Streptococcus pyogenes MGAS10394 uid58105

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|50913495|ref|YP_059467.1| thioredoxin [Streptococcus pyogenes MGAS10394]
    MIRPTSYESLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAELTDMTFVCVNRDQFIEVAQKWDIFGIPSFVVIEKG
    QEVGRLVNKMRKTKTEIMHFLAAYQ

    >gi|50913710|ref|YP_059682.1| arsenate reductase family protein [Streptococcus pyogenes MGAS10394]
    MITIYQYPKCSTCQRAMAELKQLVSDFEVIDIKANPPKAQDLKHWMETSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDK
    AAELLATDGMLIKRPILIKDGKVLQVGYRKPYQELDLG

    >gi|50913753|ref|YP_059725.1| methionine sulfoxide reductase A [Streptococcus pyogenes MGAS10394]
    MERAIFAGGCFWCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPEEISYKELVELYWAQTDPT
    DAFGQFEDRGDNYRPVIYYTTERQKEIAEQSKANLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIR
    HQFLEENWS

    >gi|50913870|ref|YP_059842.1| glutathione peroxidase [Streptococcus pyogenes MGAS10394]
    MIPLTKLLITPRRCHMPNLYDFTVKAQNGNDLSLAAYKEKVVLIVNTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCN
    QFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADPLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKT
    DPKLIEEDLKALLG

    >gi|50913990|ref|YP_059962.1| glutathione reductase [Streptococcus pyogenes MGAS10394]
    MIKMVIPYDYIVIGGGSAGIASANRAAMHGAKVLLAEGKEIGGTCVNLGCVPKKVMWYGAQVADILGTYAKDYGFDFKEK
    AFDFKQLKANRQAYIDRIHASYERGFEQNGVDRIYDYAVFKDAHTVEIAGQLYTAPHILIATGGHPVFPDIEGAQYGISS
    DGFFALDEVPKRTAVVGAGYIAVELAGVLHALGSKTDLFIRHDRPLRSFDKTIVDVLVDEMAVNGPRLHTHAEVAKVVKN
    TDESLTLYLKDGQEVEVDQLIWAIGRKPNLEVFSLDKTGVTLNDKGYIETDAYENTSVKGIYAVGDVNGKLALTPVAVAA
    GRRLSERLFNSKTDEKLDYQNVATVIFSHPVIGSVGLSEEAAVKQYGQEAVKTYQSRFTSMFTAITNHRQPCLMKLVTVG
    DTEKIVGLHGIGYGVDEMIQGFVVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|50914060|ref|YP_060032.1| arsenate reductase family protein [Streptococcus pyogenes MGAS10394]
    MIMEEITIYHNPNCGTSRNVLAMIRHAGIEPTIIEYLQTPPNRETLIELLQSMGISARELLRTNVPEFEAHGLANQAVAE
    KDVINAMLTDLILINRPIVVTRKGVKLCRPSETLLDILPVPLPSPYIKEDGEIVNPIEVKGEKDVIDD

    >gi|50914089|ref|YP_060061.1| hypothetical protein M6_Spy0743 [Streptococcus pyogenes MGAS10394]
    MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERFADLWFKIDEE
    NQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGKYLNPKQFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRN
    FRELPQWVRDNKDKFMEKRVVVY
    CTGGVRCEKFSGWMVREGFKDVGQLHGGIATYGKDPEVQGELWDGAMYVFDDRISVP
    INHVNPTVISKDYFDGTPCERYVNCANPFCNKQIFASEENETKYVRGCSPECRAHERNRYVQENGLSRQEWAERLEAIGE
    SLPEFVGA

    >gi|50914126|ref|YP_060098.1| dihydrolipoamide dehydrogenase [Streptococcus pyogenes MGAS10394]
    MFRKVLVVLTWVRQRNQRFLTYRKNSIAFSLLLVSYIMAVEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDK
    TNMELEAEDSGVLLKITRQAGETVPVTEVIGYIGAEGESVEVSSPAASDVNVARTTEDLEAAGLEVPKAPAQAASAAPKA
    ALADDEYDIIVVGGGPAGYYAAIRGAQLGGKIAIVEKSEFGGT
    CLNVGCIPTKTYLKNAEILDGIKIAAGRGINLASTNY
    TIDMDKTVDFKNTVVKTLTGGVQGLLKANKVTIFNGLGQVNPDKTVNIGSQTIKGRNVILATGSKVSRINIPGIDSKLVL
    TSDDILDLREMPKSLAVMGGGVVGIELGLVWASYGVDVTVIEMADRIIPAMDKEVSLELQKILSKKGMKIKTSVGVSEIV
    EANNQLTLKLNNGEEVVAEKALLSIGRVPQMNGLENLNLEMDRNRIKVNDYQETSIPGIYAPGDVNGTKMLAHAAYRMGE
    VAAENAIHGNTTRKANLKYTPAAVYTHPEVAMVGLTEEQAREQYGDVLIGKNSFTGNGRAIASNEAHGFVKVIADAKYHE
    ILGVHIIGPAAAEMINEAATIMESELTVDELLLSIHGHPTFSEVMYEAFADVLGEAIHNPPKRK

    >gi|50914144|ref|YP_060116.1| methionine sulfoxide reductase B [Streptococcus pyogenes MGAS10394]
    METSEELKQRIGDLSYEVTQHAATESPFTGEYDDFFEKGIYVDIVSGEVLFSSLDKFNSGCGWPAFSKPIENRMVINHDD
    SSYGMRRVEVKSREAGSHLGHVFSDGPKEAGGLRY
    CINSAALKFIPYEQMEKEGYAQWLTLFDET

    >gi|50914214|ref|YP_060186.1| NADH oxidase H2O-forming [Streptococcus pyogenes MGAS10394]
    MSKIVVVGANHAGTACIKTMLTNYGDANEIVVFDQNSNISFLGCGMALWIGEQIAGPEGLFYSDKEELESLGAKVYMESP
    VQSIDYDAKTVTALVDGKNHVETYDKLIFATGSQPILPPIKGAEIKEGSLEFEATLENLQFVKLYQNSADVIAKLENKDI
    KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAGYYDRDLTDLMAKNMEEHGIQLAFGETVKEVAGNGKVEKIITD
    KNEYDVDMVILAVGFRPNTTLGNGKIDLFRNGAFLVNKRQETSIPGVYAIGDCATIYDNATRDTNYIALASNAVRTGIVA
    AHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFPVTIKIVYDKDSRRILG
    AQMAAREDMSMGIHMFSLAIQEGVTIEKLALTDIFFLPHFNKPYNYITMAALGAKD

    >gi|50914295|ref|YP_060267.1| transcriptional regulator Spx [Streptococcus pyogenes MGAS10394]
    MVTLFLSPSCTSCRKARAWLVKHEVDFQEHNIITSPLSRDELMSILSFTENGTEDIISTRSKVFQKLDIDVEELSISGLI
    DLIAKNPSLLRRPIIMDQKRMQIGFNEDEIRAFLSRDYRKQELRQATIKAEIEG

    >gi|50914442|ref|YP_060414.1| glutaredoxin [Streptococcus pyogenes MGAS10394]
    MEPLLILEGQDMITVYSKNNCMQCKMTKKFLEQHGANFQEINIDEHPEKVDYVKSLGFTSAPVIEADNLVFSGFQPAKLK
    ELI

    >gi|50914649|ref|YP_060621.1| bifunctional methionine sulfoxide reductase A/B protein [Streptococcus pyogenes MGAS10394]
    MEHKWKLWLFIVGVVLLIGGASVLIQKGQAKAFSQGKPQIPAKKVKSTKVDPNAPVDQKVIYLAGGCFWGVEEYFSQVDG
    VLDAVSGYANGRGDTTNYQLIHQTGHAETVEVAYDANRISLKELLLHFFRIIDPTSLNKQGNDRGSQYRTGIYYTDKADL
    AIIDEVFKEKAKDYKKKIVVEKAPLKHFIKAEDYHQDYLKKNPNGYCHIDINQATYPVIDESKYPKPSATEIKEKLSADE
    YRVTQKNETEKAFSNRYWDSFDAGIYVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSG
    NSHLGHVFTDGPKDQGGLRY
    CINSLSITFIPKADMEAKGYGYLLSSVE

    >gi|50914650|ref|YP_060622.1| Thiol:disulfide interchange protein [Streptococcus pyogenes MGAS10394]
    MKKGLLVTTGLACLGLLTACSTQDNMAKKEITQDKMSMAAKKKDKMSTSKDKSMMADKSSDKKMTNDGPMAPDFELKGID
    GKTYRLSEFKGKKVYLKFWASW
    CSICLSTLADTEDLAKMSDKDYVVLTVVSPGHQGEKSEADFTKWFQGTDYKDLPVLLD
    PDGKLLEAYGVRSYPTEVFIGSDGVLAKKHIGYAKKSDIKKTLKGIH

    >gi|50914752|ref|YP_060724.1| thioredoxin reductase [Streptococcus pyogenes MGAS10394]
    MYDTLIIGSGPAGMTAALYAARSNLSVAIIEQGAPGGQMNNTFDIENYPGYDHISGPELAMKMYEPLEKFNVENIYGIVQ
    KIENFGDYKCVLTEDASYEAKTVIIATGAKYRVLGVPGEEYYTSRGVSY
    CAVCDGAFFRDQDLLVVGGGDSAVEEAIYLT
    QFAKKVTVVHRRDQLRAQKILQDRAFANDKVDFIWDSVVKEIKGNDIKVSNVLIENVKTGQVTDHAFGGVFIYVGMIPVT
    GMVKDLKITDSEGWIITDDHMRTSIPGIFAIGDVRQKDLRQITTAVGDGAIAGQGVYHYLESFPS

    >gi|50914800|ref|YP_060772.1| copper-exporting ATPase [Streptococcus pyogenes MGAS10394]
    MPLSEKGDVLMAKEIFLVEGMSCASCALTIEKTVNQLPEVEQAVVNLATEKLTVTYQDDDLETAKVIQAVKAAGYGAQVF
    DEHAKHMQTGRRDEDLKVIWSQVLWSALFTIPILYLAMGHMVGLWLPPFLQPDRYPFVYSFSQLLLTIPVLVLNRHYYHN
    GFKALFKGHPNMDSLVALATSFAFAYSLYGVVEISLGQAHFVHSLYFESVVVILTLIGLGKYFESRSKGRTSQAIQKLLS
    LKATDVRVWRNSQWQLLPLEEVSYDDLVLVQPGEKVSIDGIIVEGHSSLDESFLTGESLPVEKGEKDNVFAGSLNGPGAL
    TIKPDKLGNDTLLAQIIQLVENAQENKAPIAAIADRVSGVFVPVVLVLALLTGVFWLVFMQESFRFSLTTAIAVLVIACP
    CALGLATPTAIMVGTGRAAENGILFKGGDILEQAHQVDTVVFDKTGTVTEGKPSLQKLLIFSGDDHLILQEAASLEAYSQ
    HPLGEAIVRAAQEAGYDSLPVEEFESLTGLGVTGQLEGRRLAIGNAALMGILGIDLSCVQSVCAKASGKGQTLVYYAKEG
    QLRALFSIADAVKEDSQATVEALHQLGIHTIMLTGDHDATAKAIASQVGITDVISQVLPDQKAGVIADLRSQGRKVAMVG
    DGINDAPALAVADIGIAMGSGTDIAIESADVILMKPDMLDLVKAMSLSRATMRIVKENLFWAFIYNVLMIPVAMGLLHLF
    GGPLLNPMLAGFAMSFSSVSVVLNALRLKGKTI

    >gi|50914917|ref|YP_060889.1| thioredoxin [Streptococcus pyogenes MGAS10394]
    MYNRLIIKMKWRKKMALEVTDATFVEETKEGLVLIDFWATWCGPCRMQAPILEQLSQEIDEDELKILKMDVDENPETARQ
    FGIMSIPTLMFKKDGEVVKQVAGVHTKDQLKAIIAELS

    >gi|50915111|ref|YP_061083.1| peroxiredoxin [Streptococcus pyogenes MGAS10394]
    MSLIGKEIAEFSAQAYHDGKFITVTNEDVKGKWAVFCFYPADFSFVCPTELGDLQEQYETLKSLGVEVYSVSTDTHFVHK
    AWHDDSDVVGTITYPMIGDPSHLISQAFEVLGEDGLAQRGTFIVDPDCIIQMMEINADGIGRDASTLIDKIHAAQYVRKH
    PGEVCPAKWKEGAETLTPSLDLVGKI

    >gi|50915112|ref|YP_061084.1| peroxiredoxin reductase (NAD(P)H) [Streptococcus pyogenes MGAS10394]
    MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDRQPSFKVAKKGHDSGVVFAGL
    PLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHFETYVSLT
    CHNCPDVVQALNIMSVLNDKISHTMVEGGMFQD
    EVKAKGIMSVPTVFLDGEEFTSGRATIEQLLEQIAGPLSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
    FGGQVMETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLANGAVLQAKTAILALGAKWRN
    INVPGEDEFRNKGVTY
    CPHCDGPLFEGKDVAVIGGGNSGLEAALDLAGLAKHVYVLEFLPELKADKVLQDRAADTANMTI
    IKNVATKDIVGDDHVTGLNYTERDSGEDKHLDLEGVFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
    CTDSAYKQIIISMGSGATAAIGAFDYLIRQ

    >gi|50915143|ref|YP_061115.1| transcriptional regulator Spx [Streptococcus pyogenes MGAS10394]
    MIKIYTISSCTSCKKAKTWLNAHKLAYKEQNLGKEPLTKEEILAILSKTENGVESIVSSKNRYAKALDCDIEELSVSEVI
    DLIQDNPRILKSPILIDDKRLQVGYKEDDIRAFLPRSIRNIENTEARLRAAL