Stenotrophomonas maltophilia R551 3 uid58657

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|194363912|ref|YP_002026522.1| Rhodanese domain-containing protein [Stenotrophomonas maltophilia R551-3]
    MNYEELLAFAGRNPMLSAALVGLTVAIIVTEIRRLFRGFKGIKPAELTQLINAGGTVVVDLSASGDFEKGHIAGSRNAQA
    SAFGPDNKLVANAKQSPVVLV
    CRSGNASETAAKALKKAGFEKVYVLDGGIPAWQQAELPLVKGRN

    >gi|194364002|ref|YP_002026612.1| OsmC family protein [Stenotrophomonas maltophilia R551-3]
    MSIEKVLYTAQATSTGGREGRSVSSDNVLDIQLSTPRELGGAGGPGTNPEQLFAAGYSACFLGALKFVAGQAKVALPAET
    TVTGNVGIGQIPTGFGIEAELTINVPGVPREQVEDLVQKAHIV
    CPYSNATRGNIDVTLIVA

    >gi|194364218|ref|YP_002026828.1| methionine sulfoxide reductase B [Stenotrophomonas maltophilia R551-3]
    MTAFDLTPPTTTQTEALVAGLSSEERRVLLQHGTEAPFCGVFLDNKREGVYCCRLCALPLFRSSTKFDSGTGWPSFFAPF
    DPAHVREIRDTSHGMVRTEITCARCGSHLGHVFPDGPPPTYERH
    CLNSVSLSFTGNGEPWPDPLQRGGAESGVAG

    >gi|194364245|ref|YP_002026855.1| peptide methionine sulfoxide reductase [Stenotrophomonas maltophilia R551-3]
    MKLSFEQGIAAGVAGLVATALIAGVLLVDHGAVAAPLEASAQAKALPAPSGDAAFRDDATHASVVFAGGCFWGVQGVFQH
    VKGVSNAVSGYIGGSAANARYERVSSGQTGHAEAVKIDYDPRQVSYGQLMQVFFSVVHDPTQLNRQGPDQGSQYRSAIFS
    DDARQQAASRAYIAQLGQAGSYRAPIVTQLGSGQRFYPAESYHQNYMTNYPQAAYIRYYDAPKLAALGKQFPALYRREAV
    LVPMR

    >gi|194364246|ref|YP_002026856.1| cytochrome c biogenesis protein transmembrane region [Stenotrophomonas maltophilia R551-3]
    MLLLLLAYLGGALTLLSPCILPVLPFVFARADRPFLRSTLPLLLGMALTFTVVASLAAVGSQWVAQANQVGRWIALLLMA
    LFAVALLWPRLADHLLAPFQRVGARLSARADAADAAGRGGAWTSLLIGVATGLLWAPCAGPILGLVLTGAALHGASVGTS
    SLLLAYALGAITALALAVWVGGRVFRALQARLGLGDVLRKVLGVAALLAVVAIGLGWDTGLLTRLSTVSTARIEQNLLDA
    VPGAQPAAPPMMMMAGANAGADAPLPVEGTLPALDGATGWLNSPPLSAQQLRGKVVLVDFWTYS
    CINCLRAMPFVHEWER
    RYRDHGLVVIGVHTPEFAFERNPSNVMKAVQELKVEYPVALDNQYTIWRAFNNRYWPAQYFVDAQGNIRGHQFGEGNYAR
    SEQVIRRLLTEAGQTNLPPPADPAAADLKGVAVQADMSNLRSPETYLGHARAEQFASPGGQRSDSPFDYTLPTTLALNQW
    GLSGRWTVTDEAAQLQQAGGRIAFQFHARDLHLVLAPSQDGTPVRFRVWLDGKPLTAADAGSDVGADGSGVVNEHRLYQL
    VRQRGTVGPHRFEIEFLDTGVQAYAFTFG

    >gi|194364247|ref|YP_002026857.1| methionine-R-sulfoxide reductase [Stenotrophomonas maltophilia R551-3]
    MSLSRRHLLGLGGVATAAGLLGLGACSRAAPAAAEARPSRQFEVMRSDAQWRQQLTPAQYAVLRQQATERPYSSPLNKEH
    RQGTFACAGCALPLFSSSTKFESGTGWPSFWAPLHNAIGEDRDVTFGMLRVEVHCRRCGGHLGHVFNDGPRPTGLRY
    CMN
    GAAMVFVPGAPAGTADGWRVPVGSSPASGA

    >gi|194364319|ref|YP_002026929.1| protein disulfide isomerase precursor [Stenotrophomonas maltophilia R551-3]
    MLRFAIAAVFGALSLTACAQPAPPAAKAPATAAAAKAASPAANGSADQAVRAALTALNPGFEVDYIGAAPFPGFREVVVS
    GQLLYVSDDGRYLFQSQPYDTRAKGPANSEGLLGYRRDLLAKANHGDRIVFAAPNAKYTISVFTDIE
    CGYCRKLHQDIAE
    LNRNGISVEYLAFPRMGLGSKDYTDMISVWCAADRRQALTSAKRGGSVPAKSCTNPVAMQYALGQQLGVNGTPAIFAPDG
    TQLGGYLPPAQLRAALEKLSAKR

    >gi|194364462|ref|YP_002027072.1| methionine sulfoxide reductase A [Stenotrophomonas maltophilia R551-3]
    MLGIGQGILGIGAFKQRLPRPEEALPGRDQPLPLHSNQHFVNSHPLKDRFAGLQQIRFALGCFWGAERKFWTEPGVYSTS
    VGYAGGITPNPTYEEVCSGLTGHTEVVQVVFDPAVVSLERLLQLFWESHDPTQGMRQGNDTGTQYRSAIHATDEAQYAAA
    LASREAYQAQLDAAGYGPITTEIVYPAPEYYYAEDYHQQYLAKNPNGYCGIGGTGVSCPIGLDVEAPR

    >gi|194364466|ref|YP_002027076.1| alkyl hydroperoxide reductase subunit F [Stenotrophomonas maltophilia R551-3]
    MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLQTLDSLSDKITLQVLRDGQGRVPSFDLGTPGQDIHLTFAG
    LPMGHEFTSLVLALLQVGGHPSKATAELIEQVQNLEGEYKFETYFSLS
    CQNCPDVVQALNLAAVLNPRIQHVAIDGALFQ
    DEVEKREIMSVPTVYLNGEVFDQGRMTLEQIVAKLDTNASKRDAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
    AAERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYEVDIMDLQRASALVPAGEDGLVQVQLENGAVLKSRSVILS
    TGARWRQMNVPGEDQYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSHVTLLEFDSSLRADEVLQKKLR
    SLANVTVLTSAQTTEVLGDGSRVTGLVYKDRVGGDAHRVELEGIFVQIGLLPNTEWLKDTVALSPRGEVVIDDRGQTNLP
    GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSSVSSSSGAVAEAA

    >gi|194364467|ref|YP_002027077.1| peroxiredoxin [Stenotrophomonas maltophilia R551-3]
    MSLINTQIQPFEANAYLNGEFIKVSDSTLKGQWSVLIFMPAAFTFNCPTEIEDAADHYAEFKKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLVGDPTHQLTNAFGVHIPEEGLALRGTFIINPEGVIKTLEIHSNEIARDVSETLRKLKAAQFTAA
    NPNQVCPAKWKEGEKTLTPSLDLVGKI

    >gi|194364495|ref|YP_002027105.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stenotrophomonas maltophilia R551-3]
    MTRKTPLPLLLPLALLLALSACKPAQEPTPASSQPPAQAPTPTTPAPVEETPAERTTAEFPTLRMKAVDGSDYDLAAHRG
    KWVIVNFWATW
    CAPCRKEMPELSALHAMRSNIEVVGLAYEDIEVPEMQSFLAKHPVTYPIVIVDPFDPPADFATPRGLPL
    THLLDPQGKLAHSFLGPVTAADIEKQIAAAK

    >gi|194364560|ref|YP_002027170.1| disulfide bond formation protein B [Stenotrophomonas maltophilia R551-3]
    MNPLRWPFRAQFFLGFLICAGLLGYAIFLQLKMGLEPCPLCIFQRLAFAALGLLFLIGALHGPSNRPGRATYGVLAFIAA
    AVGVGIAARHVYVQMLPPEMGAT
    CGPPLAFLSETMGPLEVFRTVLTGTGNCGNIDWTFLGLTMPMWSGVWFLLLALWALV
    VSLRKVKR

    >gi|194364573|ref|YP_002027183.1| Glutathione S-transferase domain [Stenotrophomonas maltophilia R551-3]
    MKLYSKPGACSTADHIALQWTGQPFEVELLNKDTLKGPEFLKINPAGAVPALVDGDFVLLQNAAIMGYIADSFPQAGLGG
    DGSPRQRAEATRWLAFVNSDVHPAFSPLFAPGKFIADESQFDAIRAAAHKRLRGLFETADKQLADKAWLAGFRSFADPYF
    YITLRWAAGTKVDLSGLDNLAAYKARMDADAGVQAALKAEGLA

    >gi|194364604|ref|YP_002027214.1| glutaredoxin 3 [Stenotrophomonas maltophilia R551-3]
    MTAQTAGGAPAITIYSTAVCPYCVAAKNFLKSKGQQWTEVRIDLDPVEREKMMARTRRTSVPQIFVGDVHVGGYDDMMAL
    HREGKLEPLLAGQGQA

    >gi|194364605|ref|YP_002027215.1| alkylhydroperoxidase like protein, AhpD family [Stenotrophomonas maltophilia R551-3]
    MSAADDGSKDRIAEFTDFRKRMNERILGEPNQVVRRFFALDTQTYQAGALDVKTKELLGLVASMVLRCDDCISYHVAQCK
    DAGVTREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLEGGAAAPEAHAH

    >gi|194364786|ref|YP_002027396.1| OsmC family protein [Stenotrophomonas maltophilia R551-3]
    MGISRHATAHWEGDLKSGKGQLSTPQSGLLDKTRYGFNSRFGDEKGTNPEELIAAAHAGCFTMALSAKLGEAGFTPTSLD
    TEAKVDLSLEGGPQLSQIRLKVKAVVPGIDAGQFRAIADDAKQN
    CPVSKALSAVPISLEAELG

    >gi|194364996|ref|YP_002027606.1| methylated-DNA/protein-cysteine methyltransferase [Stenotrophomonas maltophilia R551-3]
    MTLLFDRFDSPIGVLTIAGDERGLSHVLFPENRHPARGRDDWHYAPDALPEAREQLLQFLHGERSSFDLELAPRGTPFQL
    RVWQALALIPFGQTWSYLQLAQHLGQPSATRAVGAANGRNPLPIILP
    CHRVIGSNGALTGFGGGLETKAALLRLEQRQAP
    LFA

    >gi|194365055|ref|YP_002027665.1| arsenate reductase and related [Stenotrophomonas maltophilia R551-3]
    MAMSTTVYGLKNCDTCKKATKWLDRFGVPYTFVDYRDNKPSPETLLAWAAQLGGLAAMVNKSSTTWRQLPDNRKAADSEA
    EWKLLLREYPQLIKRPLVVTADGTVSQGFSDNGFKARFGVGDA

    >gi|194365097|ref|YP_002027707.1| Rhodanese domain-containing protein [Stenotrophomonas maltophilia R551-3]
    MKPIDPPWTTLVDVATLAAVLGEGVRVVDARATASTAVRVVDARSSLADPQAGSGQYLAGHVPGAVYADLNRDLSDLTRS
    DHGRHPLPDSDAFAAKLGQWGIGPDTQVVVYDGSDGSMAASRLWWLLRLIGHSKVAVLDGGIAAWQAAGHALATGQGEVT
    ALPAYPGRFDTTQIANADEITARLKHAPGWLVDARAGERFRGEVEPLDPVAGHVPGAVNRPFALNVVDGHLRDAQELRAE
    LQGVIGNRDPQQVVLM
    CGSGVTACHLLLAMEAAGLSGARIYADSWSGWVSDSTRPVASGA

    >gi|194365142|ref|YP_002027752.1| Glutathione S-transferase domain [Stenotrophomonas maltophilia R551-3]
    MAASVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVSFDFVPVDPQNPPEDLIDLNPYHSVPTLVERELVLYAASVVSEYLD
    ERYPHPPLMPVDPLSRARIRLAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASLPLFKASKFFLNPEMSLADCA
    MAPIIWRLQSLDVPLPKDGKAIEDYGNRIFRHPGFIRSLTDQEKKLRDLPV

    >gi|194365150|ref|YP_002027760.1| alkylhydroperoxidase like protein, AhpD family [Stenotrophomonas maltophilia R551-3]
    MLDWNAYRKELKGRIGEIGKLSPDTVKGYATLANAGAQTNHLDAKTRELIALAVAVITRCDGCITVHVDAALKHGASREE
    IAEALGVAVSLNAGAALVYSARVMDAVAGHESA

    >gi|194365152|ref|YP_002027762.1| glutaredoxin-like protein [Stenotrophomonas maltophilia R551-3]
    MAVMQQIQAEVDRYPLVLFMKGTPQYPMCGFSSRAVQALMAAGAVTLRTVNVLEEPEIRANLPRFSNLPTFPQLFINGEL
    IGGCDIVMELFEAGELKRIVEEATQG

    >gi|194365167|ref|YP_002027777.1| Redoxin domain-containing protein [Stenotrophomonas maltophilia R551-3]
    MLKRVLFPVVALLLSALILVLGWQNRQLRQINDDMAAQLQNMRVEAHGAAIGARPEPLALKTTQRAHVDIGGTRALPQIL
    YFFSTA
    CRYCLASMPQLQSIDAARGPSELVGVGLPPYEALADYAGKHSMRFPIAIDSEGDAAKRYGITVTPMLMVLATDG
    SVAYKHVGQLDENTVKAAIKALTPDVTLP

    >gi|194365287|ref|YP_002027897.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stenotrophomonas maltophilia R551-3]
    MNNGDTLDSTTLSLPLALSGGEQATLGDYAGQWLVLYFYPKDSTPGCTTEGIDFNALLPKFRKAGAVVLGVSRDSVKSHD
    NFCAKQGFSFPLVSDGDEALCSAFDVIKMKNMYGKQVRGIERSTFLISPDSRIVQSWRKVKVAGHADAVLAELKASQSK

    >gi|194365399|ref|YP_002028009.1| HI0933 family protein [Stenotrophomonas maltophilia R551-3]
    MSAIRCDVVVIGAGAAGLMTAITAGQRGRQVQVIDHANKIGKKILMSGGGRCNFTNTGTTPANFLSANPHFCKSALARYT
    PWHFIELVNKHGIAYHEKELGQLFCDISSKQIVKMLVDECQTAGVQIRTQCSVERIEHGTDGFRVHTTQGLFHCASLVVA
    TGGLSIPSLGATGFGYEIARQFGHQVLPTRAGLVPLTLSGKHQERLADLSGVALPIEARCNGKSFQNFMLLTHRGVSGPA
    ILQISSFWQPGDALELDLLPGQDAGDWLRQMKQERPAAELRTVLGEVLPKRLAQRLCEHWLPDRPVRQLDEPVLRQAAQL
    LGAFPLVASGTEGYRTAEVTLGGVDTAEVSSSTLESKRVPGLHFVGEVLDVTGWLGGYNFQWAWASGHAAGGVV

    >gi|194365405|ref|YP_002028015.1| hypothetical protein Smal_1627 [Stenotrophomonas maltophilia R551-3]
    MDTDSPRFDNRLLHMLPGDPESGPRRREVLGAAWSPVMPTPVTAPTLLAWAPDVAEMLGFDTAEVESEGFAQVFGGNALY
    AGMQPWAANYGGHQFGHWAGQLGDGRAISLGELVAPDGRHWELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHHLG
    VPTTRALSLVGTGEDVMRDMFYDGHPRAEPGAIVCRVSPSFLRFGSFELPASRGETALLQQLVDACIARDFPELEGEGET
    LYGDWFAQIAVRTAEMIAHWMRVGFVHGVMNTDNLSVLGLTLDYGPYGWVEDFDPDWTPNTTDAQGRRYRFGTQPQVAYW
    NLSRLAQALSPLFADVAPLQAGLAAYQSTFVACTRRDAAAKLGLAAADDDDLQLYLRWQQLMQDGAMDMTLAWRALMRLD
    PAAPDAALLDAVYYDEARQQAVQAPLQHWLQDYAARLQADPLSASERTAKMAAANPLYVLRNWLAQEAIDRAEQGDLGGV
    HALQDVLRDPYTERPGLEHFAGKRPSWADNRAG
    CSMLSCSS

    >gi|194365444|ref|YP_002028054.1| molybdopterin biosynthesis protein MoeB [Stenotrophomonas maltophilia R551-3]
    MSIQELSPAQARERLTHGAVLIDVREAHERAGGMAEGARGVAKGELQADPAAHLPKHDQEILLICQSGKRSADAAQFLLE
    AGYTHVASVSGGTVAWREQSLPLAQPLTSAADSDFYDRYSRHLLLPQVGEAGQRRLQQSRVLVLGAGGLGAPAGFYLAAA
    GVGHLRFADHDRVERSNLHRQIVHTEASVGQLKVDSARERLLALNPSIEVEAVPERVTSENVDALLEGVDVVLDGSDNFP
    LRYLLNDACIKHAKPLVYAAIERFDGQVSVFDAGRQRGVAPCYRCLFPEPPPPEFAPN
    CSEAGVLGVLPGLAGVLQATEV
    LKLLLGIGEPLVGRLLRFDALGMRFRETGIRPDPHCPVCAPGVPFPGYIDYAAFCRGG

    >gi|194365492|ref|YP_002028102.1| ArsR family transcriptional regulator [Stenotrophomonas maltophilia R551-3]
    MNAATEPPPSPLEALAEIARTLGHAHRLALLEHIAQGERAVERLAELTGLSVANTSQHLQQLRRAGLVQTRRDGKRILYR
    SGDGPLGNLMAALRDYADHQRSEMHDVIADSVLRRDALDGLTVEQLLQQRDNVVLLDVRPQEEFALGHLPGALNIPVTEL
    RARMDELPRAVHIVAY
    CRGPYCVLSNDAVAMLREAGLTAQRLAAGYPEWKAAGLQVDLPQH

    >gi|194365520|ref|YP_002028130.1| hypothetical protein Smal_1743 [Stenotrophomonas maltophilia R551-3]
    MNLPWTAVAGGALIGAAAVLLLATVGRVAGISGIAAGSLRAAEGERGWRWAFLLGLLTAAGLVLWWQALPEASPRVLLRD
    ALPAWQLICAGLLVGFGTRLGSG
    CTSGHGVCGMARGSKRSLLAVLVFMACAMLTTFLIRHGGGLA

    >gi|194365547|ref|YP_002028157.1| heavy metal translocating P-type ATPase [Stenotrophomonas maltophilia R551-3]
    MSTPRAIAAPASPSTISLSIEGMTCASCVGRVEAALSKVEGVGSVSVNLATERADIRASGPVDRAALIQAVERVGYDVPA
    ATVELAVEGMT
    CASCVGRVERALLAVAGVNQASVNLATERATVRGVAAVDALVAAIDKVGYAARAIEAGVQSDDEAAEKK
    DAERAELKRDLIVATALALPVFVLEMGSHLIPGMHEWVMANIGMQTSWYLQFVLTLLVLAIPGRRFYQKGFPALLRLAPD
    MNSLVAVGTAAAFGYSVVATFAPRLLPPGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVNLQAKVAHVIRDG
    RTIEIPVNEVLSGDVVEVRPGERVPVDGEVIEGRSYIDESMISGEPIPVEKQPGSSVVGGTVNQKGALTVRATAVGAQTM
    LAQIIRMVEQAQGSKLPIQAVVDKVTLWFVPAVMLAALATFLVWLIFGPSPALSFALVNAVAVLIIACPCAMGLATPTSI
    MVGTGRGAEMGVLFRKGEALQLLKDAQVVAVDKTGTLTEGRPRLTDLEIADGFDRATVLAAVATVESRSEHPIARAIVDA
    ATEQGLALPSMIDFESVTGMGVRASVESARVEVGADRFMRDLGVDITAFAALAAELGAQGKSPLYAAVDGRLAAIIAVSD
    PIKPSTPAAIAALHQLGLKVAMITGDNAGTAQAIARQLGIDEVVAEVLPEGKVEAVRRLKATHGHVAFVGDGINDAPALA
    EADVGLAIGTGTDIAVESADVVLMSGNLQGVPNAIALSKATLGNIRQNLFWAFAYNTALIPVAAGVLYPVWGVLLSPVFA
    AGAMALSSVFVLGNALRLRRFQAPMADVPAASH

    >gi|194365709|ref|YP_002028319.1| thioredoxin reductase [Stenotrophomonas maltophilia R551-3]
    MSTSLPSRHQRLVILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMARMQAHAERFE
    TEVIFDHIHTADVSQRPFKLIGDSHEYTCDALIIATGATAKYLGIPTEDELKGRGVSA
    CATCDGFFYRDQDVVVVGGGNT
    AVEEALYLSNIARKVYLVHRRDTLKAEKIMQDKLFAKVAAGKIETVWHHQVEEVLGNEAGVTGVRVKSTLDGTTRDIDAH
    GFFVAIGHHPNTQLFDGQLAMNNGYLEIRSGLGGNATQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDAQG
    KAS

    >gi|194365754|ref|YP_002028364.1| arsenate reductase [Stenotrophomonas maltophilia R551-3]
    MNAVIYHNPKCGTSRNTLALIRFAGIEPDVIDYLANPPSRARLVELITAAGLSVRDAIRQKGTPYDELGLGDGALSDDAL
    LDAMLAHPILINRPLVQTDRGARLCRPSEVVLEILPPLPGPFRKEDGELVIGRAESSTP

    >gi|194365759|ref|YP_002028369.1| thioredoxin reductase [Stenotrophomonas maltophilia R551-3]
    MSTTRHIPLLILGSGPAGWTAAVYAARANLNPVVITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMARMQAHAERFETEV
    IFDHIHTADLSQRPFRLIGDSHEYTCDALIIATGATAKYLGIPTEDEFKGRGVSA
    CATCDGFFYRDQDVVVVGGGNTAVE
    EALYLSNIARKVYLVHRRDTLKAEKIMQDKLFAKVAAGKIETVWHHQVEEVLGNEAGVTGVRVKSTLDGSTRDIDAHGFF
    VAIGHHPNTQLFDGQLAMNNGYLEIRSGLGGNATQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDALKISD
    QQQHKNAA

    >gi|194365771|ref|YP_002028381.1| OsmC family protein [Stenotrophomonas maltophilia R551-3]
    MTELKPPSPAMLDRYQGDDVQPLYTGRVRVSGGQAQHGRASGVVRSDDGALAVDLRLPPELGGRGGGSNPEQLLAASYAG
    CFHGAMVLVAARAGLLLHNPSVEVEVTFARDPADGLYLLSAEIVVHLPGMDANVACELVRNTERV
    CPYAKMFHRGISHVV
    HVRVGPQGAPL

    >gi|194365927|ref|YP_002028537.1| hypothetical protein Smal_2150 [Stenotrophomonas maltophilia R551-3]
    MSRVPLIDASATTADREALLGQVHAAFGATPAMFRAVANSPAALQSMWGSFGALGGGRLSPLLGEQIAVAIANHNACGYC
    LAAHTALGRKAGASSEQMAAAQIGQSSDPATSAALDFALKVVEQRAQITDGDVQALRAAGFDDEQIVEILAHVALNLFTN
    YVNVAFDVPVDFPKVALR

    >gi|194365952|ref|YP_002028562.1| Thioredoxin domain [Stenotrophomonas maltophilia R551-3]
    MSFMRDHLLTEPTSAEVEAQAGWQLLEFGTAWCGHCQAAQPALRAFVEANDLPHRKIEDGKGKPLGRAFKVKLWPTVVLL
    RNGEEIARVVRPLNSADLMSLQSALPG

    >gi|194365970|ref|YP_002028580.1| OsmC family protein [Stenotrophomonas maltophilia R551-3]
    MAYARIVSTGDNYLHHISNGSFDVDADEPASLGGQGKGFAPFDLYLASLAACTAITLRMYAQRKGWELGEFHAELRSERD
    ADGRLHVHRVLHASAELSDAQWQRLLEVVEKTPVTLVMREGARITSERG

    >gi|194366057|ref|YP_002028667.1| Thioredoxin domain [Stenotrophomonas maltophilia R551-3]
    MLPMRVALSVLLLASALSACTPAPVSTANSAEAPAPASAIAWRQGDVDDAFAEAADSGKPVLLYWGAVWCPPCNQLKAGL
    FKDPAFIALTSKFVPVYLDGDEEGAQAWGERFGVRGYPTLIVLDPQRNEITRVAGGNDAAELTRALTVAAGRRSAVAATL
    ATALATPDRLAAEDWQVLGDYGWEVDANRLAGERRSQDVLRQLSKAAPDAALQRRFALLALATAEKPDASPVRELLQAVL
    AQPAEVRRNRELLGYAGVQLVKQASAGPATSNTLGRQLLVALERADAERGDRADDALSRALTEVSLARQQQPKGALPPAL
    VERVKQRVGAADAAATDAHARQATISSAVYALREVGDDAGAEALLLAELKRSEQPYYYMPELAELAEQRGDAAGALEWLK
    RAYDGAQGPATRVQWGVLYVEGLLKLAPDDAPRIEQATASLIAELEAQPSGYHQRTRQRFERLAGQLKAWSGKHQGAETL
    ARLQQRMQQACGDQVDGACKDWLS

    >gi|194366066|ref|YP_002028676.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stenotrophomonas maltophilia R551-3]
    MRSKPLRALLLACAVLLAAPAMAADLHAQVSASLMRPEQRSLRPMQWSSPPKLVALYFGADWCAPCHAFVPTLRSVRDAL
    REAGADTEVVYVSLDESEAALRRYMHAQEMPWPVLDPRRAARMPALQALAGLAPPNLVLIDADGKVLANGWQGRRYEGLQ
    PVLKEWTKQACAQQQAHCPNAGIQSR

    >gi|194366069|ref|YP_002028679.1| Thioredoxin domain [Stenotrophomonas maltophilia R551-3]
    MQIIDATTPEQFQQLLAEHPRVLVDFHKDQCPGCRMLEMSLHRVANSVAGQGTTLLRVQLEVLGEAFFRELGLRQTPTLL
    LFRDGDERTRLAGFQSPQQIEAAIALHL

    >gi|194366172|ref|YP_002028782.1| thiol:disulfide interchange protein [Stenotrophomonas maltophilia R551-3]
    MLSTSLRTVPAVLLLPVMLALAACSQAQTPPGKTAAAPAASAAVSAVKGDRPAVLKGIEKHGFEVVAEFDAPGGLRGFAG
    VVGGQQPAAAYVTADGKHVLVGSLFDAEGNDVAAEAVEKLVAQPMSAKMWTKLEASAWVRDGKADAPRVVYTFSDAN
    CPY
    CHKFWEAARPWVDAGKVQLRHIMVGVIREDSPAKAAAILAARDPSAALLQNEHEFDRGGIKPLPSISREIAGKLDANQVL
    MLEMGFQGTPGILFQDAQGQVQRRAGLPQGADLQTVLGPR

    >gi|194366173|ref|YP_002028783.1| Redoxin domain-containing protein [Stenotrophomonas maltophilia R551-3]
    MSSVGPVPMPVVLILACVLLAMAVAHLWPRRKDGGPLPSAASMVLDMLLIGLLCGRISFVALNLALYREAPWSILQIADG
    GYHLPVVLVAGLAWGLWRLRRWRALRAPVLVGALMGVLLWAGGSQMLSAWQERQMPLPTLQVADLQGGKVDLQQFRGKPL
    VLNLWATW
    CGPCRREMPVLAAAQQAHADVQFVFLNQGETLGEVQGFIAGERLMLGNVLLDDDAAASTVLGVQAYPSTLFF
    DAEGRLRELHLGELTAAGLEHKLRRLR

    >gi|194366364|ref|YP_002028974.1| iron-sulfur cluster assembly accessory protein [Stenotrophomonas maltophilia R551-3]
    MAVSLTPIAFERVQRFVAQTPGALGLRFGVTKTGCSGWGHVTDLARDERADDTVFDQDGVKIYVDAKSLALVDGTVIDFG
    KHGLSETFTFSNPNATAECGCGESFTTDADKA

    >gi|194366391|ref|YP_002029001.1| glutathione peroxidase [Stenotrophomonas maltophilia R551-3]
    MPLPTVSSRRLRGLSLLVLMVAGAAGSGSALAADLLDLDYRPLAGKQQVNLQQRYQGQVLLVVNTASKCGYTPQYEGLEA
    LQKRYAGRGFAVLGFPSNDFKGQEPGDEKQIQDFCTLTYGVKFPMFEKVHVVGAQATPLYQRLSAATGVAPAWNFHKYLV
    GRDGKVIAQFASKVTPDDAQLTAAIDKALAAAATH

    >gi|194366405|ref|YP_002029015.1| dihydrolipoamide dehydrogenase [Stenotrophomonas maltophilia R551-3]
    MAEQFDVVVIGAGPAGYHAAIRAAQLGLKTACIDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHIFGDHGIS
    FKDAKMDVEAMVGRKDKIVKQFTGGIAMLFKANKVATYYGFGELQPGNVVKVKQHDGSEVELKGTNVIIAAGSDSIELPF
    AKFDGDTIVDNVGGLDFTEVPNRLAVIGAGVIGLELGSVWKRLGAEVTILEALPEFLAVADAEVAKTAAKEFKKQGLDIR
    LGAKVSKTEITGKGKKKEVVVTYTDSEGEKTLTVDKLLVAVGRRAATKGLLAEGTGVKINERGQIEVDAHCHTGVNGVWA
    VGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPELAWVGKTEAQLKAEGIPYKAGSFPFAANGRAVAM
    IEPAGFVKILAHAETDRILGMHLVGANVSELVHEGVLTMEFSGSADDLARICHAHPSLSEVIHDAAMAVSKRAIHKAN

    >gi|194366425|ref|YP_002029035.1| arsenate reductase [Stenotrophomonas maltophilia R551-3]
    MDVTIWHNPACSNSRGALKLIRDAGFEPEVIEYLGNPPDVATLRQVLAESGLDAQALVRSKEAQFTELGLEDADEATLLA
    AMAEHPRLINRPVVRTPKGTRLCRPPETVLEIL

    >gi|194366430|ref|YP_002029040.1| alkylhydroperoxidase like protein, AhpD family [Stenotrophomonas maltophilia R551-3]
    MSDHASPRVPYTRLAAEAFKGLLATSQAVHDSSIDPTLMELVFLRVSQLNGCGYCMDMHATTLRKGGIEPRKLDTLPAWH
    ESRFFDARERAALGWAEALTRLTDGAPSQAAFDALAPHFDEKGISDLSMGIAVINAWNRLGAGLLPPLP

    >gi|194366433|ref|YP_002029043.1| Glutathione peroxidase [Stenotrophomonas maltophilia R551-3]
    MTTAYDFSFRDLDGQPQALARYQGHPLLLVNVASRCGFTPQYTGLEQLWQEYRERGLVVIGFPCNQFGAQEPGDAAQIRQ
    FCSLDYPVSFPLSEKIEVNGEGADPLWAWLSREKRGLLGSARIKWNFSKFLVDRQGQVVSRHAPTTRPEQLRGEIEALL

    >gi|194366478|ref|YP_002029088.1| periplasmic protein thiol/disulphide oxidoreductase DsbE [Stenotrophomonas maltophilia R551-3]
    MSESPAPRPSRPLPPVAIVIGVLFFFGLLGLMIYGVMKSGDPQRDVLPSALIDKPAPAFALPVLHDPEMIVHSDELRGAP
    YLLNVWGSW
    CAACREEHPVLTRFAESKRVRVIGYNWKDEPTDALHWLEQLGNPFMVVLSDIEGRTAIDWGVTAAPETFLV
    DGSGIVRWKYSGAMTQRVVDEKLIPALEKIEKAQGNAGNTLHTAP

    >gi|194366545|ref|YP_002029155.1| AraC family transcriptional regulator [Stenotrophomonas maltophilia R551-3]
    MPCLRPANTPFPGLTDECRKRSFRSTGTCQNPAMDSTAAATLDARVERVCRHLQTSLDEPSLQELADIAGCSPTRLHRLF
    KQATGLTPKQYAAALRADRLRTGLEQQERITDAFHDAGFGSSGRFYENAPKLLGMTPKQWRAGGRGEVIHFALAESSLGS
    VLVASSGTGVVAILLGDDPETLLQSLQQRFRQAELVGADQDYEQLVAQVVGLVEDPSRGATLPLDIRGTAFQQRVWQALQ
    QIPRGQTASYADVAARIGAPRSSRAVARACASNPLAVAVP
    CHRVVRRDGDLSGYAWGVARKRELLRREKAANG

    >gi|194366656|ref|YP_002029266.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Stenotrophomonas maltophilia R551-3]
    MSTAPYDYDLIVLGGGSAGLAGAIRAAQHGKRVAMLEPGELGGTCVNVGCVPKKAMWLAADLHERIGLASAMGFDVKARP
    ALSWKELVIHRQAYISNIHTSYHKRLDETGVVRIPARGHLLDAHTVACSDGVRYSAEHILIATGAHPLRPDIPGAELGLV
    SDDFFDLRAAPAEVAIIGGGYIAVELAGLLQALGSRVSLLVRGKRLLERFDYELTDQLAENLKQQGVRIHFNYRLRELQR
    DGERVRAFGHDGPLDNVFDAVFFATGRRGNSRDLGLEALGIGIGEHQQVQVDEWQTTSVPSVHAVGDIAGKVGLTPVAVA
    ASRRLMDRLFGGRPQSKMDYENVASVVFSHPPLGAVGMSEEDARAGFDQVSVYHSRFRPMLQALANGTQRSLFKMVCAGP
    EERVVGIHLLGEAADEILQGFAVAVKMGATKAQFDDTVAIHPTSAEEVVLMR

    >gi|194366686|ref|YP_002029296.1| thioredoxin [Stenotrophomonas maltophilia R551-3]
    MTETTYVFDATTATFEAEVLQKSLQTPVLVDFWATWCGPCKTLGPMLEKLAAEYNGAFELAKVDVDAEQQIAAAFQIRSV
    PTVFLVKGGQLVDGFPGAIPEGQLREFLAQHGVVPADVGNTITEDEAPLDPQAQVDVLRAQIAAEPDKDELRLDLALALL
    QIGGVDEAATLIDGLPANLATDDRAVRGRARLAFAAALKDAPAAEVLEARIAADGKDLKARHLRGVQLLLGGHDEAALEQ
    FLEMLRIDRSFEEGLPRKALIDAFNVISDEDLVGRYRRRMASLLF

    >gi|194366741|ref|YP_002029351.1| DSBA oxidoreductase [Stenotrophomonas maltophilia R551-3]
    MRIDIYSDVVCPWCWIGKHRFQQGVQLLGADAPELDIHWQPFQLDPDADATPVPLREAYVRKFGGVERTEQILGQTQTTA
    RAEGLPMDFGQGQVRVTTLPAHRVLWLAGQHGVQDAVGEALFRAHFEHGQNLADPSVLIKAGVAGGLDAGEIAQMLASDR
    GLAEVEAKLAQAHALGISSVPTFVIDGKWAISGAQPPEAFANALRQIAAEQGAPAASADGDEACGPDGCKV

    >gi|194366792|ref|YP_002029402.1| Redoxin domain-containing protein [Stenotrophomonas maltophilia R551-3]
    MTIHVGDRIPEVTLKRIREGIETLDTHSLFDARKVVLFAVPGAFTPTCSARHLPGYVEKFEAFRQRGIDVYCVAVNDPFV
    MKAWAAEQDVPAGLMMLSDGNAELTRALGLELDASASGMGIRSRRFALYVVDGVVRAAWIEQPGQFEVSSAEYVLEHLPT


    >gi|194367039|ref|YP_002029649.1| selenide, water dikinase [Stenotrophomonas maltophilia R551-3]
    MATHAQSPAPSTADAPQRLTSLAHGGGCGCKIAPGVLTELLRGVPALPAPVELLVGRETSDDAAVYRLDDHQAIVATTDF
    FMPIVDDPFDFGRIAATNALSDLYAMGARPLFALAIVGMPINTLPQDTIRGILQGGERACANAGIVVAGGHSIDSVEPIY
    GLAAIGVLDPQRLKRNADARADDVLVLGKPLGVGVYSSALKKEVLDAEGYRQMVESTTRLNSVGMPLAALDGVHAMTDVT
    GFGLLGHLLEVCRASGVAAEVDSAQIPLLPQTLDLLQRGCVTGASNRNWASYGAEVRFAEGTAAHWQPLLTDPQTSGGLL
    VSCAPEAVDAVLACFHDAGFGQAAVVGRLSEGAPGVSVV

    >gi|194367142|ref|YP_002029752.1| glutaredoxin-like protein [Stenotrophomonas maltophilia R551-3]
    MSLDPALRSRIETILNDNRVVLFMKGQPSMPQCGFSAKAVGALQDLGVEFAHVNVLADQEIREGIKAYGDWPTIPQLYID
    GELVGGSDIVLQMAASGELSSVLGLAAPDRTPPSITVTPAAVEMLKGALADAPGAALQLSIDAGFQPNFQLAPHDEGAIA
    AESNGLRVQFDLASARRANGITIDWVDDIRGKGLAIDNPNAPKPVQEISVRDADDLVRAGNITLVDVRPADERAIAAVGV
    PFKSFDGNGRAELEALPKDTALAFM
    CHHGGRSAQAAEQFRALGFTKVFNVTGGINAWSEDVDNGVPKY

    >gi|194367176|ref|YP_002029786.1| DSBA oxidoreductase [Stenotrophomonas maltophilia R551-3]
    MRLISRLLLSLLVLLPLAASAATPANAPLVEGKDYERIAQPGPFQPLAGKIEVVEVFGYTCPHCAHFEPQLEAWAAKLPA
    DVRFTPVPAAFGGAWDAWALAYYAADQVGVAKRSHAAVFKALHQDGSLPMQNVSADELANFYKAYGVTPDRYIQALRSDA
    VQKKVDAARAFAQRTKIPGTPAIIINGQYLVRGNSFDDQLRIASALIAQARAARGR

    >gi|194367177|ref|YP_002029787.1| DSBA oxidoreductase [Stenotrophomonas maltophilia R551-3]
    MKIRYALALAALLPILAACKADDGSTNTTAAPAEPTATPATTEPAAPAAGSEGAAPAAEGDKAPAEAAPAAAPAPTTAAL
    TGPAPVEGADYQVIPNGQPFQPAAGKIEVTEIFGYV
    CPACAAFQPLVGPWKAGLPSDVNFVYVPAMFGGTWDNYARAFYA
    AQTLGVQDKTHEALYAAIHSQKTLKGERGTDSVDDIAKFYGAYGVDPKQFAATMGSFAVNAKTNSAKQFAQRSQISGTPS
    IIVNGKYLVKGKSFPDMLRIADHLIARERGAAQAH

    >gi|194367292|ref|YP_002029902.1| dihydrolipoamide dehydrogenase [Stenotrophomonas maltophilia R551-3]
    MATIEVKVPDIGDYSDVPVIEVLVAVGDTVKKDQGLVTLESDKATLEVPSSATGVVKEIKVKLGDTLSEGAVVVVLDAEG
    AAEAPAKAAAPAPAAAAPASKPPVTPSHRAPAEPAAPKPALSSGKQADIECEMVVLGSGPGGYTAAFRAADVGLDTVLVE
    RYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVEFGKPTITLDKLRQYKEKVVNQLTKGLAGMAKQRKVRSVQGV
    GKFVSANELEITAADGSTQLLRFQKCIIAAGSQAVKLPNFPWDDKRVMDSTDALELAEVPGSLLVVGGGIIGLEMATVYG
    ALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGIDVHLKTKASGVSADAKGITVTFEAAEEGQSPALAQGTFDRVLVA
    VGRSPNGKKIDAEKAGVQVTDRGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGHKKEWVARVIPSV
    AYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEESHRIIGGAIVGVHAGDLLAEIGLAIE
    MGAEAEDIGHTIHAHPTLSESVAMASEIYDGTITDLYMPKKK

    >gi|194367402|ref|YP_002030012.1| C-type cytochrome biogenesis protein (copper tolerance) [Stenotrophomonas maltophilia R551-3]
    MKTLFARGAALCALLWLSLPAFALDEKDLLPVDQAFALTATAPERGQVQLQFKIAPGYYLYRHRTSVKADPAFNAGALQM
    PKGDKHHDDFFGEVETYRERLQATLPGAPTDAAGTISLEVRYQGCADAGVCYPPQKRVVQVTLPGGGAQAAAPAARPGAA
    SPFNNPLAGAGNSGGLRLPGAASNSQALPLPSEQAFGFDAIASDGNTLLLRFSPAPGYYLYRDRTSLKLEGSAGVLADKP
    RWPAAQSHRDEHFGDVSVYFNQVEVPLPLRRSVADAVDSTLVVTFQGCQTDGICYPPMTRRVKLSIPAGRINASADQAPP
    RSEVLSPLPTATGAPREAANGAPLRLLPTVPNTDATAPVAAGDGAASSEFAADAQGDNALRTRPPATTPNPDRSFLWVLL
    LALAGGLVLNLMPCVLPILSLKVLGLAQSGESPQRARSHALWYTLGVLVAFAVIGALMVGLRAIGNAVGIGFQLQHPGVV
    AALAYVMFAVGLSLSGVFTLGGGLGNLGQSLASRSGPAGDFFTGALACVVGSACVGPFMGGAVAYAFIATPLQAMTVFLF
    LGLGLALPFLLIGFVPALARRLPKPGPWMETLKHVLAFPMYATALWLLWVLGKQRGVDGMSLVLGGLLLFAFGLWLFERN
    RWTGPRAVALLGVLLAIAALVPAWGVTQLAPPARAAQAATDNVVEYSPQLLDRLRADKRVVFVNMTADW
    CVSCKANERAV
    LSRPEFKELLKRTNAVYMRGDYTNVDPQITTFLEEHKAVGVPLYVVYGPGAPPTVLPTLLTQAVVEEALLRTAR

    >gi|194367403|ref|YP_002030013.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stenotrophomonas maltophilia R551-3]
    MKWQRPALLWTAVLAAGLGLWAGYRLAPTPTAPAAAPVASPAAPATPALQVGDPLPVLTLPDLEGRPLDLHQHFAGRPLL
    INVWASW
    CAPCVEEMPELARFAHTQGSEGVQVLGLALDTPEDVRRFLQQVPVDYPIVIETPGPRDASVQLGNTQGLLPYS
    VLFDAQGRLQKAKLGPFAHGEIDSWVK

    >gi|194367447|ref|YP_002030057.1| thioredoxin [Stenotrophomonas maltophilia R551-3]
    MSDKVVHVGDADFDSAVLNSKEPVLVDFWAEWCGPCKMIAPALDELADAYQGRAKIAKVNVDHNRALAAKYHVRSIPYLV
    VFKDGEKVGEQIGAVGKAQLAGLLDKALA

    >gi|194367473|ref|YP_002030083.1| iron-sulfur cluster insertion protein ErpA [Stenotrophomonas maltophilia R551-3]
    MSTLVSLPGATPVAAPDYQSLERPLNFTESAAAKVKSLIQEEGNLDLALRVYIEGGGCSGFQYGFEFDENRAEDDLAVQT
    SGVTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSM

    >gi|194367666|ref|YP_002030276.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Stenotrophomonas maltophilia R551-3]
    MNPDVLIVGGSYAGIAAGLILARARRPVTVIDAGSPRNRFASHSHGVLGLDGISGAELLKTARQQLLDYPTVRWVHAEVE
    HARTTAEGVEVRTADGQVLAARKLLLASGIADQLPELPGLAERWGSTVLH
    CPYCHGYEVGGGAIGLLGGHPMSASKAPLF
    ADWGNVTFFSMGLEITDEEHAAMQQRGVRIETSPVLGVHGDQPTWLEVELADGRRIAQRALFVPATQAMATPLVQQLGCT
    LVESPLGVLIEVDMMKQTSVPNVYAAGDATTVGNITLAAAEGVRAGIGVHHALVAEDSVPR

    >gi|194367794|ref|YP_002030404.1| Glutathione peroxidase [Stenotrophomonas maltophilia R551-3]
    MSTPIQDISLTTIDGQPSSLADYQGKVLLLVNVASKCGLTPQYEGLQALYAEKHAQGLEVLGFPANNFLGQEPGSEAEIQ
    QFCQLTYDVSFPMFSKISVAGDDTHPLYQQLTAAQPQSIGEGPLRERLASKEIPIHPAPAVLWNFEKFLVGRDGKVIARF
    APDVAADDARVREAIEAALAA

    >gi|194365775|ref|YP_002028385.1| alkylhydroperoxidase like protein, AhpD family [Stenotrophomonas maltophilia R551-3]
    MTARLDYAAQSPELFKKLGLYSHAAHTASIEAAIIDLVNIRASQLNGCGFCLDMHVKEATLRGERPLRLHHLAAWRESTL
    FSPRERACLAWTEVLTQLPAQGVPDELYARVRGQLSEQEIVDLTHAVMAINAWNRANVAFRTTPGTLDAAFSLDKAGLA