Streptococcus pneumoniae 670 6B uid52533

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|307126298|ref|YP_003878329.1| hypothetical protein SP670_0147 [Streptococcus pneumoniae 670-6B]
    METSISMADFYGKYQNENLELIDVREAHEFQAGHAPGAKNLPLSTLEQGYKELKPDHEYYVICQGGVRSASTCQFLSSQG
    LTVTNVEGGMNAWPGQVE

    >gi|307126316|ref|YP_003878347.1| Rhodanese-domain-containing protein [Streptococcus pneumoniae 670-6B]
    MAKDIRVLLYYLYTPIENAEQFAADHLAFCKSIGLKGRILVADEGINGTVSGDYETTQKYMDYVHSLPGMEDLWFKIDEE
    SEQAFKKMFVRYKKEIVHLGLEDNDFDNDINPLETTGAYLSPKEFKEALLDKDTVVLDTRNDYEYDLGHFRGAIRPDIRN
    FRELPQWVRDNKEKFMDKRVVVY
    CTGGVRCEKFSGWMVREGYKDVGQLHGGIATYGKDPEVQGELWDGKMYVFDERIAVD
    VNHVNPTIVGKDWFDGTPCERYVNCGNPFCNRRILTSEENEDKYLRGCSHECRVHPRNRYVSKNELTQAEVIERLAAIGE
    SLDQAATV

    >gi|307126413|ref|YP_003878444.1| regulatory protein spx [Streptococcus pneumoniae 670-6B]
    MIKIYTVSSCTSCKKAKTWLNAHQLSYKEQNLGKEGITREELLDILTKTDNGIASIVSSKNRYAKALGVDIEDLSVNEVL
    NLIMETPRILKSPILVDEKRLQVGYKEDDIRAFLPRSVRNVENAEARLRAAL

    >gi|307126525|ref|YP_003878556.1| peroxiredoxin Hyr1 [Streptococcus pneumoniae 670-6B]
    MTSLYDFSVLNQNNQATPLDSYRGKVLLIVNTATGCGLTPQYQGLQELYERYQDQGFEILDFPCNQFMGQAPGSAEEINA
    FCSLHFQTTFPRFAKIKVNGKEADPLYVWLKDHKSGPLGKRIEWNFAKFLISRDGQVFERFSSKTDPKQIEEAIQTLL

    >gi|307126624|ref|YP_003878655.1| macrophage infectivity potentiator protein [Streptococcus pneumoniae 670-6B]
    MTTFTIHTVESAPAEVKEILETVEKDNNGYIPNLIGLLANAPTVLEAYQIVSSIHRRNSLTPVEREVVQITAAVTNGCAF
    CVAGHTAFSIKQIQMNDDLIQALRNRTPIETDPKLDTLAKFTLAVINTKGRVGDEALSEFLEAGYTQQNALDVVFGVSLA
    ILCNYANNLANTPINPELQPYA

    >gi|307126854|ref|YP_003878885.1| thioredoxin family protein [Streptococcus pneumoniae 670-6B]
    MKKWQTCVLGAGSLLCLTACSGKSVTSEHQTKDEMKTEQTASKTSAAKGKEVADFELMGVDGKTYRLSDYKGKKVYLKFW
    ASW
    CSICLASLPDTDEIAKEAGDDYVVLTVVSPGHKGEQSEADFKNWYKGLDYKNLPVLVDPSGKLLETYGVRSYPTQAF
    IDKEGKLVKTHPGFMEKDAILQTLKELA

    >gi|307126855|ref|YP_003878886.1| peptide methionine sulfoxide reductase MsrA/msrB [Streptococcus pneumoniae 670-6B]
    MNDKLKIFLLLGVFFLAITGFYVLLIRNAGQTDASQIEKAAVSQGGKAVKKTEISKDADLHEIYLAGGCFWGVEEYFSRV
    PGVTDAVSGYANGRGETTKYELINQTGHAETVHVTYDAKQISLKEILLHYFRIINPTSKNKQGNDVGTQYRTGVYYTDDK
    DLEVINQVFDEVAKKYDQPLAVEKENLKNFVVAEDYHQDYLKKNPNGYCHINVNQAAYPVIDASKYPKPSDEELKKTLSP
    EEYAVTQENQTERAFSNRYWDKFESGIYVDIATGEPLFSSKDKFESGCGWPSFTQPISPDVVTYKEDKSYNMTRMEVRSR
    VGDSHLGHVFTDGPQDKGGLRY
    CINSLSIRFIPKDQMEEKGYAYLLDYVD

    >gi|307126961|ref|YP_003878992.1| NADH oxidase [Streptococcus pneumoniae 670-6B]
    MSKIVVVGANHAGTACINTMLDNFGNENEIVVFDQNSNISFLGCGMALWIGEQIDGAEGLFYSDKDKLEAKGAKVYMNSP
    VLSIDYDNKVVTAEVEGKEHKESYEKLIFATGSTPILPPIEGVEIVKGNREFKATLENVQFVKLYQNAEEVINKLSDKSQ
    HLDRIAVVGGGYIGVELAEAFERLGKEVVLVDIVDTVLNGYYDKDFTQMMAKNLEDHNIRLALGQTVKAIEGDGKVERLI
    TDKESFDVDMVILAVGFRPNTALADGKIELFRNGAFLVDKKQETSIPGVYAVGDCATVYDNARKDTSYIALASNAVRTGI
    VGAYNACGHELEGIGVQGSNGISIYGLHMVSTGLTLEKAKAAGYNATETGFNDLQKPEFMKHDNHEVAIKIVFDKDSREI
    LGAQMVSHDIAISMGIHMFSLAIQEHVTIDKLALTDLFFLPHFNKPYNYITMAALTAEK

    >gi|307126967|ref|YP_003878998.1| O6-methylguanine-DNA methyltransferase [Streptococcus pneumoniae 670-6B]
    MQKKYVKILYSSPIGILSLVADDHYLYGIWVQEQKHFERGLGDETIEEVVSHPILDPVIACLDDYFKGKPQDLSNLLLAP
    IGTNFEKRVWDYLQGIPYGQTVTYGQIAQDLQVASAQAIGGAVGRNPWSILVP
    CHRVLGAGKRLTGYAAGVEKKAWLLEH
    EGVDFKDRNNRRRSTC

    >gi|307126968|ref|YP_003878999.1| arsenate reductase [Streptococcus pneumoniae 670-6B]
    MLEFIEYPKCSTCKKAKQELNQLGVDYKAVHIVEETPSQEVILNWLETSGFELKQFFNTSGIKYRELGLKDKVGSLSNQE
    AAELLASDGMLLKRPILVENGTVKQIGYRKSYEELGLK

    >gi|307126972|ref|YP_003879003.1| thioredoxin-disulfide reductase [Streptococcus pneumoniae 670-6B]
    MYDTIIIGAGPAGMTAALYAARSNLKVALIEGGLPGGQMNNTSDIENYPGYANISGPELAEKMFEPLENLGVEHIYGYVE
    NVEDHGDFKKVMTDDQTYETRTVIVATGSKHRPLGVPGEEELNSRGVSY
    CAVCDGAFFRDQDLLVVGGGDSAVEEALFLT
    RFAKTVTIVHRRDQLRAQKVLQDRAFANEKISFIWDSVVREIKGENRVESVVFENVKTGQVTEQVFGGVFIYVGLDPLSD
    FVKELNIQDQAGWIVTDNHMKTAVDGIFAVGDVRLKDLRQVTTAVGDGAIAGQEAYKFITEHS

    >gi|307127026|ref|YP_003879057.1| regulatory protein spx [Streptococcus pneumoniae 670-6B]
    MITLFLSPSCTSCRKAKAWLEKHKVPFVEHNIMTSPLTRKELQHILSLTENGTDDIISTRSKIFQKLNIDVESISVSELL
    HLIEQYPSLLRRPIIIDAKRMQIGFNEDEIRAFLPRSYRKQELKEARMRAGIS

    >gi|307127072|ref|YP_003879103.1| peptide methionine sulfoxide reductase MsrA/msrB [Streptococcus pneumoniae 670-6B]
    MAEIYLAGGCFWGLEEYFSRISGVLETSVGYANGQVETTNYQLIKETDHAETVQVIYDEKEVSLREILLYYFRVIDPLSI
    NQQGNDRGRQYRTGIYYQDEADLPAIYTVVQEQERMLGRKIAVEVEQLRHYILAEDYHQDYLRKNPSGYCHIDVTDADKP
    LIDAANYEKPSQEVLKASLSEESYRVTQEAATEAPFTNAYDQTFEEGIYVDITTGEPLFFAKDKFASGCGWPSFSRPISK
    ELIHYYKDLSHGMERIEVRSRSGSAHLGHVFTDGPRELGGLRY
    CINSASLRFVAKDEMEKAGYGYLLPYLNK

    >gi|307127227|ref|YP_003879258.1| glutaredoxin [Streptococcus pneumoniae 670-6B]
    MVTVYSKNNCVQCKMTKRFLDSNNVSYREINLDEQPEYVDQVKELGFSAAPVIQTPTEVFSGFQPGKLKQLA

    >gi|307127243|ref|YP_003879274.1| dihydrolipoyl dehydrogenase [Streptococcus pneumoniae 670-6B]
    MPKAGVDMTEGQIVQWNKKVGEFVKEGEILLEIMTDKVSMELEAEEDGYLIAILKGDGETVPVTEVIGYLGEERENIPTA
    GAASPEASSVPVASTSNDDDKSDDAFDIVVIGGGPAGYVAAIKAAQFGGKVALVEKSELGGT
    CLNRGCIPTKTYLHNAEI
    IENIGHAANRGIVIENPNFTVDMEKLLETKSKVVNTLVGGVAGLLRSYGVTVHKGIGTITKDKNVLVNGSELLETKKIIL
    AGGSKVSKINVPGMESPLVMTSDDILEMNEVPESLVIIGGGVVGIELGQAFMTFGSKVTVIEMMDRIVPAMDAEVSKNLR
    LILERKGMTILTGTKLQEIIEENGQLRIKVEGKDDIIASKALLSIGRMPDLEGIGEVEFELDRGCIKVNEYMETSVPGIY
    APGDINGTKMLAHAAFRMGEVSAENALKGNHAVAKLNLTPAAIYTLPEVAAVGLTEEQAREKYDVAIGKFNFAANGRAIA
    SDAAQGFVKVIADKKYGEILGVHIIGPAAAELINEASSIIEMEITVEEMLKTIHGHPTYSEVMYEAFADVLGMAIHSPKK
    K

    >gi|307127451|ref|YP_003879482.1| thioredoxin family protein [Streptococcus pneumoniae 670-6B]
    MKKVMFAGLSLLSLVVLMACGEEETKKTQAAQQPKQQTTVQQIAVGKDAPDFTLQSMDGKEVKLSDFKGKKVYLKFWASW
    CGPCKKSMPELMELAAKPDRDFEILTVIAPGIQGEKTVEQFPQWFQEQGYKDIPVLYDTKATTFQAYQIRSIPTEYLIDS
    QGKIGKIQFGAISNADAEAAFKEMN

    >gi|307127666|ref|YP_003879697.1| glutathione-disulfide reductase [Streptococcus pneumoniae 670-6B]
    MREYDIIAIGGGSGGIATMNRAGEHGAKAAVIEEKKLGGTCVNVGCVPKKIMWYGAQIAETFHQFGEDYGFKTTDLNFGF
    ATLRRNREAYIDRARSSYDGSFKRNGVDLIEGHAEFVDSHTVSVNGELIRAKHIVIATGAHPSIPNIPGAELGGSSDDVF
    AWEELPESIAILGAGYIAVELAGVLHTFGVKTDLFVRRDRPLRGFDSYIVEGLVKEMERTNLPLHTHKVPVKLEKTTDGI
    TIHFEDGTSHTASQVIWATGRRPNVKGLQLEKAGVTLNERGFIQVDEYQNTVVEGIYALGDVTGEKELTPVAIKAGRTLS
    ERLFNGKTTAKMDYSTIPTVVFSHPAIGTVGLTEEQAIKEYGQDQIKVYKSSFASMYSACTRNRQESRFKLITAGSEEKV
    VGLHGIGYGVDEMIQGFAVAIKMGATKADFDATVAIHPTASEEFVTMR

    >gi|307127796|ref|YP_003879827.1| putative pyridine nucleotide-disulfide oxidoreductase YkgC [Streptococcus pneumoniae 670-6B]
    MLTYDLIVIGFGKAGKTLAGKLASAGKKVALVERSKAMYGGTCINIGCIPTKTLLVAAEKDLSFEEVISTKNTITGRLNG
    KNYTTVAGTGVDIFDAEAHFLSNKVIEIQAGDEKQELTAETIVINTGAVSNVLPIPGLATSKNVFDSTGIQSLDKLPEKL
    GVLGGGNIGLEFAGLYNKLGSKVTVLDALDTFLPRAEPSIAALAKQYMEEDGIELLQNIHTTEIKNDGDQVLVVTEDETY
    RFDALLYATGRKPNVEPLQLENTDIELTERGAIKVDKHCQTNVPGVFAVGDVNGGLQFTYISLDDFRVVYSYLAGDGNYT
    LEDRLNVPNTMFITPALSQVGLTESQAADLKLPYAVKEIPVTAMPRGHVNGDLRGAFKAVVNTETKEILGASIFSEGSQE
    IINIITVAMDNKIPYTYFTKQIFTHPTLAENLNDLFAI

    >gi|307127863|ref|YP_003879894.1| thiol peroxidase [Streptococcus pneumoniae 670-6B]
    MVTFLGNPVSFTGKQLQVGDKALDFSLTTTDLSKKSLADFDGKKKVLSVVPSIDTGICSTQTRRFNEELAGLDNTVVLTV
    SMDLPFAQKRWCGAEGLDNAIMLSDYFDHSFGRDYALLINEWHLLARAVFVLDTDNTIRYVEYVDNINSEPNFEAAIAAA
    KAL

    >gi|307127971|ref|YP_003880002.1| thioredoxin [Streptococcus pneumoniae 670-6B]
    MAKAITDATFEQETKDGLVLVDFWATWCGPCRMQGPILDKLSEELSEDVLKIVKMDVDENPNTARAFGIMSIPTLLFKKD
    GQVVKQVAGVHTAEQIKAIIAELS

    >gi|307128112|ref|YP_003880143.1| thioredoxin family protein [Streptococcus pneumoniae 670-6B]
    MIQPASLEELASLVEKAGKKVFLFVADWCGDCRYIYPALPEIEETNPEFTFIRMDRDQYMDLAKLWDVYGIPSLVVLEKD
    KEIGRFVNRDRKSKEQINDFLAGLK