Streptococcus pyogenes MGAS10270 uid58571

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|94989611|ref|YP_597711.1| thioredoxin [Streptococcus pyogenes MGAS10270]
    MIRPTSYESLAALIEKEDKLVLFFTADWCPDCQFIYPIMPEIEAELTDMTFVCVNRDQFIEVAQKWNIFGIPSFVVIEKG
    QEVGRLVNKMRKTKTEIMHFLAAYQ

    >gi|94989846|ref|YP_597946.1| arsenate reductase family protein [Streptococcus pyogenes MGAS10270]
    MITIYQYPKCSTCQRAMAELKQLVSDFEVIDIKANPPKAQDLKHWMETSGYTIKNFFNTSGNSYRELGLKDKIDQLSLDK
    AAELLATDGMLIKRPILIKDGNVLQVGYRKPYQELDLG

    >gi|94989892|ref|YP_597992.1| methionine sulfoxide reductase A [Streptococcus pyogenes MGAS10270]
    MERAIFAGGCFWCMVQPFEEQAGILSVRSGYTGGHLPNPSYEQVCAKTTGHTEAVEIIFDPKQIAYKDLVELYWAQTDPT
    DAFGQFEDRGDNYRPVIYYTTERQKEIAEQSKASLQASGRFDQPIVTTIEPAEPFYLAEDYHQGFYKKNPKRYAQSSAIR
    HQFLEENWS

    >gi|94990006|ref|YP_598106.1| glutathione peroxidase [Streptococcus pyogenes MGAS10270]
    MIPLTKLSVTPRRCHMPNLYDFTVKAQDGSDISLVNYKEKVVLVVNTATKCGLTPQYQALQALYDTYHDKGFEVLDFPCN
    QFLNQAPGDAEEINHFCSLTYHTTFPRFAKIKVNGKDADPLFTWLKEEKSGPLGKRIEWNFTKFLIDQNGQVIKRYSSKT
    DPKLIEEDLKALLG

    >gi|94990192|ref|YP_598292.1| glutathione reductase [Streptococcus pyogenes MGAS10270]
    MIKMVIPYDYIVIGGGSAGIASANRAAMHGAKVLLAEGKEIGGTCVNLGCVPKKVMWYGAQVADILGTYAKDYGFDFKEK
    AFDFKQLKANRQAYIDRIHASYERGFEQNGVDRIYDYAIFKDAHTVEIAGQLYTAPHILIATGGHPVFPDIEGAQYGISS
    DGFFALDEVPKRTAVVGAGYIAVELAGVLHALGSKTDLFIRHDRPLRSFDKAIVDVLVEEMAVNGPRLHTHAEVAKVVKN
    TDESLTLYLKDGQEVEVDQLIWAIGRKPNLEGFGLDKTGVTLNDKGYIETDAYENTSVKGIYAVGDVNGKLALTPVAVAA
    GRRLSERLFNGKTDEKLDYQNVATVIFSHPVIGSVGLSEEAAVKQYGQEAVKTYQSRFTSMFTAITNHRQPCLMKLVTVG
    DTEKIVGLHGIGYGVDEMIQGFAVAIKMGATKADFDNTVAIHPTGSEEFVTMR

    >gi|94990264|ref|YP_598364.1| arsenate reductase [Streptococcus pyogenes MGAS10270]
    MEEITIYHNPNCGTSRNVLAMIRHAGIEPTIIEYLQTPPNRETLIELLQSMGISARELLRTNVPEFEAYGLANQAVAEKD
    VINAMLTDPILINRPIVVTRKGVKLCRPSETLLDILPVPLPSPYIKEDGEIVNPIEVKGEKDVIDD

    >gi|94990285|ref|YP_598385.1| hypothetical protein MGAS10270_Spy0776 [Streptococcus pyogenes MGAS10270]
    MSEKIRVLLYYKYVSIENAQEYAAKHLEFCKSIGLKGRILIADEGINGTVSGDYETTQKYMDWVHSDERFADLWFKIDEE
    NQQAFRKMFVRYKKEIVHLGLEDNNFDSDINPLETTGEYLNPKQFKEALLDEDTVVLDTRNDYEYDLGHFRGAIRPDIRN
    FRELPQWVRDNKDKFMEKRVVVY
    CTGGVRCEKFSGWMVREGFKDVGQLHGGIATYGKDPEVQGELWDGAMYVFDDRISVP
    INHVNPTVISKDYFDGTPCERYVNCTNPFCNKQIFASEENETKYVRGCSPECRAHERNRYVQENGLSRQEWAERLEAIGE
    SLPEFVGA

    >gi|94990382|ref|YP_598482.1| dihydrolipoamide dehydrogenase [Streptococcus pyogenes MGAS10270]
    MAVEIIMPKLGVDMQEGEIIEWKKQEGDTVNEGDILLEIMSDKTNMELEAEDSGVLLKITRQAGETVPVTEVIGYIGAEG
    ESVEVSSPAASDVNVARTTEDLEAAGLEVPKAPAQAASTAPKAALADDEYDIIVVGGGPAGYYAAIRGAQLGGKIAIVEK
    SEFGGT
    CLNVGCIPTKTYLKNAEILDGIKIAAGRGINLASTNYTIDMDKTVDFKNTVVKTLTGGVQGLLKANKVTIFNGL
    GQVNPDKTVTIGSKTIKGRNVILATGSKVSRINIPGIDSKLVLTSDDILDLREMPKSLAVMGGGVVGIELGLVWASYGVD
    VTVIEMADRIIPAMDKEVSLELQKILSKKGMKIKTSVGVSEIVEANNQLTLKLNNGEEVVAEKALLSIGRVPQMNGLENL
    NLEMDRNRIKVNDYQETSIPGIYAPGDVNGTKMLAHAAYRMGEVAAENAMHGNTTRKANLKYTPAAVYTHPEVAMVGLTE
    EQAREQYGDVLIGKNSFTGNGRAIASNEAHGFVKVIADAKYHEILGVHIIGPAAAEMINEAATIMESELTVDELLLSIHG
    HPTFSEVMYEAFADVLGEAIHNPPKRK

    >gi|94990403|ref|YP_598503.1| methionine sulfoxide reductase B [Streptococcus pyogenes MGAS10270]
    METSEELKQRIGDLSYEVTQHAATESPFTGEYDDFFEKGIYVDIVSEEVLFSSLDKFNSGCGWPAFSKPIENRMVTNHDD
    SSYGMRRIEVKSREAGSHLGHVFSDGPKEAGGLRY
    CINSAALKFIPYEQMEKEGYAQWLTLFDET

    >gi|94990495|ref|YP_598595.1| NADH oxidase H2O-forming [Streptococcus pyogenes MGAS10270]
    MSKIVVVGANHAGTACIKTMLTNYGDANEIVVFDQNSNISFLGCGMALWIGEQIAGPEGLFYSDKEELESLGAKVYMESP
    VQSIDYDAKTVTALVDGKNHVETYDKLIFATGSQPILPPIKGAEIKEGSLEFEATLQNLQFVKLYQNSADVIAKLENKDI
    KRVAVVGAGYIGVELAEAFQRKGKEVVLIDVVDTCLAGYYDRDLTDLMAKNMEEHGIQLAFGETVKEVAGNGKVEKIITD
    KNEYDVDMVILAVGFRPNTTLGNGKIDLFRNGAFLVNKRQETSIPGVYAIGDCATIYDNATRDTNYIALASNAVRTGIVA
    AHNACGTDLEGIGVQGSNGISIYGLHMVSTGLTLEKAKRLGFDAAVTEYTDNQKPEFIEHGNFLVTIKIVYDKDSRRILG
    AQMAAREDVSMGIHMFSLAIQEGVTIEKLALTDIFFLPHFNKPYNYITMAALGAKD

    >gi|94990583|ref|YP_598683.1| transcriptional regulator Spx [Streptococcus pyogenes MGAS10270]
    MVTLFLSPSCTSCRKARAWLVKHEVDFQEHNIITSPLSRDELMSILSFTENGTEDIISTRSKVFQKLDIDVEELSISDLI
    DLIAKNPSLLRRPIIMDQKRMQIGFNEDEIRAFLSRDYRKQELRQATIKAEIEG

    >gi|94990701|ref|YP_598801.1| glutaredoxin [Streptococcus pyogenes MGAS10270]
    MEPLLILEGQDMITVYSKNNCMQCKMTKKFLEQHGANFQEINIDEHPEKVDYVKSLGFTSAPVIEADNLVFSGFQPAKLK
    ELI

    >gi|94990871|ref|YP_598971.1| bifunctional methionine sulfoxide reductase A/B protein [Streptococcus pyogenes MGAS10270]
    MEHKWKLWLFIVGVVLLIGGASVLIQKGQAKAFSQGKPQLPAKKVKSTKVDPNALVDQKVIYLAGGCFWGVEEYFSQVDG
    VLDAVSGYANGRGDTTNYQLIHQTGHAETVEVTYDANRISLKELLLHFFRIIDPTSLNKQGNDRGSQYRTGIYYTDKADL
    AIIDEVFKEKAKDYKKKIVVEKAPLKHFIKAEDYHQDYLKKNPNGYCHIDINQATYPVIDESKYPKPSATEIKAKLSADE
    YRVTQKNETEKAFSNRYWDSFDAGIYVDVVTGEPLFSSKDKFESGCGWPSFSRPISPDVVRYKEDKSFNMTRTEVRSRSG
    NSHLGHVFTDGPKDQGGLRY
    CINSLSITFIPKADMEAKGYGYLLSSVE

    >gi|94990872|ref|YP_598972.1| Thiol:disulfide interchange protein tlpA [Streptococcus pyogenes MGAS10270]
    MKKGLLVTTGLACIGLLTACSTQDNMAKKEITQDKMSMAAKKKDKMSTSKDKSMMADKSSDKKMTNDGPMAPDFELKGID
    GKTYRLSEFKGKKVYLKFWASW
    CSICLSTLADTEDLAKMSDKDYVVLTVVSPGHQGEKSEADFTKWFQGTDYKDLPVLLD
    PDGKLLEAYGVRSYPTEVFIGSDGVLAKKHIGYAKKSDIKKTLKGIH

    >gi|94990911|ref|YP_599011.1| glutaredoxin-like protein [Streptococcus pyogenes MGAS10270]
    MEHRLSMHYFQVKKEIFGVLLLSPVILLIMWGYVSSNQDDGRLTQKQYYETVVNQTVNLVFYKKSCPYCKVAKKEIATQA
    KDSQVITYYVDTSTGEGQKLVKKYHVKYAPTIVSIRKGNIQSFLYARDRGNNIIVEKEKIKEVFSQ

    >gi|94990986|ref|YP_599086.1| thioredoxin reductase [Streptococcus pyogenes MGAS10270]
    MYDTLIIGSGPAGMTAALYAARSNLSVAIIEQGAPGGQMNNTFDIENYPGYDHISGPELAMKMYEPLEKFNVENIYGIVQ
    KIENFGDYKCVLTEDASYEAKTVIIATGAKYRVLGVPGEEYYTSRGVSY
    CAVCDGAFFRDQDLLVVGGGDSAVEEAIYLT
    QFAKKVTVVHRRDQLRAQKILQDRAFANDKVDFIWDSVVKEIKGNDIKVSNVLIENVKTGQVTDHAFGGVFIYVGMNPVT
    DMVKDLEITDQEGWIITDDHMRTSIPGIFAIGDVRQKDLRQITTAVGDGAIAGQGVYHYLESFSS

    >gi|94991135|ref|YP_599235.1| thioredoxin [Streptococcus pyogenes MGAS10270]
    MYNRLIIKMKWRKKMALEVTDATFVEETKEGLVLIDFWATWCGPCRMQAPILEQLSQEIDEDELKILKMDVDENPETARQ
    FGIMSIPTLMFKKDGEVVKQVAGVHTKDQLKAIIAELS

    >gi|94991343|ref|YP_599443.1| peroxiredoxin [Streptococcus pyogenes MGAS10270]
    MSLIGKEIAEFSAQAYHDGKFITVTNEDVKGKWAVFCFYPADFSFVCPTELGDLQEQYETLKSLGVEVYSVSTDTHFVHK
    AWHDDSDVVGTITYPMIGDPSHLISQAFEVLGEDGLAQRGTFIVDPDGIIQMMEINADGIGRDASTLIDKIHAAQYVRKH
    PGEVCPAKWKEGAETLTPSLDLVGKI

    >gi|94991344|ref|YP_599444.1| peroxiredoxin reductase (NAD(P)H) / NADH oxidase H2O2-forming [Streptococcus pyogenes MGAS10270]
    MALSPDIKEQLAQYLTLLEADLVLQVSLGDNEQSQKVKDFVEEIAAMSERISIENITLDRQPSFKVAKKGHDSGVVFAGL
    PLGHELTSFILALLQVSGRAPKVDQDVIDRIKAIDRPLHFETYVSLT
    CHNCPDVVQALNIMSVLNDKISHTMVEGGMFQD
    EVKAKGIMSVPTVFLDGEEFTSGRATIEQLLEQIAGPLSEEAFADKGLYDVLVIGGGPAGNSAAIYAARKGLKTGLLAET
    FGGQVIETVGIENMIGTLYTEGPKLMAEVEAHTKSYDVDIIKAQLATSIEKKENIEVTLANGAVLQAKTAILALGAKWRN
    INVPGEDEFRNKGVTY
    CPHCDGPLFEGKDVAIIGGGNSGLEAALDLAGLAKHVYVLEFLPELKADKVLQDRAAKTNNMTI
    IKNVATKDIVGDDHVTGLNYTERDSGEDKHLDLEGIFVQIGLVPNTAWLKDSGVNLTDRGEIIVDKHGSTNIPGIFAAGD
    CTDSAYKQIIISMGSGATAAIGAFDYLIRQ

    >gi|94991375|ref|YP_599475.1| transcriptional regulator Spx [Streptococcus pyogenes MGAS10270]
    MIKIYTISSCTSCKKAKTWLNAHKLAYKEQNLGKEPLTKEEILAILSKTENGVESIVSSKNRYAKALDCDIEELSVSEVI
    DLIQDNPRILKSPILIDDKRLQVGYKEDDIRAFLPRSIRNIENTEARLRAAL