMQARIKGLEGLGLPVQDLPTGRTFASGIDGTTEVPGVWVAGNATDPVAQVGTSAAAGALAGIEMNKMLAIAD
    TDAALQKLSGGSPKGATG

    >gi|21221334|ref|NP_627113.1| hypothetical protein SCO2885 [Streptomyces coelicolor A3(2)]
    MEARLNLFANPLAGKLLRHINSAGKAVGDSALSAATQELVKIRASQINGCGFCLDMHTKDAAKAGETSLRLNLIAAWREA
    KVFTDAERAALELTEQGTRIADASGGVSDEAWANAAEHYDEEQLTALVGLIAVINTYNRLNVITQQPAGDYEPGMFG