Bacillus halodurans C 125 uid57791

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|15612779|ref|NP_241082.1| pyruvate dehydrogenase E3 (dihydrolipoamide dehydrogenase) [Bacillus halodurans C-125]
    MVVGEVAVEVDTVVVGGGPGGYTAAIRLGQLGKSVVLIEKNQLGGVCLNRGCIPSKALIQMAEKFDELTHLKEMGVELPG
    KPASIDLHKWQKWKQEITTKLNTGIHQLCQQNGVTVVTGEAHFLSSHRVGVETGNAFDVYKFEHAIVATGSSPRSLPFAE
    VDHTYILDSTSALELTEVPRSLSIVGGGYIGMELGLAFAKLGSAVTIVEMSPHILPATAPHISREVLNKAEKLGVTIKSS
    TSVEHLTVNDGYVELIVQSNGEQETLQSEKALMTVGRSPNTKGLGLEQVGVFFNEDGTLPINEECRTNIDHIFAIGDVTE
    GPALAHKASKQGIVAAEVIGGLPSAIDSSYIPYVVFTDPQIAGVGLTAKQAQEQGHRVKTARFPFQANGLALVASKPDGF
    AEVIVDEESHLLLGFHIVGADASNLIGEGVLALELGARVEDVALTVHPHPTFSEGWLGAAEAALGHAIHVVNK

    >gi|15612956|ref|NP_241259.1| O6-methylguanine-DNA alkyltransferase [Bacillus halodurans C-125]
    MNLYQDYYFSPIGPMEILASDTHVRHIRFSTTPSHQRPNEQTDHCIRELTDYFAGTLTQFTVSIHMRGTPFQQEVWKALA
    SIPYGDTRTYQQIAALIGRENAYRAVGQAISHNPLALVIP
    CHRVVGKTGKLTGFAWGVERKKQLLDHEAQSRYVSLRNVF
    PSSFPSEK

    >gi|15613119|ref|NP_241422.1| mercuric transport system (mercuric-binding protein) [Bacillus halodurans C-125]
    METTLNVKGMSCQHCVKAVEENVGQLTGVEKVTVQLDKGTVNVSYKEDQVSIDKIKDTIEDQGYDVE

    >gi|15613120|ref|NP_241423.1| copper-transporting ATPase [Bacillus halodurans C-125]
    MKNQKELTLDIQGMTCAACSNRIEKGLQRMDGVQEANVNLTLERSTVVYDPEKVQPEQVIEKVEQLGYKVVIDRVEFDVV
    GMT
    CAACANRIEKKLNRLEGVHKAVVNLALETATVEYRPESVSPSDLEQAIEQIGYTLKRKTGDAEEGDVRERELQKQKR
    RFWISAVLTLPLLWSMVTHFEFTSFIWMPHLFMDPWVQLLLATPVQFYIGAPFYVGAYKALRHKSANMDVLVALGTSAAY
    FYSMYLGYDWLYGTREGMMPELYFEASAIIITLIVLGKYFEARAKGRTSEAIRKLLGLQAKTARVIREGKEEQIPLEEVK
    TGDLLLVKPGEKIPVDGEVVEGYSAVDESMLTGESIPVEKDVGDQVIGATVNHNGSLRIRATRVGKDTALAQIVKVVEEA
    QGSKADIQRAVDKVSSIFVPVVVAISVLTFLVWYMVIDPGNVTSALIPTISILVIACPCALGLATPTSIMAGSGRSAELG
    VLFKGGEHLEHTQRIDTVVLDKTGTVTEGKPSLTDFVTYGSADEKEMATMLHAAERRSEHPLATAIVDGMKQLGVDRLEA
    DSFSAIPGHGVEAMVAGRNVLVGTRKLMAEHQVDYKEALSSAEAREARGETVMFMAVDGILTAHVAVADQLKSSSKKAIE
    RLKALGLDIVMLTGDNERTARAVANDVGIEQVIAEVLPKDKSEQIRKLQKQGRTVAMVGDGLNDAPALATADVGMAIGSA
    TDIPIEAADLTLLGDDLHRVADAVLMSQKTMRNIKQNLFFAFVYNTSAIPIAAAGLLAPWVAGAAMAFSSVSVVLNALRL
    QRFQIK

    >gi|15613176|ref|NP_241479.1| assimilatory nitrite reductase (subunit) [Bacillus halodurans C-125]
    MKEKLVVVGNGMAGIRTVEELFERGGHERYEVTVVGEEPHVNYNRILLSSVLASEANMEDIELNSLDWYRENDVTLYRSE
    KVTKLDRKKKVVLTDKGQKIAYDKVILATGSHPFMLPLPGSDLEGVIAFRNIED
    CETMIETAKNYKKAVVIGGGLLGIEA
    ARGLLNLGMEVEVVHIFDYLMERQLDRTAANILRTELENQGMKFLLEKHTEAIIGKGRVERVKFKDGTETRADLVVMAVG
    IRPNHEVASASGIEVNRGIVVDDYMQTSDPDVYAVGECAEHRGMVYGLVAPLWEQGKILANALMDNKDEKYEGSVLYSKL
    KVSGVQVFSVGEFQEQDDAKSVSMLDEFAGIYKKIVTRGDKIVGSILVGDTSESTILLNQIIKGVPFEGSPMQLLRSHVG
    SADDGVSAVSMLSNEDQVCGCNGVSKGAIIDAIKTQGCASVADVGACTTAGRSCGTCKPMIADLLAEELGETANEKETMC
    GCTDLSHEEVVAAIREKGLTHTREVMNVLGWKEEHGCSKCRPAINYYLAMVHPLEHEDERESRFVNERLHANIQKDGTYS
    VVPRMYGGVTNPDELRRIADVAEKFNVPLLKITGGQRIDLLGVKKEDVPSVWKELDMPSGYAYGKALRTVKTCVGEDFCR
    FGTQDSIGLGIAIEKKFERLNTPHKVKMAVSACPRNCAESGIKDVGIVGVEGAWEIYVGGNGGASLRLGDLMCRVKTSEE
    VLEIIGAFLQLYREEARYLERTSHWVERVGLDYIKETLLEHPENRKVLNERMDEALSVLTDPWEEINNDPSLKETLFEEK
    VAVVTSE

    >gi|15613220|ref|NP_241523.1| pyridine nucleotide-disulphide oxidoreductase, class II [Bacillus halodurans C-125]
    MEKQQLDVAIIGGGPAGLNAALVLGRARKQVAVIDEGRPRNAVTREAHGFLTRDGISPADFRRIAKEEIIAYPNVSFVAD
    KAVSIAGVDGQFQIVTAEGISFETKKLLFAVGMKDRPLDIPGLVEAYGKSAFV
    CPYCDGWELRDESLVVINKGEELLHFA
    PIISGWTDRFTICTNGPDELTEDQREELRRHQVPVYDSPIRSIDSNDGIVHQVVLQDGTIIPCRGIFFKPELIPGSDLPQ
    SIGCDITEAGMVVVDDFGKTSVPGVYSAGDVASKMYQAIAAASMGALTAAAMNNELNMEAWKRNG

    >gi|15613342|ref|NP_241645.1| dihydrolipoamide dehydrogenase [Bacillus halodurans C-125]
    MKSYDIVVIGGGPGGYVAAIKAAKLGKKVALVEAKDLGGTCLNRGCIPSKTLLHQGEIIEKIKQAKEWGIETGAVTLSLP
    KMLARKNEIIQKLRAGIHFLLKQGKIDVYFGYGEIERDRSVKIKMKETAEIVSVRTENMIVATGTEPTIPPVPGLAEAVV
    DTSDTIFELDSIPQSIVIIGGGVIGVEIACIFSSLQVDVTIVEMGKRILPQEDEEAAKVLAKALAAKGVHLLTNTKVTAV
    LQGDKQKVEIETSTGDRDWLEGERILLAVGRTPNLSVVKELGLGMAGPFLKVDDQMRTSDPSIYAIGDVIGGWQLAHVAS
    AEGLVAAANASGKVEIINRQVIPRCIYTQPEIASVGLTEQEAKEKGYSYKVVKVDLRANGKAMALGETTGFVKMIADPNY
    GEILGVTMVGPHVTEMIGEPAAFIHLEGTVDELKAMIHPHPTVSEALYEAAASWLGQGVHQP

    >gi|15613511|ref|NP_241814.1| bacterioferritin comigratory protein [Bacillus halodurans C-125]
    MLEGKQAPDFSLPASNGETVSLSDFKGKNIVLYFYPKDMTPGCTTEACDFRDRVEDFKGLNTVILGVSPDPVERHKKFIE
    KYSLPFLLLADEDTKVAQQYDVWKLKKNFGKEYMGIERSTFVIDKDGTVVKEWRKVRVKDHVEEALAFIKENLE

    >gi|15613584|ref|NP_241887.1| O6-methylguanine DNA alkyltransferase [Bacillus halodurans C-125]
    MAEQSLLYDEMESPIGCLSIVSTDQGVCTILFGSLESNQVTLNVWLKKHRLPCQLLKDEEAIRPVIAQLLEYFDGKRHSF
    DVPLDLYGTPFQKRVWQALQTISYGETRSYKEIAQHIGAPKAVRAIGGANNQNPIPIIIP
    CHRVIGSNGAMVGYGGGLEK
    KEWLLSIEGAYEKIS

    >gi|15613982|ref|NP_242285.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus halodurans C-125]
    MTDRLEERYSRQMLFAPIGKEGQQKLQNSAVLIVGIGALGTVLANHFVRAGIGHVRMVDRDYVEASNLQRQLLFDENDVR
    ECLPKAVAAQQKLQKVNSDIKVEGIVADVTVENIHELMEGMDLVLDGTDNFQTRFLINDACFQMGLPFIYGGAVSSRGMT
    AMFIPEKTPCLRCFIQEGQGSGQT
    CDTVGVLGPVVDIVASFQAIEALKYLTDNEQAYRHSLMSFDVWRNHRYDMNFAAAK
    ANCPTCGTKAFPALHPAAHDSVTSLCGRETVQVHTGRPFDLSEWGKRLDRIADVQTTPFLVRVQLTEGERLVLFKDGRVL
    VQGTEDVSRAKTLVSKYIGL

    >gi|15614010|ref|NP_242313.1| methionine sulfoxide reductase B [Bacillus halodurans C-125]
    MTEQNEELKKKLTPLQYEVTQNNGTEPPFRNEYYDLEAEGIYVDIVSGKPLFSSKDKYDAGCGWPSFTKPIDEEEVIEKE
    DRSHGMFRTEVRSKQADSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKADLEKEGYGKYKALFD

    >gi|15614011|ref|NP_242314.1| peptide methionine sulfoxide reductase [Bacillus halodurans C-125]
    MSESKWALATFAGGCFWCMVSPFEEEPGIHQVVSGYTGGHTENPTYKEVCSETTGHYEAVQISFDPEVFPYEKLLEIYWT
    QIDPTDPGGQFHDRGDSYRTAIFYHDEQQKQAADASKQKLEESGKFNAPIVTRILPAKPFYPAEEYHQKYHKKNPFHYKM
    YRHGSGREAFIKQHWGESR

    >gi|15614056|ref|NP_242359.1| reductase [Bacillus halodurans C-125]
    MYECVIVGGGIAGLQAAIQLGRYEHHVAIIDNGGGRSSLCRRYHNLLGWPDGISGQAIREAGRKQATSLGVEFIDSSVHS
    VRRQAEHFVIETESTTFEAKRLLLATGISDRIPPFPSLYPMLGKHVFL
    CPDCDGYEVRGQDTIVIGSGQAGANLSLALTY
    WKPNLTYINHEQQPLSPEVEQKLASKNILVVHEKVETILHDEETFQGVMLQDGTVHSAPKAFLAMGGAKVESDLAKQLGV
    ERLENHHIVVNPRTKETNVKHVWAVGDVTVHSQLLSIAMGDGAQAAIWIHKSLLHERT

    >gi|15614085|ref|NP_242388.1| thioredoxin (thiol:disulfide interchange protein) [Bacillus halodurans C-125]
    MNKKRLTTIVVLIAVVASVIIILTQNNLEVGNGKGMLAEDFTLPLYEESQSRSLSDYRGDVVILNVWASWCEPCRKEMPA
    LMELQSDYESEDVSIVTVNMQTFERTVNDAGEFIEELGITLPVFLDEEGEFADAYQVQHLPMTYVLDREGIINEVILGEV
    TYEQLEQLIVPLLEKAS

    >gi|15614140|ref|NP_242443.1| thiol-disulfide oxidoreductase [Bacillus halodurans C-125]
    MDKRKRFWMRLSILAVISVALGYTFYSNFFADRSLARAGEQAVNFVLEDLEGESIELRELEGKGVFLNFWGTYCPPCERE
    MPHMEKLYGEYKEQGVEIIAVNANEPELTVQRFVDRYGLSFPIVIDKGLNVIDAYGIRPLPTTILINEHGEIVKVHTGGM
    TEQMVEEFMELIKPEA

    >gi|15614271|ref|NP_242574.1| thiosulfate sulfurtransferase [Bacillus halodurans C-125]
    MKQYTVSLDWLSEHLEGVKVVDCRFSLQDSADGLRRYQDGHIQGAVYFDLVHDLSGTVQDHGGRHPLPEVDTFLEKVEAA
    GIDHETTVVAYDDEGGPFASRFWWLLRYLGHENVYVLDGSFSEWQAVGYPVDRNIPMYAKTTMDVKVKPERLATYTYVKQ
    NLSDPAVHLIDAREPARFLGKVEPIDKKKGHIPNAKNRFWQDGLNGKKRKSAKEQAERFADLPKEDEVIVY
    CGSGVTACP
    NVLTLEELGYKRVRLYVGSWSDWISHDESEIATGEEGERTRDK

    >gi|15614278|ref|NP_242581.1| thioredoxin [Bacillus halodurans C-125]
    MGSKAPAAANTHGVYFHSPLCGTCKVAKRMIKVMEETFPHFEIREVNINEEIALAHSLKVTSIPCLIIFQEEREAERLYA
    FRSLEHLYTKLKPYTVVERLHKSFRLDQTKGD

    >gi|15614280|ref|NP_242583.1| thioredoxin [Bacillus halodurans C-125]
    MRQIHHPHHRWPYLKEKSLSILSHGKRLKGRSQKLSSVVWLWRTTNIANNRCVTAMKAPLFSLKDGQTGNILRLEDVKGQ
    VVMLTFWASW
    CPDSQRDLEQKWELYKQMDKAKLAFLTINVTGREGRSGDGIAYAKEHGYDFTILLDEGTTVYDQYRCMGV
    PTTFLLDEELNIKYRYSDRAAFMEIMQGLSTLL

    >gi|15614388|ref|NP_242691.1| dihydrolipoamide dehydrogenase [Bacillus halodurans C-125]
    MDRVAIVGGGPAGYVAAITAAHRGKQVTLIEQKKLGGTCLNEGCMPTKSLLESAATYDKVKHASDYGIKGPVDEMRIEWG
    QVQARKNQIVHQLVKGIDYLLKKHKIELLEGTASFQSAHELLVQTERGQQTIEANRIIIATGSEPTPLPFAPFDREWVIS
    SEQAMSLPIQPESMIIVGGGVIGCEFASIYGRMGTKVTIIEMADRLLFGEDHDICKVLMEELKRQGVEIYPSTVIKEMQR
    DRKQVVVERDGQVEVLTGDYVLVAIGRKPRLQEIGLERIGVDFTSRGITVNEHMQTTIPHIYACGDVIGGIQLAHVAFHE
    GSVAAKHLCGEPIQVRYEAVPRCIYTSPEIATVGLTETQARENYGHVRIGEYPFAANGKALIVNETIGKVKVVVEPEYEA
    IVGLTIVGPHATELIAQGTLMVHNELTLDSLESFIAAHPTVSEAVHEAVLQALGQAVHV

    >gi|15614505|ref|NP_242808.1| hypothetical protein BH1942 [Bacillus halodurans C-125]
    MKKLAIFGSIIVLLFVAIAVVTNLSQKQQVEGNPFGKETLDPTTIELLDDPNYQNVILPDELEDILAGEGEATVYFYASD
    CPYCKEATPRLVPIAEDLGIDLVQYNVKEFQQGWNDYNIESTPTIIHFENGEEVARLVGSHSDEGFTLFLEENVLD

    >gi|15614655|ref|NP_242958.1| hypothetical protein BH2092 [Bacillus halodurans C-125]
    MSRKPRYSLALEVEPANPNEAYRHYMKKLSYETDIADLSIDIKKGYEGIIVVDVRDAEAYKECHIPTAISIPGNKINEDT
    TKRLSKEKVIITY
    CWGPACNGATKAAAKFAQLGFRVKELIGGIEYWRKENGEVEGTLGAKADLFWNMKKESKNKKSLDGS
    TQ

    >gi|15614812|ref|NP_243115.1| peptide methionine sulfoxide reductase [Bacillus halodurans C-125]
    MEKRLERAMFAGGCFWCMVQPFDKQPGIESVVSGYAGGTVENPTYEQVKTGTTGHYEVVHITYVPELFPFEKLLSLYWPQ
    IDPTDPDGQFHDRGPQYRTAIFYENEEQRALAERSREALEKSGKFKKPIVTSILPMATFYPAEEEHQQFYKKNPMAYKED
    REKSGRDEFIYKHWGK

    >gi|15615215|ref|NP_243518.1| dihydrolipoamide dehydrogenase [Bacillus halodurans C-125]
    MVVGDFAKEVDTLVIGSGPGGYVAAIRAAQLGQSVTIVEKGTLGGVCLNVGCIPSKALISAGHRYHNALHSDDLGIKAEN
    VTLDFSKVQEWKASVVNKLTGGVEGLLKGNKVEIIKGEAYFASEDSVRIMDEKNATTYKFKNCIIATGSRPIELPNFKYS
    KRIINSTGALALEEVPKKLVVIGGGYIGIELTGAYSNLGSDVVVLEGGKQILPGFEKQMAKLVERKLKKNGVSFHTEAMA
    KGVEETEDGVKVTAEIKGKEEVFEADYVLVTVGRKPNTDELGLEQIGVELTERGLIKVDKQCRTNLSNIYAIGDVIEGPA
    LAHKASYEGKIAAEAIAGEKSEIDYLAIPAVVFSDPELATVGYTETEAKEAGYDVTAAKFPFAANGRALSLNDADGFMKL
    ITRKEDGLVIGAQIAGPNASDMIAELGLAIETGMTAEDIALTIHAHPSLGEITMEAAEVALGTPIHIVK

    >gi|15615227|ref|NP_243530.1| hypothetical protein BH2664 [Bacillus halodurans C-125]
    MALKLRSQMPELEGATAWLNGEVQKSDLQDKPTLIHFWSISCGLCKEAMPNVNEFRDKYKDQLHVIAVHMPRSEKDLDLE
    QIKQVAEEHGITQPIFVDSQHKLTDAFENEYVPAYYVFDEEGQLRHFQAGGGGMKMLTKRVNRVLGIKE

    >gi|15615228|ref|NP_243531.1| 2-cys peroxiredoxin [Bacillus halodurans C-125]
    MTDKRMVAKQAPRFEMDAVMPNKEFGKVSLEENMKNDKWTVLFFYPMDFTFVCPTEITSLSDRYDEFEDLDAEVIGVSTD
    TIHTHKAWINTSRDDNGLGDLKYPLAADTNHEVSREYGVLIEEEGIALRGLFIISPEGELMYSVVNHNNIGRDVDETLRV
    LQALQTGGLCPANWKPGQETLSV

    >gi|15615327|ref|NP_243630.1| dihydrolipoamide dehydrogenase [Bacillus halodurans C-125]
    MAEEYDLVILGGGTGGYVAAIRATQLDLKVALVEKGKLGGTCLHKGCIPSKALLRSAEVFSTVQKADQFGVKIDGAALDF
    TSVQNRKEQIVTQLHRGVEMLMKKGKIDVYKGHGRILGPSIFSPTPGTISVEMNNGEDNMMLIPRNVIIATGSSPRVLPG
    MEIDGEAVLTSDEALKMEQLPKSMLIVGGGVIGIEWASMLNDFGVDVTVIEYGPRILPTEDADIAKEAERLLKKRGVTFK
    TNAKVLAETLEKGDNSVVIEAEVGGVSERFTAEKMLVSVGRTPNVNDIGLENTDIEVIDGAIAVNEWYQTKESHIYAIGD
    VIGGMQLAHVASHEGILAVEHMTDHKPEPLNYLTVARCVYSHPEMASIGLSEAEAKEKGYEVKVGTFPFQAIGKALVYGE
    SDGFVKILSDKKTDDLLGVHMIGPHVTDMISEAALAKVLDAAHWEVAHTIHPHPTLSEVVGEAALAVDGKAIHF

    >gi|15615376|ref|NP_243679.1| hypothetical protein BH2813 [Bacillus halodurans C-125]
    MMVYVWLVLLALLVYVLFKRLYTPKYLKTLTQEEFIQGYRKAQLIDVREPREYDSGHILGARNIPLSQLKQRLKEVRTDQ
    PVYLY
    CQSGARSRQAAAILKKKHGVEDVNHLKGGFRKWTGKIKKK

    >gi|15615393|ref|NP_243696.1| glutathione peroxidase [Bacillus halodurans C-125]
    MSIHEFSARLINGEEKALSDYKDQVLLIVNTASKCGLTPQYEELQILYETYKDQGFTVLGFPSNQFMNQEPGDHNEIAAF
    CERNYGVSFPIFEKVKVNGKEAHPLFQYLTSQQGGLFTEKIKWNFTKFLIDRSGNVVKRYAPSTSPIKIKDDIEELL

    >gi|15615424|ref|NP_243727.1| transcriptional regulator Spx [Bacillus halodurans C-125]
    MVTLLTSPSCTSCRKAKAWLEEHNIPFEERNIFSSPLTVEEVKEVVRMTEDGTDEIISTRSKVFQELDVELEALPLQTLF
    KIISENPGLLRRPIIFDEKRLQVGYNEAEIRRFLPRKVRTFQLQEAQRLVN

    >gi|15615431|ref|NP_243734.1| thiol/disulfide interchange protein [Bacillus halodurans C-125]
    MKGKQAFYRSFLILALCTVGYFYSQSEHVYRPVDKEAITTFNEGVQVGQRAVPFSLTTLEGQVVDLSSLRGQPVILHFFA
    TW
    CPVCQDEMPSLVKLDKEYRQKGGQFLAINLTNQESSIKDVRAFVQHYRAEFDPLLDTDGEVMETYQVIGIPTTLILDE
    EGTIVKRYNGVLTEEIIDEIMDIH

    >gi|15615483|ref|NP_243786.1| hypothetical protein BH2920 [Bacillus halodurans C-125]
    MAFELDGIEQVEETELAALLNEKGDETIVVDVREPEEYEAGHIPGLPLLPMSSIPAVVAEMDKEKSYIFVCRSGSRSQNV
    ALYLKDQGFRDVKNYAGGMLEWTGEVTSGLEWFVKDVHELYKK

    >gi|15615660|ref|NP_243964.1| thioredoxin [Bacillus halodurans C-125]
    MAIVNVTDQTFAQETSEGLVLADFWAPWCGPCKMIAPVLEELDGEMGDKVKIAKLDVDENQETASKFNVMSIPTLIVFKD
    GQVVDQVTGFQPKDALAELLNKHL

    >gi|15615756|ref|NP_244060.1| thioredoxin peroxidase [Bacillus halodurans C-125]
    MASITFKGNPMTLLGNEVKVGDKAPNFTVLANDLSPVTLDDSKGKVRLISVVPSIDTGVCDAQTRKFNEEAANLDGVEVL
    TVSVDLPFAQKRWCATAGLEQAKTLSDHRDLSFGKAYGVAIEELRLLARAVFVINANDEVTYVEYVSEATNHPDYEKAIE
    AAKAAL

    >gi|15615815|ref|NP_244119.1| thioredoxin H1 [Bacillus halodurans C-125]
    MEQIKTLEQFQQVKNQENVVFLFSADWCPDCRVIEPFLPELEQTYDEYQFYYVNRDDFIELCQELDIFGIPSFLFYSNGE
    ERSRFVSKDRKTKEEIERFLTEAKQA

    >gi|15615841|ref|NP_244145.1| hypothetical protein BH3279 [Bacillus halodurans C-125]
    MHEVIVIGGGPAGLMASVSAAEHGARVLLLDKGDKLGRKLAISGGGRCNVTNRMPLDELIAHIPGNGRFMYSPFSVFNNE
    DIIRFFERLGIALKEEDRGRMFPVSDKATTVVQTLLKRINDLGVTVRTNTAVASLEYDDGRIAMVQLKNGERLKTKTVIV
    ATGGQSVPHTGSTGDAYPWAKAAGHTITELYPTEVPITSAEPFIQEKKLQGLSLRDIELSVYAPNGKQIKTHDGDMIFTH
    FGLSGPAALRCSQYVVKALKKYKQPTIEMRIDLRPTIPAEALFQETIQNIKAEPKKALKTVLRGIAPERFLQYIYERLRI
    DSNLPCASVRHEVIREIVQQLKSFSFHVNGTLSIEKAFVTGGGVSVKEIEPKTMHSKKKAGLFFCGEVLDIHGYTGGYNI
    TCAFSTGYTAGKGAAEYVHHKS

    >gi|15615972|ref|NP_244277.1| hypothetical protein BH3410 [Bacillus halodurans C-125]
    MIKITDAAVNRIKEMMKEEGEEGLKLRVGVKGGGCSGLSYGMGFDNEQTEDDTLHEINGLSVLIDNESGPILKDVVIDYK
    QNMMGGGFTIDNPNAIATCGCGTSFRTATNAGTPEDC

    >gi|15616035|ref|NP_244340.1| hypothetical protein BH3473 [Bacillus halodurans C-125]
    MDQQQMNPMEMALMDYKEGLGTFQQKMPEIAEKYNAFTEACFAKGELSQKQKQLIALGVSVFAQDEYCIIYHTKGCMDQD
    CSEEEILEAIGVTAAFGGGAAMSQAVTLVQEAMNEFGQNGGEQGQQDQQDSQNGQNGQNGQNQKQGQNQNMKH

    >gi|15616047|ref|NP_244352.1| arsenate reductase [Bacillus halodurans C-125]
    MALTFYQYPKCGTCQKAKKWLDQHGIEVNSVHIVEQPPSKEELKQLYEQSGLELKKFFNTSGKKYRELGLKDKVKEASED
    ELLETLASDGMLIKRPILTDGDKVTVGFKEAEYEETWKK

    >gi|15616124|ref|NP_244429.1| hypothetical protein BH3562 [Bacillus halodurans C-125]
    MLKVTFYSKEQCPLCDKGLAKMKRLKDEFSFDLEVVDIYEDDELLEKYQLIIPVVAINGEQVDYGMIDEQKVKTWFLEKI
    N

    >gi|15616133|ref|NP_244438.1| thioredoxin reductase (NADPH) [Bacillus halodurans C-125]
    MGEEQKVYDVVIAGAGPAGMTAAVYTSRANLSTVMVERGVPGGQMANTEDVENYPGFDHILGPELSTKMFEHAKKFGAEY
    AYGDIKEIIDQGDLKLVKAGNKEYKARAVIVATGAEYKKLGVPGEKELSGRGVSY
    CAVCDGAFFKGKELVVVGGGDSAVE
    EAVYLTRFASKVTIIHRRDQLRAQKILQQRAFDNDKIEFIWDHVVKQINGTDGKVSSVTIEHAKTGEQQDFKTDGVFIYI
    GMLPLNEAVKNLNILNDEGYIVTNEEMETSVPGIFAAGDVREKSLRQIVTATGDGSLAAQNVQHYIEELAEKVKN

    >gi|15616338|ref|NP_244643.1| NADH oxidase (nox) [Bacillus halodurans C-125]
    MKYVIIGGDAAGMSAAMEIVRNEEAANITTLEMGSIYSYAQCGLPYVVGGVIPQTEKLIARTIETFRNKYGIDARTNHEV
    TKIDPDSKHVYGANFEIPYDKLLIATGARPLVPNWPGRTLAGIHTIKTIPDTEVLLADLKGEIKNVVIVGGGYIGLEMAE
    NLALTGKNVTIVEANAQLAAIFDQEMGEIIHQEAERKGVTLRLKEEVKGFEGTDRVQAVVTSSATVPAELVIIAIGVVPN
    TTFLEGQPFHRHENSALKVNAYMETNLPDIYAAGDCATQYHRIKKLDDYIPLGTHANKQGRLAGLNMVGKRRAFAGVVGT
    SIIKFFDLSLGRTGLSEKETRDARLPASSITFDGRDIAGYYPGAEPLKIKLVYHSETNQLLGGQVIGTNGVAKRVDVLAT
    ALYQQLTLEELLDLDLSYAPPFNGVWDPIQQAARRA

    >gi|15616501|ref|NP_244807.1| hypothetical protein BH3939 [Bacillus halodurans C-125]
    MTENKGTPEVGWSFDTRYTDLPSMMFSNVEPEPVEAPKLVILNDSLAQSLGLDPVALQHQNSIAVLAGNEVPKGAAPLAQ
    AYAGHQFGHFTMLGDGRAILLGEQITPNGERFDIQLKGSGRTPYSRQGDGRAALGPMLREYIISEAMHALGIPTTRSLAV
    VTTGESVFRETVLPGAILTRVAASHIRVGTFQFVANAGSEEELKALADYTLARHFPEVEADRENRYLALLQKVIKRQAEL
    IAKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDVYDPETVFSSIDTRGRYAYGNQPRIGAWNLARFAEALLPLLADDQ
    DEAIKLAEAEISNYAEQFEHHWLNGMRAKLGLFNEESEDLSLIKDLLEVMHKHKADFTNTFRALTFDEQEETGLHDKLEF
    TEWHERWQARLGRQEQTKDDSHNLMKMSNPAVIPRNHRVEEALEAAVEQEDYQVMERLLKVLANPFAHSPEQKAYAKLPA
    PCAIPYRTY
    CGT

    >gi|15616598|ref|NP_244904.1| cadmium-transporting ATPase [Bacillus halodurans C-125]
    MADQATVEVKKTTYRVQGFSCANCANTFEKNVKDLHGVVEAQVNFGASKLTVYGDATVEDLERAGAFEHLKVRPENEKAI
    ETKEPFWKAYGHVIVSALLLLVGVVSYFMKGERHLWTVSLFASSIVIGGYSLFKAGFYNLIRLRFDMKTLMTVAVIGAAL
    IGEWLEGAVVVILFAISEALERFSMDRARQSIRSLVDMAPKEALVRRNGEELVIPVEAIEVGDIMLIKPGQKLAMDGIVR
    SGRSSMNEAAITGESVPVEKMVGDDVFAGTLNEEGFLEVEVTKRVEDTTLAKIIHLVEEAQGERAPSQAFVDMFAKYYTP
    AIMVIAALVATVPPLFFAGSWETWIYQGLAVLVVGCPCALVISTPVSIVTAIGNAARHGILVKGGIYLEEAARLRAVAFD
    KTGTLTKGKPAVTDYQVYDADTDGRELLAAVAALEYRSQHPLAAAVMKKADDEQLSYTDMEVSEFSSITGKGIAGTVNGI
    AINVGKPALFGELPPAIEADVARLQAAGKTIMLIGAEQKVLALLAVADEVREVSRTAVERLHALGITKTVMLTGDNRMTA
    RAIGKQVGVAEVEAELLPEDKLGFVKGLKEEHGRVAMVGDGVNDAPALAASSVGVAMGGAGTDTALETADVALMGDDLRK
    LPFLIRLSRKALLIIKENIAFSLGIKLVALFLVAPGWLTLWIAILADMGATLLVTLNGLRLLRMKDE

    >gi|15612987|ref|NP_241290.1| hypothetical protein BH0424 [Bacillus halodurans C-125]
    MARLSAGPYGETPFQKRLGHNRYILRAWNELSEILEQDGALFSTLKEQVRRALAQKNGCEYCKAKGRPDPQLVDEKTGVA
    IGFAEAFLQMRGAVPDSIFEVAREALSEREMSELCAFICFTTASQFFGALMDLQPDEQ

    >gi|15615467|ref|NP_243770.1| hypothetical protein BH2904 [Bacillus halodurans C-125]
    MKRWMTIAVLALMLGGCNWLYDMGSNNEATDPAFDISEAGLTVPDFEYVNQEGDPFGTEQLKGNYWLVNMIFTHCPGVCN
    IMTPNMVNLQDAMIEEGLDVKVVSFTVDPDRDTPELLKVYGENVGADFEYWSFVTGYSDGEITELAKTAFASIVQEDPEN
    EDIIHTTDFFLVDDQGLVIRRYDGMATDQAEIINDLKATVE