Streptococcus pneumoniae 70585 uid59125

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|225857956|ref|YP_002739466.1| hypothetical protein SP70585_0154 [Streptococcus pneumoniae 70585]
    MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGMEDLWFKIDEE
    NEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRN
    FRELPQWVRDNKEKFMDKRVVVY
    CTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVD
    VNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGE
    SLDQAATV

    >gi|225858048|ref|YP_002739558.1| transcriptional regulator Spx [Streptococcus pneumoniae 70585]
    MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDILTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVL
    NLIMETPRILKSPILVDEKRLQVGYKEDDIRAFLPRSVRNVENAEARLRAAL

    >gi|225858168|ref|YP_002739678.1| peroxiredoxin Hyr1 (hydrogen peroxide resistanceprotein 1) (oxidant receptor peroxidase 1) (glutathione peroxidase 3
    MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEILDFPCNQFMGQAPGSAEEINA
    FCSLHFQTTFPRFAKIKVNGKEADPLYVWLQDQKSGPLGKRIEWNFAKFLIGRDGQVFERFSSKTDPKQIEEAIQTLL

    >gi|225858262|ref|YP_002739772.1| macrophage infectivity potentiator protein [Streptococcus pneumoniae 70585]
    MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVLEAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAF
    CVAGHTAFSIKQIQMNDDLIQALRNRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLA
    ILCNYANNLANTPINPELQPYA

    >gi|225858487|ref|YP_002739997.1| thioredoxin family protein [Streptococcus pneumoniae 70585]
    MKKWQTCVLGAGSLLWLTACSGKSVTSEHQTKDEMKTEQTASKTSAAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFW
    ASW
    CSICLASLPDTDEIAKEAGDDYVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAF
    IDKEGKLVKTHPGFMEKDAILQTLKELA

    >gi|225858488|ref|YP_002739998.1| peptide methionine sulfoxide reductase MsrA/msrB [Streptococcus pneumoniae 70585]
    MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQGGKAVKKTEISKDADLHEIYLAGGCFWGVEEYFSRV
    PGVTDAVSGYANGRGETTKYELINQTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDK
    DLEVINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVIDASKYPKPSDEELKKTLSP
    EEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSKDKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSR
    VGDSHLGHVFTDGPQDKGGLRY
    CINSLSIRFIPKDQMEEKGYAYLLDYVD

    >gi|225858592|ref|YP_002740102.1| glutathione reductase [Streptococcus pneumoniae 70585]
    MREYDIIAIGGGSGGIATMNRAGEHGAQAAVIEEKKLGGTCVNVGCVPKKIMWYGAQIAETFHQFGEDYGFKTTDLNFDF
    ATLRRNRESYIDRARSSYDGSFKRNGVDLIEGHAEFVDSHTVSVNGELIRAKHIVIATGAHPSIPNIPGAELGGSSDDVF
    AWEELPESVAILGAGYIAVELAGVLHTFGVKTDLFVRRDRPLRGFDSYIVEGLVKEMERTNLPLHTHKVPVKLEKTTDGI
    TIHFEDGTSHTASQVIWATGRRPNVKGLQLEKAGVTLNERGFIQVDEYQNTVVEGIYALGDVTGEKELTPVAIKAGRTLS
    ERLFNGKTTAKMDYSTIPTVVFSHPAIGTVGLTEEQAIKEYGQDQIKVYKSSFASMYSACTRNRQESRFKLITAGSEEKV
    VGLHGIGYGVDEMIQGFAVAIKMGVTKADFDATVAIHPTSSEEFVTMR

    >gi|225858793|ref|YP_002740303.1| thioredoxin family protein [Streptococcus pneumoniae 70585]
    MKKVMFAGLSLLSLVVLMACGEEETKKTQAAQQPKQQTTVQQIAVGKDAPDFTLQSMDGKEVKLSDFKGKKVYLKFWASW
    CGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDS
    QGKIGKIQFGAISNADAEAAFKEMN

    >gi|225858948|ref|YP_002740458.1| dihydrolipoyl dehydrogenase [Streptococcus pneumoniae 70585]
    MALEVIMPKAGVDMTEGQIVQWNKKVGEFVKEGEILLEIMTDKVSMELEAEEDGYLIAILKGDGETVPVTEVIGYLGEER
    ENIPTAGAASPEASPVPVASTSNDDGKSDDAFDIVVIGGGPAGYVAAIKAAQLGGKVALVEKSELGGT
    CLNRGCIPTKTY
    LHNAEIIENIGHAANRGIVIENPNFTVDMEKLLETKSKVVNTLVGGVAGLLRSYGVTVHKGIGTITKDKNVLVNGSELLE
    TKKIILAGGSKVSKINVPGMESSLVMTSDDILEMNEVPESLVIIGGGVVGIELGQAFMTFGSKVTVIEMMDRIVPAMDAE
    VSKNLRLILERKGMTILTGTKLQEIIEENGQLRIKVEGKDDIIASKALLSIGRMPDLEGIGEVEFELDRGCIKVNEYMET
    SVPGIYAPGDINGTKMLAHAAFRMGEVSAENALKGNHAVAKLNLTPAAIYTLPEVAAVGLTEEQAREKYDVAIGKFNFAA
    NGRAIASDAAQGFVKVIADKKYGEILGVHIIGPAAAELINEASSIIEMEITVEEMLKTIHGHPTYSEVMYEAFADVLGMA
    IHSPKKK

    >gi|225858966|ref|YP_002740476.1| glutaredoxin [Streptococcus pneumoniae 70585]
    MVTVYSKNNCVQCKMTKRFLDSNNVSYREINLDEQPEYVDQVKELGFSAAPVIQTPTEVFSGFQPGKLKQLA

    >gi|225859126|ref|YP_002740636.1| peptide methionine sulfoxide reductase MsrA/msrB [Streptococcus pneumoniae 70585]
    MAEIYLAGGCFWGLEEYFSRISGVLETSVGYANGQVETTNYQLIKETDHAETVQVIYDEKEVSLREILLYYFRVIDPLSI
    NQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSGYCHIDVTDADKP
    LIDAANYEKPSQEVLKASLSEESYRVTQEAATEAPFTNAYDQTFEEGIYVDITTGEPLFFAKDKFASGCGWPSFSRPISK
    ELIHYYKDLSHGMERIEVRSRSGSAHLGHVFTDGPRELGGLRY
    CINSASLRFVAKDEMEKAGYGYLLPYLNK

    >gi|225859170|ref|YP_002740680.1| transcriptional regulator Spx [Streptococcus pneumoniae 70585]
    MITLFLSPSCTSCRKAKAWLEKHKVPFVEHNIMTSPLTRKELQHILSLTENGTDDIISTRSKIFQKLNIDVESISVSELL
    HLIEQYPSLLRRPIIIDAKRMQIGFNEDEIRAFLPRSYRKQELKEARMRAGIS

    >gi|225859219|ref|YP_002740729.1| thioredoxin-disulfide reductase [Streptococcus pneumoniae 70585]
    MYDTIIIGAGPAGMTAALYAARSNLKVALIEGGLPGGQMNNTSDIENYPGYANISGPELAEKMFEPLENLGVEHIYGYVE
    NVEDHGDFKKVMTDDQTYETRTVIVATGSKHRPLGVLGEEELNSRGVSY
    CAVCDGAFFRDQDLLVVGGGDSAVEEALFLT
    RFAKTVTIVHRRDQLRAQKVLQDRAFANEKISFIWDSVVREIKGENRVESVVFENVKTGQVTEQAFGGVFIYVGLDPLSD
    FVKELNIQDQAGWIVTDNHMKTAVDGIFAVGDVRLKDLRQVTTAVGDGAIAGQEAYKFITEHS

    >gi|225859223|ref|YP_002740733.1| arsenate reductase [Streptococcus pneumoniae 70585]
    MLEFIEYPKCSTCKKAKQELNQLGVDYKAVHIVEETPSQEVILNWLETSGFELKQFFNTSGIKYRELGLKDKVGSLSNQE
    AAELLASDGMLLKRPILVENGTVKQIGYRKSYEELGLK

    >gi|225859224|ref|YP_002740734.1| O6-methylguanine-DNA methyltransferase [Streptococcus pneumoniae 70585]
    MQKKYVKILYSSPIGILSLVADDHYLYGIWVQEQKHFERGLGDETIEEVVSHPILDPVIACLDDYFKGKPQDLSNLLLAP
    IGTNFEKRVWDYLQGIPYGQTVTYGQIAQDLQVASAQAIGGAVGRNPWSILVP
    CHRVLGAGKRLTGYAAGVEKKAWLLEH
    EGVDFKDRNNRRRSTC

    >gi|225859230|ref|YP_002740740.1| NADH oxidase (noxase) [Streptococcus pneumoniae 70585]
    MSKIVVVGANHAGTACINTMLDNFGNENEIVVFDQNSNISFLGCGMALWIGEQIDGAEGLFYSDKEKLEAKGAKVYMNSP
    VLSIDYDNKVVTAEVEGKEHKESYEKLIFATGSTPILPPIEGVEIVKGNREFKATLENVQFVKLYQNAEEVINKLSDKSQ
    HLDRIAVVGGGYIGVELAEAFERLGKEVVLVDIVDTVLNGYYDKDFTQMMAKNLEDHNIRLALGQTVKAIEGDGKVERLI
    TDKESFDVDMVILAVGFRPNTALADGKIELFRNGAFLVDKKQETSIPGVYAVGDCATVYDNARKDTSYIALASNAVRTGI
    VGAYNACGHELEGIGVQGSNGISIYGLHMVSTGLTLEKAKAAGYNATETGFNDLQKPEFMKHDNHEVAIKIVFDKDSREI
    LGAQMVSHDIAISMGIHMFSLAIQEHVTIDKLALTDLFFLPHFNKPYNYITMAALTAEK

    >gi|225859345|ref|YP_002740855.1| pyridine nucleotide-disulfide oxidoreductase [Streptococcus pneumoniae 70585]
    MLTYDLIVIGFGKAGKTLAGKLASAGKKVALVERSKAMYGGTCINIGCIPTKTLLVAAEKDLSFEEVIATKNTITGRLNG
    KNYATVAGTGVDIFDAEAHFLSNKVIEIQAGDEKKELTAETIVINTGAVSNVLPIPGLATSKNIFDSTGIQSLDKLPEKL
    GVLGGGNIGLEFAGLYNKLGSKVTVLDALDTFLPRAEPSIAALAKQYMEEDGIELLQNIHTTEIKNDGDQVLVVTEDETY
    RFDALLYATGRKPNVEPLQLENTDIELTERGAIKVDKHCQTNVPGVFAVGDVNGGLQFTYISLDDFRVVYSYLAGDGSYT
    LEDRLNVPNTMFITPALSQVGLTESQAADLKLPYAVKEIPVAAMPRGHVNGDLRGAFKAVVNTETKEILGASIFSEGSQE
    IINIITVAMDNKIPYTYFTKQIFTHPTLAENLNDLFAI

    >gi|225859407|ref|YP_002740917.1| thiol peroxidase [Streptococcus pneumoniae 70585]
    MVTFLGNPVSFTGKQLQVGDKALDFSLTTTDLSKKSLADFDGKKKVLSVVPSIDTGICSTQTRRFNEELAGLDNMVVLTV
    SMDLPFAQKRWCGAEGLDNAIMLSDYFDHSFGHDYALLINEWHLLARAVFVLDTDNTIRYVEYVDNINSEPNFEAAIAAA
    KAL

    >gi|225859531|ref|YP_002741041.1| thioredoxin [Streptococcus pneumoniae 70585]
    MAKAITDATFEQETKDGLVLVDFWATWCGPCRMQGPILDKLSEELSEDVLKIVKMDVDENPNTARAFGIMSIPTLLFKKD
    GQVVKQVAGVHTAEQIKAIIAELS

    >gi|225859677|ref|YP_002741187.1| thioredoxin family protein [Streptococcus pneumoniae 70585]
    MIQPASLEELASLVEKAGKKVFLFVADWCGDCRYIYPALPEIEETNPEFTFIRMDRDQYMDLAKLWDVYGIPSLVVLEKD
    KEIGRFVNRDRKSKEQINDFLAGLK