Streptococcus pyogenes MGAS10750 uid58575

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|94993503|ref|YP_601601.1| Thioredoxin [Streptococcus pyogenes MGAS10750]
    MIRPTSYEPLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAELTDMTFVCVNRDQFIEVAQKWNIFGIPSFVVIEKG
    QEVGRLVNKMRKTKTEIMHFLAAYQ

    >gi|94993732|ref|YP_601830.1| Arsenate reductase family protein [Streptococcus pyogenes MGAS10750]
    MITIYQYPKCSTCQRAMAELKQLVSDFEAIDIKANPPKAQDLKHWMETSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDK
    AAELLATDGMLIKRPILIKDGKVLQVGYRKPYQELDLG

    >gi|94993918|ref|YP_602016.1| Glutathione peroxidase [Streptococcus pyogenes MGAS10750]
    MIPLTKLSITPRRCHMPNLYDFTVKAQNGNDLSLAAYKEKVVLIVNTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCN
    QFLNQAPGDAEEINHFCSLTYHTTFPRFVKIKVNGKDADPLFAWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKT
    DPKLIEEDLKALLG

    >gi|94994111|ref|YP_602209.1| glutathione reductase [Streptococcus pyogenes MGAS10750]
    MVIPYDYIVIGGGSAGIASANRAAMHGAKVLLAEGKEIGGTCVNLGCVPKKVMWYGAQVADILGTYAKDYGFDFKDKAFD
    FKQLKANRQAYIDRIHASYERGFEQNGVDRIYDYAVFKDAHTVEIAGQLYTAPHILIATGGHPVFPDIEGAQYGISSDGF
    FALDEVPKRTAVVGAGYIAVELAGVLHALGSKTDLFIRHDRPLRSFDKAIVDVLVEEMAVGGPCLHPHSEVAKVVKNTDE
    SLTLYLKDGQEVEVDQLIWAIGRKPNLEGFGLDKTGVTLNDKGYIETDAYENTSVKGIYAVGDVNGKLALTPVAVAAGRR
    LSERLFNGKTDEKLDYQNVATVIFSHPVIGSVGLSEEAAVKQYGQEAVKTYQSRFTSMFTAITNHRQPCLMKLVTVGDTE
    KIVGLHGIGYGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|94994185|ref|YP_602283.1| Arsenate reductase [Streptococcus pyogenes MGAS10750]
    MIMEEITIYHNPNCGTSRNVLAMIRHAGIEPTIIEYLQTPPNRETLIELLQSMGISARELLRTNVPEFEAHGLANQAVAE
    KDVINAMLTDPILINRPIVVTRKGVKLCRPSETLLDILPVPLPSPYIKEDGEIVNPIEVKGEKDVIDD

    >gi|94994207|ref|YP_602305.1| hypothetical protein MGAS10750_Spy0811 [Streptococcus pyogenes MGAS10750]
    MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERFADLWFKIDEE
    NQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRN
    FRELPQWVRDNKDKFMEKRVVVY
    CTGGVRCEKFSGWMVREGFKDVGQLHGGIATYGKDPEVQGELWDGAMYVFDDRISVP
    INHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEENETKYVRGCSPECRAHERNRYVQENGLSRQEWAERLEAIGE
    SLPEFVGA

    >gi|94994303|ref|YP_602401.1| Dihydrolipoamide dehydrogenase [Streptococcus pyogenes MGAS10750]
    MAVEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDKTNMELEAEDSGVLLKITRQAGETVPVTEVIGYIGAEG
    ESVEVSSPAASDVNVARTTEDLEAAGLEVPKAPAQAASAAPKAALADDEYDIIVVGGGPAGYYAAIRGAQLGGKIAIVEK
    SEFGGT
    CLNVGCIPTKTYLKNAEILDGIKIAAGRGINLASTNYTIDMDKTVDFKNTVVKTLTGGVQGLLKANKVTIFNGL
    GQVNPDKTVTIGSQTIKGRNVILATGSKVSRINIPGIDSKLVLTSDDILDLREMPKSLAVMGGGVVGIELGLVWASYGVD
    VTVIEMADRIIPAMDKEVSLELQKILSKKGMKIKTSVGVSEIVEANNQLTLKLNNGEEVVAEKALLSIGRVPQMNGLENL
    NLEMDRNRIKVNDYQETSIPGIYAPGDVNGTKMLAHAAYRMGEVAAENAIHGNTTRKANLKYTPAAVYTHPEVAMVGLTE
    EQAREQYGDVLIGKNSFTGNGRAIASNEAHGFVKVIADAKYHEILGVHIIGPAAAEMINEAATIMESELTVDELLLSIHG
    HPTFSEVMYEAFADVLGEAIHNPPKRK

    >gi|94994325|ref|YP_602423.1| methionine sulfoxide reductase B [Streptococcus pyogenes MGAS10750]
    METSDELKQRIGDLSYEVTQHAATESPFTGKYDDFFEKGIYVDIVSGEVLFSSLDKFNSGCGWPAFSKPIENRMVTNHDD
    SSYGMRRVEVKSREAGSHLGHVFSDGPKEAGGLRY
    CINSAALKFIPYDQMEKGGYAQWLTLFDET

    >gi|94994417|ref|YP_602515.1| NADH oxidase H2O-forming [Streptococcus pyogenes MGAS10750]
    MSKIVVVGANHAGTACIKTMLTNYGDANEIVVFDQNSNISFLGCGMALWIGEQIAGPEGLFYSDKEELESLGAKVYMESP
    VQSIDYDAKTVTALVDGKNHVETYDKLIFATGSQPILPPIKGAEIKEGSLEFEATLENLQFVKLYQNSADVIAKLENKDI
    KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAGYYDRDLTDLMAKNMEEHGIQLAFGETVKEVAGNGKVEKIITD
    KNEYDVDMVILAVGFRPNTTLGNGKIELFRNGAFLVNKRQETSIPGVYAIGDCATIYDNATRDTNYIALASNAVRTGIVA
    AHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILG
    AQMAAREDVSMGIHMFSLAIQEGVTIEKLALTDIFFLPHFNKPYNYITMAALGAKD

    >gi|94994506|ref|YP_602604.1| transcriptional regulator Spx [Streptococcus pyogenes MGAS10750]
    MVTLFLSPSCTSCRKARAWLVKHEVDFQEHNIITSPLSRDELMSILSFTENGTEDIISTRSKVFQKLDIDVEELSISDLI
    DLIAKNPSLLRRPIIMDQKRMQIGFNEDEIRAFLSRDYRKQELRQATIKAEIEG

    >gi|94994620|ref|YP_602718.1| Glutaredoxin [Streptococcus pyogenes MGAS10750]
    MEPLLILEGQDMITVYSKNNCMQCKMTKKFLEQHGANFQGN

    >gi|94994785|ref|YP_602883.1| Peptide methionine sulfoxide reductase msrA/msrB [Streptococcus pyogenes MGAS10750]
    MEHKWKLWLFIVGVVLLIGGASVLIQKGQAKAFSQGKPQLPAKKVKSTKVDPNAPVDQKMIYLAGGCFWGVEEYFSQVDG
    VLDAVSGYANGRGDTTNYQLIHQTGHAETVEVAYDANRISLKELLLHFFRIIDPTSLNKQGNDRGSQYRTGIYYTDKADL
    AIIDEVFKEKAKDYKKKIVVEKAPLKHFIKAEEYHQDYLKKNPNGYCHIDINQATYPVIDESKYPKPSATEIKAKLSADE
    YRVTQKNETEKAFSNRYWDSFDAGIYVDVVTGEPLFSSKDKFESGCGWPSFSRPLSPDVVRYKEDKSFNMTRTEVRSRSG
    NSHLGHAFTDGPKDQGGLRY
    CINSLSITFIPKADMEAKGYGYLLSSVE

    >gi|94994786|ref|YP_602884.1| Thiol:disulfide interchange protein tlpA [Streptococcus pyogenes MGAS10750]
    MKKGLLVTTGLACLGLLTACSTQDNMAKKEITQDKMSMAAKKKDEMSTSKDKSMMADKTSDKKMTNDGPMAPDFELKGID
    GKTYRLSEFKGKKVYLKFWASW
    CSICLSTLADTEDLAKMSDKDYVVLTVVSPGHQGEKSEADFTKWFQGTDYKDLPVLLD
    PDGKLLEAYGVRSYPTEVFIGSDGVLAKKHIGYAKKSDIKKTLKGIH

    >gi|94994865|ref|YP_602963.1| Thioredoxin reductase [Streptococcus pyogenes MGAS10750]
    MYDTLIIGSGPAGMTAALYAARSNLSVAIIEQGAPGGQMNNTFDIENYPGYDHISGPELAMKMYEPLEKFNVENIYGIVQ
    KIENFGDYKCVLTEDASYEAKTVIIATGAKYRVLGVPGEEYYTSRGVSY
    CAVCDGAFFRDQDLLVVGGGDSAVEEAIYLT
    QFAKKVTVVHRRDQLRAQKILQDRAFANDKVDFIWDSVVKEIQGNDIKVSNVLIENVKTGQVTDHAFGGVFIYVGMNPVT
    GMVKDLEITDSEGWIITDDHMRTSIPGIFAIGDVRQKDLRQITTAVGDGAIAGQGVYHYLESFPS

    >gi|94994914|ref|YP_603012.1| Copper-exporting ATPase [Streptococcus pyogenes MGAS10750]
    MAKEIFLVEGMSCASCALTIEKTVNQLPEVEQAVVNLATEKLTVTYQDDDLETAKVIQAVKAAGYGAQVFDEHAKHMQTG
    RRDEDLKVIWSQVLWSALFTIPILYLAMGHMVGLWLPSFLQPDRYPFVYSFSQLLLTIPVLVLNRHYYHNGFKALFKGYP
    NMDSLVALATSFAFAYSLYGVVEISMGQAHFVHSLYFESVVVILTLIGLGKYFESRSKGRTSQAIQKLLSLKATVVRVWR
    NSQWQLLPLEEVSYDDLVLVQPGEKVSIDGIIVEGHSSLDESFLTGESFPVEKGEKDNVFAGSLNGKGALTIKPDKLGND
    TLLAQIIQLVENAQENKAPIAAIADRVSGVFVPVVLVLTLLTGVFWLVFMQESLRFSLTTAIAVLVIACPCALGLATPTA
    IMVGTGRAAENGILFKGGDILEQAHQVDTVVFDKTGTITEGKPSLQKLLTFSGDEHLILQEAASLEAYSQHPLGEAIVRA
    AQEAGYDSLPVEEFESLTGLGVTGQLEGRRLAIGNATLMATLGIDLASVQSVCAKASGKGQTIVYYAKEGQLRALFSIAD
    AVKEDSQATVEALHQLGIHTIMLTGDHDATAKAIASQVGITDVISQVLPDQKAGVITHLQSQGRKVAMVGDGINDAPALA
    VADIGIAMGSGTDIAIESADVILMKPDMLDLVKALSLSRATMRIVKENLFWAFIYNVLMIPVAMGLLHLFGGPLLNPMLA
    GFAMSFSSVSVVLNALRLKGKTI

    >gi|94995014|ref|YP_603112.1| Thioredoxin [Streptococcus pyogenes MGAS10750]
    MYNRLIIKMKWRKKMALEVTDATFVEETKEGLVLIDFWATWCGPCRMQAPILEQLSQEIDEDELKILKMDVDENPETARQ
    FGIMSIPTLMLKKDGEVVKQVAGVHTKDQLKAIIAELS

    >gi|94995256|ref|YP_603354.1| Peroxiredoxin [Streptococcus pyogenes MGAS10750]
    MSLIGKEIAEFSAQAYHDGKFITVTNEDVKGKWAVFCFYPADFSFVCPTELGDLQKQYETLKSLGVEVYSVSTDTHFVHK
    AWHDDSDVVGTITYPMIGDPSHLISQAFEVLGEDGLAQRGTFIVDPDGIIQMMEINADGIGRDASTLIDKIHAAQYVRKH
    PGEVCPAKWKEGAETLTPSLDLVGKI

    >gi|94995257|ref|YP_603355.1| Peroxiredoxin reductase (NAD(P)H) / NADH oxidase H2O2-forming [Streptococcus pyogenes MGAS10750]
    MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDRQPSFKVAKKGHGSGVVFAGL
    PLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHFETYVSLT
    CHNCPDVVQALNIMSVLNDKISHTMVEGGMFQD
    EVKAKGIMSVPTVFLDGEEFTSGRATIEQLLEQIAGPLSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
    FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLANGAVLQAKTAILALGAKWRN
    INVPGEDEFRNKGVTY
    CPHCDGPLFEGKDVAVIGGGNSGLEAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTNNMTI
    IKNVSTKDIVGEDHVTGLNYTERDSGEDKHLDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
    CTDSAYKQIIISMGSGATAAIGAFDYLIRQ

    >gi|94995286|ref|YP_603384.1| transcriptional regulator Spx [Streptococcus pyogenes MGAS10750]
    MIKIYTISSCTSCKKAKTWLNAHKLAYKEQNLGKEPLTKEEILAILSKTENGVESIVSSKNRYAKALDCDIEELSVSEVI
    DLIQDNPRILKSPILIDDKRLQVGYKEDDIRAFLPRSIRNIENTEARLRAAL