Streptomyces avermitilis MA 4680 uid57739

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|29827158|ref|NP_821792.1| cation-transporting P-type ATPase [Streptomyces avermitilis MA-4680]
    MGAEPMTALVTTDLSVGGMTCAACVTRVEKKLGKLDGVTATVNLATGRARVSHPTEVSVGQLVATVEKAGYTAALPEPPK
    KQPREGGRETEEARQERDRLLGTALLAVPVLVLSMVPVLQFRNWQWLCFMLAAPVAVWGAWPFHARAVRGLRHSAATMDT
    LVSLGVVASFAWSAYALFLGGAGDPGMRMPFSLVPSASDGVAHIYLEAAVGVPLFVLAGRFLEARARRGTGAALRSLAEL
    AAKEVSVRDGDSERLVPIAELEGGQVFVVRPGERVATDGQVVEGSSAVDLALVTGESEPVEVGPGSAVVGGAVNAGGLLL
    VRATAVGADTQLARITRLVTEAQAGKARAQRLADSVAGVFVPVVLALAVTALGFWLGAGADPQAAITACVAVLVVACPCA
    LGLATPTALMAATGRGAQLGVLVTGPQALEGLQHIDAVVLDKTGTLTTGHMSVARVTVVPDGLGRDAVLRLAGGVEQGSE
    HPLGRAVSAYARRELREQRLPDVGEFSAMPGRGVRGRVEGRLVEVLAPDDELPAALADALPVAEAAAHTPVLVRVDGVAE
    ALIEVGDVVRPGSYRAVDRLRRLGVRPVLATGDREAPARAVAATLGIDEVHARCTPEGKAELVRELQEQGYRVAVIGDGV
    NDAAALAGADLGIAMGTGTDVAIGAADVTLVRGDIEALADAVRLARRTLGTIRANLVWAFGYNVVTVPLALVGLLNPMLA
    AAAMSASSVLVVGNSLRLRGWQPSPARRRTR

    >gi|29827208|ref|NP_821842.1| oxidoreductase [Streptomyces avermitilis MA-4680]
    MNETARTYDVIVIGGGPVGENVAERARAAGLSAVIVERELLGGECSFWACDPSKALLRPVVARADASRVPGLDPAVAGPL
    DVEAVLAHRDMMSSYWKDEDQADWLNAVSVDLIRGHGRLTGCKEVAVQTSEGDTIALTARHAVAVSTGTRAALPPIPGFD
    TVRPWTSREATSADKVPDRLAVVGGGVVAVEMATAWQALGSQVTMLVLENGLLERMEPFAGELVADGLREAGVDIRFSTT
    VTSMAREGGEDGEVRITLSDGRELAADEILLATGRAPQTRDVGLETVGLTPGDWLTVDDTFRVTGVDGGWLYAVGDVNRR
    ALMTHQGKYQARIAGTVIGARAKGEPIDDAPWGAHVATADHAAVPQVVFTTPEVASVGLTSREAEQSGRRIEVVDYDLAR
    VAGAHQYGDDYRGRARMLIDTDRNTVVGVTFAGPGVGELVHSATIAVAGEVPLDRLWHAVPAFPTLGEVWLRLLETYRG

    >gi|29827478|ref|NP_822112.1| C5-O-methyltransferase [Streptomyces avermitilis MA-4680]
    MMAVPEQTPPSSLEVGDYYDRLTDLMNRALGGNTHLGYWPQPGDGSSPGKAADRLTDLLIGKLRGITGRRVLDVGCGSGK
    PAVRLALSAPVDVVGVTVSEVQVGLATALAKQSHVADRVVFTRADAMELPFPDGSFDAAWALECLLHMPSPAQVIREIAR
    VLRPGGRLAVTDVALRAFGRTGMKRGE
    CTSQLLAVPALVHIDEYAGMIADAGLELHELTDIGDQVVGPSFAALRDHVNEH
    LDEYAAAFGIGVAEMRKVVAQCTTLPWTPDIGYVVLTARRPGE

    >gi|29827615|ref|NP_822249.1| bacterioferritin comigratory protein [Streptomyces avermitilis MA-4680]
    MTRRVDVGDKVEDFVLPDETGTPRQLSDLVADGPVVLFFYPAALTAGCTAEACHFRDLAAEFAAAGARPVGISGDPVDRQ
    QEFAGQHTLGFPLLSDEDGTIRERFGVKRGFSLAPTKRVTFVIAEDRTVLEVVRSELRMSAHADRALTALRAHRS

    >gi|29827877|ref|NP_822511.1| rhodanese family protein [Streptomyces avermitilis MA-4680]
    MWDTLAQWARYRSSGAASIRRRVSIPAMTDALLSGPLVDDAWLAAHLDDPRLVVLDATALLPSPRHDGDHRSGSGHAQWA
    ERHIPGSRHADLTGDLSDHEAPYHFAVPSPRALADALQRLGVRDGSEVVAYDSGGGIWAARLWWMLRSISVPAAVLDGGW
    AVWEEGGHPVAHGDETGAVRVSRPLTPVPRPDVWTGIDEVAAISRGERPGTLVCALPPGGFDGSAATRYSRRGHIPGSLS
    LPGRGLLDATGRLLPRSELARRTGAVLQDAESPVVLY
    CGGGISAAGTALALTLLGREDISLYDGSLEEWSGDLSRPIRLG
    HQLGDQRLGDQR

    >gi|29828024|ref|NP_822658.1| thioredoxin [Streptomyces avermitilis MA-4680]
    MTGLVVCVVVLVVASAYGVLHRRRSGRVRVRGRDGGKHLGAAELGEGLGERATLVQFSSAFCAPCRATRRVLTEVAGLVP
    GVTHVEIDAEDRLELVRELDIIKTPTVLVLDAEGRIVRRATGQPRKADVIAALGEAV

    >gi|29828088|ref|NP_822722.1| hypothetical protein SAV_1546 [Streptomyces avermitilis MA-4680]
    MAEETAAPKADAAAPRSFTLSDTTAGPVGTRGTRVFIDKQSPKAYHALVETSEAVRAVAADAGLDRVLVELINLRVSQIN
    GCAY
    CLSLHTKAALRVGETTQRLGVLAAWRDTELFTSRERAALALAEVTTDPADATAQEHAYDAARQVLTDDEISAVIWV
    AVTINAFNRVSIMSKHPVRGIPHQ

    >gi|29828151|ref|NP_822785.1| ferredoxin reductase [Streptomyces avermitilis MA-4680]
    MKRILVVGASAAGLTAAETLRREGYDGTITLVGDECHAPYDRPPLSKQLLAAEWEPERLALRTPGDLEALDLDLRLGVAA
    TGLDVTDRTVRLADGSSVPYDGLIVATGVRPRRLPGEGAHVLRTVDDALALRDRLGPGTRLVVVGAGFLGAEAAAVARRL
    GADVTLLEPAPVPLAHAVGAEVGEVLSRAHLEHGVELRTGVTVTEVTDEGVRLADGEVVEADEILVAIGCLPNTEWLKGS
    GLTLGDGLVCDAYGEAARSVYGAGDVARWHNPLFGVSMRIEHRTNAAEHGMAAARNLLRPEARRPFAPVPYFWSDQYDMK
    IQAYGYFRAHDETVVVEGDLAERRFVAAYRTGDRLTGALAAGLPPRAIRRWRQAIAAGATWREAVRDNISPATAPWGSVL
    PEKIT

    >gi|29828404|ref|NP_823038.1| ATP/GTP-binding protein [Streptomyces avermitilis MA-4680]
    MATTRSAHTVWEGNLLEGNGVVTFDSSGIGQQPVSWPSRAEQANGKTSPEELIAAAHSSCFSMALSHGLAGAGTPPTKLV
    TSADVTFQPGEGITGIHLTVEGTVPGLDNDAFVAAAEDAKKN
    CPVSQALTGTTITLSAKLA

    >gi|29828475|ref|NP_823109.1| methylated-DNA--protein-cysteine S-methyltransferase [Streptomyces avermitilis MA-4680]
    MKQHMLVDSPYGPLTLVAADGVLCGLYMVAQRHRPSEETFGARDDTPFGETVDQLTAYFAGELTEFDLPLRLDGTPFQRT
    VWEQLRRIPYGETRSYGELAGALGNPKASRAVGLANGKNPLGIIVP
    CHRVVGADGSLTGYGGGLERKRRLLDFERGAALF


    >gi|29828595|ref|NP_823229.1| methylated-DNA--protein-cysteine S-methyltransferase [Streptomyces avermitilis MA-4680]
    MTVYATIDSPLGALLLVGEESATAKGGTALASLSVPGQKGGATVQDDWLEKAEAFDEIVTQLTSYFDGRLTRFDIEYVTG
    GSEFQRRVWQALEAIPYGTTLSYGDIAARIGAPRAAVRAVGTAIGANPLLVVRP
    CHRVIGASGALTGYAGGLERKRRLLD
    LENAHRDA

    >gi|29828696|ref|NP_823330.1| dihydrolipoamide dehydrogenase [Streptomyces avermitilis MA-4680]
    MENMNTPDVIVIGGGTGGYSAALRAAALGLTVVLAERDKVGGTCLHRGCIPSKAMLHAAELVDGIAEARERWGVKATLDD
    IDWPALVATRDDIVTRNHRGVEAHLAHARVRVVRGSARLTGPRSVRVEGAPDDLPGGAGDFTARRGIVLATGSRPRTLPG
    LVPDGRRVVTSDDALFAPGLPRSVLVLGGGAIGVEYASFHRSMGAEVTLVEAADRIVPLEDVDVSRHLTRGLKKRGIDVR
    AGARLLDAELLEAGVRARVRTVRGEIRTLEAERLLVAVGRAPVTDGLDLAAAGLATDERGFVTPSDWDRLETAVPGIHVV
    GDLLPPPSLGLAHASFAEGLSVAETLAGLPSAPVDYAAVPRVTYSSPQTASVGLGEAEARARGHEVDVNTMPLTAVAKGM
    VHGRGGMVKVVAEEGGGQVLGVHLVGPHVSEMIAESQLIVGWDAQPSDVARHIHAHPTLSEAVGETFLTLAGRGLHQQ

    >gi|29828746|ref|NP_823380.1| oxidoreductase [Streptomyces avermitilis MA-4680]
    MSYDIEKPDEAWRAELTPAEYAVLRKAGTEPAFTGEYTDTRTKGVYSCRACGAELFTSNEKFESHCGWPSFYDPKNTDAV
    ELIDDRSHGMVRTEVRCARCGSHLGHVFEGEGYATPTDQRY
    CINSISLRLAPDEG

    >gi|29828767|ref|NP_823401.1| flavoprotein oxidoreductase [Streptomyces avermitilis MA-4680]
    MSMSRTSRTKERLVVIGGDAAGMSAASQARRLKGPAELEIVAFERGHFTSYSACGIPYWVGGDVAERDQLIARTPEEHRA
    RGIGLRIRTEVTEIDAEGARVRSRDLASGAESWTSYDKLVIATGARPVRPELPGVDAPGVHGVQTLDDGQALLDTLAATR
    GRRAVVVGAGYIGVEMAEALINRGYEVTVVNRSKEPMATLDPDMGRLVHKAMEGLGITMVNDAEVTGLPTGDDGRVRAVA
    TEDAEYPADVVVLGIGVRPETTLAQAAGLPLGEHHGLLTDLAMRVRGHENIWAGGDCVEVLDLVSGSERHIPLGTHANKH
    GQVIGANVGGGYATFPGVVGTAVSKVCDLEIARTGLREKDARRAGLQFEAVTVESTSRAGYYPGADPMTVKMLAERRTGR
    LLGVQIVGGEGAGKRVDIAAVALTAGMTVEQMTALDLGYAPPFSPVWDPILVAARKAVAAVRANGV

    >gi|29828954|ref|NP_823588.1| thiosulfate sulfurtransferase [Streptomyces avermitilis MA-4680]
    MNVIISASELASELAGPNPPTLLDVRWQLSTAKAGGAAPFDGRAAYASGHVPGAVFVDLDADLAGPAGPAGRHPLPDLAH
    FGEAMRAAGVSARRPVVVYDGGQGWAAARAWWMLRWTGHPAVRVLDGGLAAWSGPVTTETEELVAGDFEPAPGALPLLDA
    DGAAALARTGLLLDARAAERYRGDVEPIDPVGGHIPGAVSAPTTENVAENGRFRPAAELADRFKSLGVNDAAEVGVY
    CGS
    GVSAAHEVLALAVAGIPAALYVGSWSEWSAAGSRPVAAGPDPQ

    >gi|29829350|ref|NP_823984.1| thioredoxin [Streptomyces avermitilis MA-4680]
    MTEVTDADFEAEVIGADLPVLVEFTADWCPPCRQMGPVLSSLAFEEGDRLKVVQLDVDTNPETTNAYKVLSMPTFMVFRG
    GEPVKSMVGARPKRRLLEELADVL

    >gi|29829372|ref|NP_824006.1| thioredoxin [Streptomyces avermitilis MA-4680]
    MQPRNMSMSGVVDLAAVKAAQEAKAKAEQARAEAARQGGGGTAVSAVPPSSLVIDVDEAGFERDVLQRSTEVPVVIDFWA
    EW
    CEPCKQLSPVLERLAVEYNGRFVLAKIDVDANQMLMQQFGVQGIPAVFAVVAGQALPLFQGAAGEQQIRGTLDQLVEV
    AEQRFGLTGLTVATDAEPGAAQEAPPIPAGPYDALLEAAVQALDAGDFGGAVQAYKNVLSDDPGNTEARLGLAQAELLQR
    VQDADPQRVRVEAAEKPGDAQAQIAAADLDLVGGHVDDAFGRLIQTVQRTAGDDRDAVRLRLLELFEVVGADDPRVTAAR
    RALARALF

    >gi|29829615|ref|NP_824249.1| glutaredoxin-like protein [Streptomyces avermitilis MA-4680]
    MPGTVTMYSTTWCGYCSRLKSQMDREGITYNEINIEHDPDSAAFVEKANGGNQTVPTVLFADGSTLTNPSLAQVKQKIGA


    >gi|29829624|ref|NP_824258.1| molybdopterin biosynthesis-like protein MoeZ [Streptomyces avermitilis MA-4680]
    MSLPPLVEPAAELTVDEVRRYSRHLIIPDVGMDGQKRLKNAKVLCVGAGGLGSPALMYLAAAGVGTLGIVEFDEVDESNL
    QRQIIHSQSDIGRSKAQSAKDSVLGINPYVNVILHEERLEAENVMDIFSQYDLIVDGTDNFATRYLVNDACVLLNKPYVW
    GSIYRFDGQASVFWSEHGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVNEAIKLLAGIGEPLVGRLMIYDALE
    MQYRQVKVRKDPDCAVCGENPTVTELIDYEAFCGVVSEEAQEAAAGSTITPKQLKEWIDDGENIEIIDVREINEYEIVSI
    PGAKLIPKNEFLMGTALEALPQDKKIVLH
    CKTGVRSAEVLAVLKSAGFSDAVHVGGGVIGWVNQIEPNKPVY

    >gi|29829774|ref|NP_824408.1| alkyl hydroperoxide reductase [Streptomyces avermitilis MA-4680]
    MLTVGDKFPEFDLTACVSLEKGNEFQQINHKTYEGQWKVIFAWPKDFTFVCPTEIAAFGKLNDEFADRDAQVLGFSGDSE
    FVHHAWRKDHDDLRDLPFPMMADSKHELMRDLGIEGEDGFAKRAVFIVDQNNEIQFSMVTAGSVGRNPKEVLRVLDALQT
    DELCPCNWTKGETTLDPVALLAGE

    >gi|29829838|ref|NP_824472.1| hypothetical protein SAV_3296 [Streptomyces avermitilis MA-4680]
    MNRLAHETSPYLLQHADNPVDWWPWSPEAFEEARKRGVPLLLSVGYSSCHWCHVMAHESFEDETTAAYLNEHFVNVKVDR
    EERPDVDAVYMEAVQAATGQGGWPMTVFLTPDAEPFYFGTYFPPEPRHGMPSFRQVLEGVRSAWTDRRDEVAEVAGKIVR
    DLAGREISYGDSSTPGEEELAQALLGLTRDYDARRGGFGGAPKFPPSMVVEFLLRHHARTGSEGALQMAQDTCERMARGG
    IYDQLGGGFARYSVDRDWVVPHFEKMLYDNALLCRVYAHLWRATGSELARRVALETADFMVRELRTGEGGFASALDADSD
    DGSGRHVEGAYYVWTPEQLEQALGREDAELAARCFGVTRDGTFEEGASVLQLPQQDVVFDAERIASVRARLLGRRAERPA
    PGRDDKVVAAWNGLAIAALAETGAYFDRPDLVEAAIGAADLLVRLHLDEHARLARTSKDGRAGAHAGVLEDYGDVAEGFL
    ALASVTGEGVWLEFAGFLLDHVLAQFTDPESGALYDTAADAEKLIRRPQDPTDNATPSGWSAAAGALLSYAAHTGAEPHR
    TAAERALGVVKALGPRAPRFVGWGLAVAEALLDGPREVSVVGPADDPATGTLHRTALLGTAPGAVVAVGTPGSDEFPLLA
    DRPLVGGGPAAYVCRNFTCDAPITDADRLRTALSG

    >gi|29829849|ref|NP_824483.1| methionine sulfoxide reductase A [Streptomyces avermitilis MA-4680]
    MAAQTQRAVLAGGCFWGMEDLIRRLPGVTATRVGYTGGDVPNATYRNHGTHAEAIEILFDPARTDFRAILEFFFQIHDPS
    TKNRQGNDIGLSYRSAIYYVDDEQKRIAEDTIADVDASGLWPGKVVTEVEPVGPFWEAEPEHQDYLERYPDGYTCHFPRP
    GWRLPARAEG

    >gi|29829971|ref|NP_824605.1| hypothetical protein SAV_3428 [Streptomyces avermitilis MA-4680]
    MTTNDTTTATTTPTAEYAPEHSPRLNWAKLAPDVYKAMIRLDTAAQRGLDPKLRELVKIRASQLNHCAFCLDMHTKDALA
    AGESVERVVQLSAWDESRHFYTEKELAALELTEAVTVLTDGFVPDEVYERAAKHFEEAELAQLIAAITVINAWNRFGVTC
    RLVPGHYQAGQHK

    >gi|29830153|ref|NP_824787.1| organic hydroperoxide resistance protein [Streptomyces avermitilis MA-4680]
    MYVAEATAHGGRDGYVTSQDGRLELKVAMPPALGGNGDGTNPEQLFAAGYSACFHNALVLVGRREGYDLSGSTVAAKVGI
    GPNKQRGYGLAVALSVSLPVVDQDLATKLVDAAHEV
    CPYSNATRGNIEVTIVLG

    >gi|29830321|ref|NP_824955.1| glutathione peroxidase [Streptomyces avermitilis MA-4680]
    MTTDNAATSVLDTEIDALQGGSADLSQYAGKAVLIVNVASKCGLTPQYAGLERLQERYAAQGFTVLGVPCNQFLGQEPGT
    SEEIAEFCSATYGVTFPLTEKVEVNGDARHALYESLVGFADGEGHTGDIRWNFEKFLIGRDGKVVARFSPQTEPESAEVV
    TAVERQLAG

    >gi|29830577|ref|NP_825211.1| hypothetical protein SAV_4034 [Streptomyces avermitilis MA-4680]
    MIKVTAGTDAPERCSQAFTVAAVAVASGVEVSLWLTGESAWFALPGRAAEFELPHAAPLPDLIDSVLAGGQLTLCTQCAA
    RRDITEKDVLDGVRIAGAQVFVQEAMADGTQALVY

    >gi|29830580|ref|NP_825214.1| thiosulfate sulfurtransferase [Streptomyces avermitilis MA-4680]
    MSRSDVLVDADWVQDHLDDPSVAIVEVDEDTSAYEKNHIRNAIRIDWTKDLQDPVRRDFIDQEGFEKLLSEKGIANDTLV
    VLYGGNNNWFASYAYWYFKLYGHENVKLLDGGRKKWELDSRDLVAEVPTRATTDYKAKAQNTAIRAFRDDVVAAIGSQNL
    VDVRSPDEFSGKLLAPAHLPQEQSQRPGHIPSARNIPWSKNANDDGTFKSDDELKELYVEEQVDLAKDTIAY
    CRIGERSA
    LTWFVLHELLGVENVKNYDGSWTEYGSLVGVPIELGANK

    >gi|29830848|ref|NP_825482.1| thioredoxin reductase (NADPH) [Streptomyces avermitilis MA-4680]
    MSDVRNVIIIGSGPAGYTAALYTARASLKPLVFEGAVTAGGALMNTTEVENFPGFQDGIMGPELMDNMRAQAERFGAELV
    PDDVVAVDLTGEIKTVTDTAGTVHQAKAVIVTTGSQHRKLALPNEDALSGRGVSW
    CATCDGFFFKGQDIAVIGGGDTAME
    EATFLSRFAKSVTIVHRRDTLRASKAMQERAFADPKIKFVWDSEVAEIKGDPKLAGLSLRNLKTGEISELPVTGLFIAIG
    HDPRTELFKGQLDLDEEGYLKVDAPSTRTNLSGVFGAGDVVDHTYRQAITAAGTGCSAALDAERFLSALAAAEDAAEPEK
    TTV

    >gi|29830849|ref|NP_825483.1| thioredoxin [Streptomyces avermitilis MA-4680]
    MAGTLKNVTDDSFEQDVLKSDKPVLVDFWAAWCGPCRQIAPSLEAIASEYGDKIEIVKLNIDENPGTAAKYGVMSIPTLN
    VYQGGEVAKTIVGAKPKAAIVRDLEDFIAE

    >gi|29830891|ref|NP_825525.1| hypothetical protein SAV_4348 [Streptomyces avermitilis MA-4680]
    MPTVGVADLADGDFLLDVREDDEWEAGHAEGALHIPISDFVARYGELTEAAPQDGRVHVICRSGGRSAQVTMYLAQQGID
    AVNVDGGMQVWAAAGRPVVDDKGQPGFVL

    >gi|29830929|ref|NP_825563.1| hypothetical protein SAV_4386 [Streptomyces avermitilis MA-4680]
    MNDSAPRRVRVRAPELIGKGGWLNTGDKQYTLADLRGRIVVLDFWTFCCINCLHVLDELRELEEKHRDTVVIIGVHSPKF
    VHEAEHQAVVDAVERYGVEHPVLDDPELATWKQYAVRAWPTLVVIDPEGYVVAQHAGEGHAHAIAALVAELEAEHEAKGT
    LRRGDGPYVAPEPEPTVLRFPGKALLLPSGNFLVSDTTRHQLVELAADGESVVRRIGSGIRGFADGPADAASFSEPQGMT
    LLDEDVVVVADTVNHALRRLDLATGEVTTLAGTGRQWWQGSPASGPAREVDLSSPWDVAVFGGRVWIAMAGGAPAVDVRP
    GGGDGRGRGGHDERGAGRRTG

    >gi|29831280|ref|NP_825914.1| redoxin [Streptomyces avermitilis MA-4680]
    MADMSPIFRRKAAQSAPQDRLVTLIRKPGCHLCDDAQQVIEKVCGDLGVPWEQKDITQDAELHREYWEQIPVVLVDGAQH
    TFWRVNEERLRKALTQGLPGRS

    >gi|29831341|ref|NP_825975.1| hypothetical protein SAV_4798 [Streptomyces avermitilis MA-4680]
    MSAACRVHQRLNRTNRTRSRAALLSAGAAVAALVLSACSSGGTHGGGGDTNFVAGKDGISTVAKGSRVDAPDLSGKTVDG
    KQLDVADYKGKVVVLNVWGSW
    CPPCRAEAPNFVKVAKDTAAQGVQFVGLNTRDPGTAPAKAFEKEQGITYPSLYDPTGKL
    MLRFKKGTLNPQTIPSTLVIDRDGKIAARTLQALTEEKLREMLDPILAEK

    >gi|29831634|ref|NP_826268.1| organic hydroperoxide resistance protein [Streptomyces avermitilis MA-4680]
    MDALYTAVATATHGREGRAISSDGKLDVQLAPPAELGGNGQGTNPEQLFAGGYAACFASALGLVGRQAKVDVSDAAVTAE
    VGIGKQGEGFGLKVTLRIELPDSVDEATGRKLVETAHQV
    CPYSNATRGNIEVELVVE

    >gi|29831719|ref|NP_826353.1| bacterioferritin comigratory protein [Streptomyces avermitilis MA-4680]
    MSERLQPGDTAPAFTLPDADGNEVSLADHKGRKVIVYFYPAALTPGCTKQACDFTDNLELLAGAGYDVIGVSPDKPEKLA
    KFREQENLKVTLVGDPDKQVLEAYGAFGEKKLYGKTVVGVIRSTVVVDEEGKVERALYNVKATGHVAKIIKDLGI

    >gi|29831874|ref|NP_826508.1| cation-transporting P-type ATPase [Streptomyces avermitilis MA-4680]
    MSSTTAEAPIGPASQVELTIGGMTCASCAARVEKKLNRMDGVTATVNFATEKARVSYPAEVEVADLIATVVKTGYTATEP
    PPPRPEAPEEPQPSRASEEDPELTSLRGRLTVSVLLALPVVLLSMIPALQFDNWQWLSLTLAAPVVVWGALPFHQAAFTN
    ARHGAATMDTLVSVGTLAAFGWSVWALFWGHAGMPGMRHGFDFTVSRGNGASTIYLEVAAGVVAFILLGRYLEARSKRRA
    GAALHALMELGAKDVAVVRNGREVRVPVTRLTVGDRFVVRPGEKIATDGTVVEGDSAVDASMLTGESVPVDVTVGDTVTG
    ATVNAGGRLVVEATRVGADTQLARMAQLVEAAQNGKAEVQRLADRISGVFVPVVLLIALGTFGVWLAVTDDTVAAFTAAV
    AVLIIACPCALGLATPTALMVGTGRGAQLGILIKGPEVLESTRRVDTVVLDKTGTVTTGRMTLQEVYVAEGAAEKEVLRL
    AGALEHASEHPIARAITAGAQERAGALPAPERFENVPGLGVRGRVEGHEVLVGRLPEVALPEGLARAKATAEAEGRTAVV
    VSRDGVALGVLTVADAIKETSAEAVRELRALGLTPVLLTGDNRAVAESVARAVGIDEVIAEVLPQDKVAVVERLRGQGRT
    VAMVGDGVNDAAALATADLGLAMGTGTDAAIEASDLTLVRGDLRVAADAIRLSRRTLSTIKGNLVWAFGYNVAALPLAAA
    GLLNPMIAGAAMAFSSVFVVTNSLRLRTFS

    >gi|29831875|ref|NP_826509.1| copper chaperone [Streptomyces avermitilis MA-4680]
    MTAETETPGSTTTVYQVSGMSCGHCEGSVSSEIAEIAGVSSVKAVASTGEVTVVSAAPLDDEAVRAAVDEAGFELAGRA

    >gi|29831955|ref|NP_826589.1| hypothetical protein SAV_5412 [Streptomyces avermitilis MA-4680]
    MSEKTPVDFWFDPLCPWAWMTSRWVLEVEKVRDIEVRWHLMSLAVLNEPKLDELPEEYRELLETKAWGPVRVVIAAQQEH
    GAKVLGDLYTALGTRFHNQGEGPTKEAVAAALDEVGLPASLLDHWDSTPYEAELRASHKEGIEKVGQDVGTPVIAVPGAD
    GEQIAFFGPVVTPAPKGEEAAKLWDGTLLVASVPGFYEIKRSRSQGPDFSNL

    >gi|29832345|ref|NP_826979.1| thiol-specific antioxidant protein [Streptomyces avermitilis MA-4680]
    MAIQVGDKAPDFELKDNHGATVRLSDFRGEKNVVLLFYPFAFTGVCTGELCALRDELPKFVNDDVQLLAVSNDSIHTLRV
    FAEQEGLEYPLLSDFWPHGNTSRAYGVFDEDKGCAVRGTFIIDKEGVVRWTVVNGLPDARDLNEYVKALDTL

    >gi|29832542|ref|NP_827176.1| arsenate reductase [Streptomyces avermitilis MA-4680]
    MEIWINPACSKCRSALSLLDAEDAEYTVRRYLEDVPSEDEIRGVLQRLGLEPWDITRTEEAVAKELGVKEWARDAGSRDQ
    WVRALAEHPKLIQRPIITADDGTALVARTEEAVRDALSR

    >gi|57833863|ref|NP_827200.2| dihydrolipoamide dehydrogenase [Streptomyces avermitilis MA-4680]
    MANDASTVFDLVILGGGSGGYAAALRGAQLGLDVALIEKDKVGGTCLHRGCIPTKALLHAGEIADQARESEQFGVKATFE
    GIDVPAVHKYKDGVISGLYKGLQGLIASRKVTYIEGEGRLSSPTSVDVNGQRVQGRHVLLATGSVPKSLPGLAIDGNRII
    SSDHALVLDRVPESAIVLGGGVIGVEFASAWKSFGADVTVIEGLKHLVPVEDENSSKLLERAFRKRGIKFNLGTFFSKAE
    YTQNGVKVTLADGKEFEAEVLLVAVGRGPVSQGLGYEEQGVAMDRGYVLVDEYMRTNVPTISAVGDLVPTLQLAHVGFAE
    GILVAERLAGLKTVPIDYDGVPRVTYCHPEVASVGITEAKAKEIYGADKVVALKYNLAGNGKSKILNTAGEIKLVQVKDG
    AVVGVHMVGDRMGEQVGEAQLIYNWEALPAEVAQLIHAHPTQNEAMGEAHLALAGKPLHSHD

    >gi|29832584|ref|NP_827218.1| hypothetical protein SAV_6042 [Streptomyces avermitilis MA-4680]
    MSVSDETTTVSDGIILSDAAAAKVKALLDQEGREDLALRVAVQPGGCSGLRYQLFFDERSLDGDVVKDFDGVKVVTDRMS
    APYLGGASIDFVDTIEKQGFTIDNPNATGSCACGDSFS

    >gi|29832799|ref|NP_827433.1| hypothetical protein SAV_6257 [Streptomyces avermitilis MA-4680]
    MVMTTNTTHTTHTTNTTDTVDTTGSRLNFAKAAPKVFRALIGFDAAAREGIDPALVELIQIRASHLNHCAYCLHMHTNDA
    RKAGESEDRLHMVAVWREARHFFTPKEQAALALTEAVTLVADAGVPADVYAEAAAHFPEEELAHVLALILTINTWNRVAL
    STGKVAGTDER

    >gi|29832812|ref|NP_827446.1| methylated-DNA--protein-cysteine S-methyltransferase [Streptomyces avermitilis MA-4680]
    MKSVERSEQQVVWAVVGTDIGPLLLAATGDGLVNVVFHATDAVRDKALERLASRLGSEPVEDPGSPFLAEAIRQVTAYFA
    GERRDFELPLDWSLISGFNRQVLRELASGVPYGAVVGYGDLARRVGQPGAAQAVGMAMGSNPLPVVVP
    CHRVVESDGGIG
    GFGGGLEAKRKLLALEGVLPEPLF

    >gi|29832935|ref|NP_827569.1| protein dithiol-disulfide isomerase [Streptomyces avermitilis MA-4680]
    MRVEIWSDIACPWCYVGKARFEKALEAFPHRDDVEVVHRSFELDPNRAKGDIQPVLTMLTKKYGMSEAQAQAGEDNLGAQ
    AAAEGLDYRTRDRDHGNTFDMHRLLHFAKEQGRQDELIGLLYRANFAEERSVFDDDERLVELAVAAGLDAEAARTVLADP
    AAYADEVRADEREAAELGASGVPFFVLDRAYGVSGAQPAEVFAQALKQAWGDRPPLTLIQDSGDAQACGPDGCAVPQG

    >gi|29833600|ref|NP_828234.1| hypothetical protein SAV_7058 [Streptomyces avermitilis MA-4680]
    MNHSFRTGITGRRFSAMRVPYGRSRRTHRNGGAGREGTTMTTTTTPTTTTPTSPPTVKAPTVKAPTAKTATAKTADNPVL
    RVAPASPAAAAAYFGASLAFHADVSDVATALAAGGDPGFVVLDSRSTASWDQGHVPGAVHLPTALIPEQAEQLLDRSVPV
    VTY
    CWGPGCNGATRAALALAELGFQVKEMLGGFEYWVREGFEYETWEGRDHRVADPLTAPVDADDCGC

    >gi|29833679|ref|NP_828313.1| reductase [Streptomyces avermitilis MA-4680]
    MEVVTMTERYEVVVVGGGAAGLSAALVLGRARRHTLVVDAGEPRNAPAAHLQGFLTRDGMPPAEFLAEGRREIGRYGVEL
    VQGRVVDVVRGGVGAFEVTLAGGRTVHARRLVLATGLVDELPPVPGVAERFGRDVLH
    CPYCHGWEVRDEAFGVLASTPMS
    VHQALMVSQWSKDVTLFLHTVGEDELTHDDRRRLAAAGVTLVSGEVAGLEVDEDRLTGVRLADGTTRDRSVLFVAPRAVP
    RTDLFDRLGAELRETPFGTYPVVDETGLTTVPGVWAAGNAIGFAEQLVNAASGGYRAGAVINGDLLFADLDAAAGPAASG
    EAENAAERV

    >gi|29833784|ref|NP_828418.1| thioredoxin [Streptomyces avermitilis MA-4680]
    MGGMSTMQATTVSCPNCGRTNRVPVAAEGRPKCGHCKQPLPWMVDASDDDFTEVAERADVPVVVDLWATWCGPCRMVSPA
    LEKVATDLAGRIKLVKVDIDKNPRLSRRFEVQAVPTLLVLDQGETVARQAGAAPAPVLRQWVEQSITAREG

    >gi|29833889|ref|NP_828523.1| thioredoxin [Streptomyces avermitilis MA-4680]
    MSSTVELTKENFDQTVTDNEFVLIDFWASWCGPCRQFAPVYEKAAEANPDLVFAKVDTEAQPELAAAFDIQSIPTLMIVR
    DQVAVFAQPGALPEAALEDVIGQARKLDMDEVRKAVAAQQAQAQAQQGE

    >gi|29833890|ref|NP_828524.1| oxidoreductase [Streptomyces avermitilis MA-4680]
    MTETESIAYDVVVLGAGPVGENVADRTRAAGLSTAVVESELVGGECSYWACMPSKALLRPVIARADARRVPGVSHLAQGH
    LDTAAVLAHRDYEVSHWKDDGQVGWLDGIGADLYRGHGRLSGPREVTVTGPDGDRRVLTARHAVAVCTGSRALLPDLPGL
    DQVEPWTSREATSAQAAPGRLIVVGGGVVAVEMATAWRALGSEVTVLVRGKGLLPRMEPFAGELVAEALKEAGADVRTGT
    SVSAVTREGPTVVVLTDTGDRIEADEILFATGRAPRTDDLGLDTVGLEPGSWLSVDDSLRVTGSDWLYAVGDVNHRALLT
    HQGKYQARIAGAAIAARASGVPLLESDPWGAHAATADHAAVPQVVFTDPEAAAVGLSLAEAERAGHHVRAVDVEFSSVAG
    AGLYADGYRGRARMVVDVNRETLLGVTFVGPGVGELIHSATIAVAGEVPIGRLWHAVPSYPTISEVWLRLLEAYRDA

    >gi|29834005|ref|NP_828639.1| glutathione S-transferase [Streptomyces avermitilis MA-4680]
    MSEGNGNSAYGRKAFKRSRSHFTDRITADGRDGRPVEAGRYRLIASRACPWASRALVSRRLLGLEDALSLGVVDPVQDDR
    SWRFTLDPDGRDPVLGIRYLSEAYDARQPEYPGGVSVPAIVDVPSGKLVTNDYQQLTLDLATEWKALHRQGAPDLYPAGL
    RDEIDEVMADIYEDVNNGVYRAGFATGQKEYEAACAGVFHRLELLGQRLADRRHLVGDSITEADIRLFTTLVRFDAVYHG
    HFKCNRWKLTEHPVLWAYARDLYQTPGFGDTVDFDHIKRHYYQVHTGINPTGIVPLGPDLAGWLTPHHRERLGGRPFGDG
    TPPGPVREDEEIPAQGRP