Streptobacillus moniliformis DSM 12112

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269122923|ref|YP_003305500.1| OsmC family protein [Streptobacillus moniliformis DSM 12112]
    MYITKGESIKGYEVSTETNGSVYNMDYKKLNPIGTSPVGLLNSALVGCIIMVIRSYFSIMGMDVKVEAISKLDGMNIEMD
    IKLDIEVSEAEIQRILAYVEEK
    CTVHKMISKEVKIIKNIRGI

    >gi|269123034|ref|YP_003305611.1| methionine-R-sulfoxide reductase [Streptobacillus moniliformis DSM 12112]
    MRKIYLAGGCFWGMQGYFNKILGVINTTVGYANGITSNTSYRELKKTDHVETLEIEYNSNLVRLEELLLRFFKLIDPLSV
    NKQGGDIGRQYRTGIYYVDPTDIPIINKVYDFVEKKIGSKLVVENEPLREYILAEDYHQNYLDNNPDGYCHINLNAVKDP
    VFYKIYTKPELNELRQKLSQLEFDISQNSATERPFTSEYEKFDEEGIYINVVTGEPLFISHDKFDAGCGWPSFTRPILTE
    TVNFYEDNSHGMNRIEVKSAKDLAHLGHVFTDGPKDKGSLRY
    CINGSILRFVPKSKLEEYGYGDYIVLF

    >gi|269123222|ref|YP_003305799.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptobacillus moniliformis DSM 12112]
    MYDLLVIGWGKGGKTLAGILANKGKKVAIIEKDPKMYGGTCPNVGCLPTKAMVHRAKILSEMELLGVERDYEFNNIIYQN
    ALSEKKKLVNKVNTANFNLLNNNENVTVYNGEAKFISNTEVMVNGEILTAKNIVINTGSKTRIPNIKGVESKHVLTSDDG
    LELEILPKKLAIIGGGFIGIEFASYFSNFGSDVTVFEGIDKFMPKEDIDISETIFNILVEQGINFNFGIKILEFNEVEDS
    IEIKFEKDGEIKSEIFDKILISIGREPNIEGLDLENTNITVSDRGEVVVNEYLETTVKGIYAVGDVKGGEMFTAVSLDDS
    RIILPQILGEKGRSLVSGRNVPKVLFIDPSYAQVGLNEKQATEKGIKYIVKKLATTAIPKSLVIGETDGFTKVLINENDE
    IIGAFIINYEAHEMINLLALAIDQKIKYQVLRDLIYSHPVFTEGLNDILK

    >gi|269123253|ref|YP_003305830.1| Redoxin domain protein [Streptobacillus moniliformis DSM 12112]
    MKVTMAGNPITLVGNQVKVGEMAPDFKALKGDLSEFKLSDYLGKKIILTSFPSIDTGVCAIQATKFNQEISKFDDAVLIT
    ISNDLPFALNRYCGANGINNAITISDHKDVDFGMKYGMLIEELRLLSRAVFVIDKEGKLAFIEVCEEIKNEPNYEEALKV
    LRSI

    >gi|269123482|ref|YP_003306059.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptobacillus moniliformis DSM 12112]
    MSKILKFDETIIYDTIIVGAGPAAVSAAIYAVRKGLKTAMIGEDIGGQILDTNEIENIIGVPLTNGFDYATELEKHMSEY
    EIYFYKGHRVKEIINDDKLKKIITDDNKEVLTKTIIISTGAKWRQLGIPGEKEYTGKGVHY
    CSTCDGPFYRNKDVIIVGG
    GNSGVEAAIEISNIAKSVVLVEYMDELKADKVLQDRLFTLENVKIYLSTGVTEIIGNEYAEISKLKNRHTSEEFELKMDG
    LFVEIGLSANSDLVKNIVETNKAGEILIDEMNMTSIPGIFAAGDCTNTKHKQIIIAMGEGAKAALSAFEYVIKN

    >gi|269123490|ref|YP_003306067.1| protein of unknown function DUF395 YeeE/YedE [Streptobacillus moniliformis DSM 12112]
    MEDRKNRRKEKPSQIPYALILVICLVGFGFYLKEPKLVAYWIFGVSFGIILQRSRFCFTAAFRDPVLTGGTSITRSVLWA
    ISLATVGFTAYKYVNQENAKILMTNVNAVSILTVVGAILFGIGMVIAGG
    CASGTLMRCGEGFQMQWLSLVFFIFGSIVGS
    WAMNYLEPATAAMSIKLFLPDLFGWVGALVVQFIIILSIYVIALKWQLKKIGSYE

    >gi|269123492|ref|YP_003306069.1| protein of unknown function DUF395 YeeE/YedE [Streptobacillus moniliformis DSM 12112]
    MQAYFKKIQKNPIYKRIMKDPLSYNTGATLLAVFAIAHFIFFNSTWGVTSTFAVWGAKIIKIFGLTPENWVYFQTHASQG
    KSILTPLLQDGGSIRNIGIILGATLATLFASEFRIKKIKNKKQVVAGILGGFLMGFGSRLALG
    CNIGALFSATAALSLSG
    WIFALFLLVGAIIGSKLLVKVFM

    >gi|269123493|ref|YP_003306070.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptobacillus moniliformis DSM 12112]
    MEKKRERYDVLIIGGGSSGLTAGIYCGRAKLKTLVFEKTLVGGLATYTSDIANYPGFPDGIGGTELMNLFHKQAKNFDVK
    FKLTDVKSVKLDTEIKEVETFRVIYEAPVVIIAGGGYPRLTGALNEDLFLYDKGISF
    CATCDAAANTDKTVMVVGSGDSA
    IEEGIFLTKFAKKVIVSVVHDEGIMDCNEIAKAEALANPKMEFIWNSMVKEYKGNEKLETVILKNTKTGEEIPVDVDTCF
    LFIGYLPNTSLYKEILDLSTKGYIVTNEKMETNIEGVFAAGDIREKYLKQVSTAVGDGAIAGYNAEKFISETNTFNNQIL
    NDGKETLVYLYDSSDIKMLDFLPKVEEHSKSINHELVKVDIYKSKFISNKLNIKEFPALVYLKDKKVVKIKYEL

    >gi|269123565|ref|YP_003306142.1| methylated-DNA/protein-cysteinemethyltransferase [Streptobacillus moniliformis DSM 12112]
    MLLKNIYNSPMGKILILVDEKRLKGLWFEDQKYFGAKYDISNIEFGENEVIQEVRYWLKKYFSGENPKVNINILSIEGTE
    FRKKVSEVLLSIPYGQTISYKRVSDILFEKYGMKTSARAVGGALGHNPISILIP
    CHRVIATNGLLTGYAGGISKKIELLI
    IEGFDKKFLESKI

    >gi|269123571|ref|YP_003306148.1| heavy metal translocating P-type ATPase [Streptobacillus moniliformis DSM 12112]
    MKREKFNITGMHCTNCSLNITKNIEKLEGIEKVNINLITSKMSVIYDEKIIDVEKIIEIVEKIGYGIEKINNKKNKENIE
    EIKKDYYIIKLVISIILTVLIMYLSMGHMLGFNKVNNSEIIQIIISISIMYLYKEYYFSGFLALKNNSSNMSSLIAVSTL
    ASFVYSIFNVIKGENNDLYFESIAVILTLVSIGKYIERRIKKNATKSITKMINLTPKKATIIKDGNEIVIDVGDLEIDDE
    VLIKTGEIISCDGIILEGKAYVNESSITGESKLIEKNVNDEVIASSILEKGYLKVRVNKEANDTIIAKIIELVEEATSSK
    APISKLADKISGILVPIIFVFSILTFIFWLVIGNEFSEAINRAISVLVISCPCALGIATPISIMIGNLKGSQMGILFKRA
    ELLEIIKKANIILMDKTGTITKGEPKVIDFISISDDDRVIKYIYSAEKKSEHHLATSVVTYCENLGINTVDIDEFIQVEG
    RGINAKIKNNELLIGNEKMMLEYNIDLSKYIDDINRYSKQGKTVILASINGSLVAIITIADEIREDVKITIEKLKNKNIR
    PIMLTGDNIETARYVAKLVGIEEVYAGLLPNEKYDILINLQENNKVIMVGDGINDAPALAKADVGISIGGSTDIAMEISD
    IVLMKQRLIDIINAINLSKAVIINIKFSLFWAFIYNIMGITLAMGLFVKFGLTLNPMFAAFAMSLSSMCILLNAMTLKLF
    KGENK

    >gi|269123579|ref|YP_003306156.1| thioredoxin [Streptobacillus moniliformis DSM 12112]
    MSKVLHLGATEQLGEILKKEKVVLVDFFATWCGPCKRLGPVLDELSEEADFPIVKIDVDQFPDLAGEYGVRSIPTLFVIK
    DGQKVATDLGFKTKEELTSLVKNNI

    >gi|269123580|ref|YP_003306157.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Streptobacillus moniliformis DSM 12112]
    MKVVVIGANHAGTATINTILGNYPDTEVVVFDRNNNISFLGCGMALWIGDQIDGSDGLFYSNKEKLEANGAKVYMETEVY
    DIDFENKIVYAKSKCGKEFAEKYDKVIVSTGSLPINLPIPGKELENVQYVKLFQNAAEVIEKLKNPEIKHVTVIGAGYIG
    VELAEAFERKGKKVRLVDSCSDCLSTYYDKEFRTRMNEKLASHGIELSFGEMLKEIKGTDGKVSSIVTDKDEYTTDMVIL
    CAGFRPNTDLLKEKVELFRNGAYLVDRTQKTSQEDVYAIGDCATIYDNSIDDVNYIALATNAVRSGIVAAHNVCGTKLEG
    IGVQGSNGISVYELNMLSTGLSEENAKRFGFEVETTTFTDNQKPEFMKTENDAVTVKIVYDKNTRRILGAQMASTLDISL
    GLHVFSLAIQEKVTIDKFKLLDIFFLPHFNKPYNYFTMTALGAK

    >gi|269123686|ref|YP_003306263.1| arsenate reductase-like protein [Streptobacillus moniliformis DSM 12112]
    MKYIHYPKCTTCQKVLKHLEKKGHVLEKRHIVEEKLTKDELKEIHEKSGLDIKKLFNTSGILYKEMKLKDKLDTMSLDEK
    LELLSTNGMLVKRPILICEDKVIIGYKKEDYDNI

    >gi|269123751|ref|YP_003306328.1| hypothetical protein Smon_0986 [Streptobacillus moniliformis DSM 12112]
    MKKIILILMTFITFSCVLAENNNIKIVNNKNYENVIKKENNIIVYATSWCPHCQEELEELSKIQDKLKDVKITVIMLPFI
    PTEDEFSNYEKETLEFINEKKYNFDFYLDKNKEILEKLNIQSIPSIGIIKDGNMIKEINEEEISSEKILEIFEK

    >gi|269123769|ref|YP_003306346.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Streptobacillus moniliformis DSM 12112]
    MRIVVIGGGAAGMMFSTQYKKMNPNDEIILFEKTPYVSWAGCPSPYYIANELPLKKVIGSPSDSFINKGIDVRINTKVSE
    INFDEKHVIVNNEKVTYDKLVLAIGAKSTLDIKKDRYFSLSHATDAIEIKNFIENKKPKKALILGLGFIGLEMVEALLLN
    NINVTVVEKANDVFNILPLEYRNILKEKIKNKNVELILGNGVKEFNEENVILENNEKIDFDMLIISTGITTKTEILGDKI
    ELLNNKIIVDNNFKTNIEDVYAIGDAILNKNIITNEYTYAPFGDVANKHGMMLAKLLSSKKSEFIGVTNTYATSFFDLKI
    AGTGLTEDVAISKGYNVGKVNMEVLTKNSGFKDSVPGSAEIIYDKDTNTVLGATIIGNEAVAQFIDQIAIVIRFRIKIDD
    LISVDFAYSPTNASVWNPLLVLYRKVIK

    >gi|269123886|ref|YP_003306463.1| peroxiredoxin [Streptobacillus moniliformis DSM 12112]
    MSLIGKRIPEFKVSAFKKGEEDFITITDKDVLGKWSVFVFYPADFTFVCPTELEDLQDNYENFKAEGAEVYSISCDTSFV
    HKAWNDHSPKISKVEYPMIGDPTGFLAREFGVMIEEEGLALRGSFVINPEGKIVAYEIHDNGIGREASELLRKLQAAKFV
    AQYGEVCPAKWKPGKETLKPSIDLVGEL

    >gi|269123970|ref|YP_003306547.1| dihydrolipoamide dehydrogenase [Streptobacillus moniliformis DSM 12112]
    MALEVIMPKAGIDMTEGEIVKWNKQIGEFVKQGEILLEIMTDKTNMELEAEEDGYLLAILRQPGETVAVTEIIGYLGEQG
    EAIPTAGGTQAAASEPVVEEKAAPVAKKENGYDVVVIGGGPAGYVAAIKASQLGGKVALVEKSELGGT
    CLNRGCIPTKAY
    LHNAEIIEGISHAAARGIMIENPKFTVDMEKVLAMKGKVVKTLVGGVGALLKSNGIEVFKGVGKITKDKNVMVDGVKELV
    TDKIILAGGSKVSKINVSGMDSKLVMTSDDILEMKEVPKTMAVIGGGVVGVELGQAFATFGSKVTIIEMMDRIVPSMDAE
    VSNALRTALEKKGITIMTSTKLQEIVETDGKLTVKLEGKQDLIVDKALLSIGRVPDLEGLGEVEFELERGKIKVDEYMET
    SVKGIYAPGDINGTKMLAHAAFRMGEVAAENALKGNHHVAKLDLTPAAIYTLPEVAACGLTEEQARERYDISVGKFSFTA
    NGRAIASDENYGFVKVIADKKYGEILGVHIVGPAAAELINEASSIMEMEITVEEMLKTIHGHPTYSEVMYEAFADVLGLA
    VHALKKN

    >gi|269123997|ref|YP_003306574.1| heavy metal translocating P-type ATPase [Streptobacillus moniliformis DSM 12112]
    MKYLICGIDCAGCASKLEEHLKNHENVKDLSINFATKSLSVDFNVESENNIDELVEYGRKKEKSFDIKIENKSEIQFLEE
    IEELKDQKIHMFISLALFIFAIFVDKYLYMYLRYDSELYLYYIPLYLFSYAIVAFPIIKDAIKSIKNGDCFNEKVLMMVA
    SLLAIFIREYEEATGVMLFYTLGEYFQEYSVLKSRKGIRSLIDLNDNKVHKLDEDKNEFVDVDVNLIKPGDIFYVKPGEK
    ILLDGKIYIGNAELDTSMITGESLPRHFEKDDEVLAGMINLTKTLAIEASKSFDESSIYKIVEMIENSGHNKSKMEKFVT
    KFSRYYTPIIFTLAIFITIVPPIFFRNISFMDSLYNGIVLLVIACPCALVLSIPLTFFSGIGRAAKEGILIKGADIFDNI
    DKIDSVFLDKTGTITEGKFKVNSVFEDLEKIDIDLKEVYEYIYKAEENSNHPIAKSIISFIDKKFGLVDNVENEERFYEY
    ISLCGHCGCCHDYSEHYNKQDIKIAEHEPKGHYYGDECKNHIKKIKDNGKYLKKQFSKNKKILEINEIAGLGLNVKFEDR
    ELLIGNKRILEDRNIYIPEISFIDDKNSSLVYVAIDNVFVSLFVIKDKIKEDTKEAIALMKKTKIKEVVMLTGDNLEAAK
    EVGNILGIDRIYSNLLPQDKLNILIKEKENKHILFVGDGINDAPVIAAADVGVAMGNMGQDITINTADIVLNTDSLTKIS
    VLKKISSKMKAIVFQNLLFIISIKLIIITFGVFSFMSMWFAVFADVGVTILTVLNAMRMRYIKL

    >gi|269124158|ref|YP_003306735.1| Redoxin domain protein [Streptobacillus moniliformis DSM 12112]
    MKKILAMFLLMLSTTFSFSGSLDYISFKDQAGQVKKISDYKGKTYIKMWASWCHICLATMPHTVELSKEKNLGFNVISVV
    SPGRNGELKENDFKKWFKDTGWTELTTLMDDKGELIKRARLRVYPTNVFLDSRGNIAKVIIGAMSSKRIKEEMSKIN