Stenotrophomonas maltophilia K279a

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|190572249|ref|YP_001970094.1| hypothetical protein Smlt0170 [Stenotrophomonas maltophilia K279a]
    MNYEELLAFAGRNPMLSAALVGLTVAIIVTEIRRLFRGFKGIKPAELTQLMNAGGTVVVDLSASGDFEKGHIAGSRNAQA
    SAFGPDNKLVANAKQSPVVLV
    CRSGNASETAAKALKKAGFEKVYVLDGGIPAWQQAELPLVKGRN

    >gi|190572343|ref|YP_001970188.1| putative organic hydroperoxide resistance protein [Stenotrophomonas maltophilia K279a]
    MSIEKVLYTAQATSTGGREGRSVSSDNVLDIQLSTPRELGGAGGPGTNPEQLFAAGYSACFLGALKFVAGQAKVALPADT
    TVTGKVGIGQIPTGFGIEAELTINVPGVPREQVEELVQKAHIV
    CPYSNATRGNIDVTLIVA

    >gi|190572621|ref|YP_001970466.1| methionine sulfoxide reductase B [Stenotrophomonas maltophilia K279a]
    MTAFDLTPPTATQTEALVAGLSSEERRVLLQHGTEAPFCGVFLDNKREGVYCCRLCALPLFRSSTKFDSGTGWPSFFAPF
    DPAHVREIRDTSHGMVRTEITCARCGSHLGHVFPDGPPPTYERH
    CLNSVSLSFTGNGEPWPDPLQRGGAEAGMAG

    >gi|190572647|ref|YP_001970492.1| putative peptide methionine sulfoxide reductase [Stenotrophomonas maltophilia K279a]
    MKFSFEQGIAAGVAGLVAAALIAGVLLVDHGAIAAPVEASAQTGALPAPSGDAAFRDDATHASVVFAGGCFWGVQGVFQH
    VKGVSNAVSGYIGGSAANARYERVSSGQTGHAEAVKVDYDPRQVSYGQLMQVFFSVVHDPTQLNRQGPDHGSQYRSAIFT
    DDARQQAASRAYIAQLGQAGSFRAPIVTQLVSGQRFYPAESYHQNYMTNYPQAAYIRYYDAPKLAALGRQFPGLYRRDAV
    LVPMR

    >gi|190572648|ref|YP_001970493.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
    MLLLLLAYLGGALTLLSPCILPVLPFVFARADRPFLRSTLPLLLGMALTFTVVASLAAVGSQWVAQANQVGRWIALLLMA
    LFALALLWPRLADHLLAPFQRVGARLSARADAADAAGRGGAWTSLLIGIATGLLWAPCAGPILGLVLTGAALHGASVGTT
    ALLLAYALGAITALALAVWVGGRVFRALHARLGLGDVLRKVLGVAALLAVVAIGLGWDTGLLTRLSTVSTARIEQGLLDA
    VPGAQPAAPPMMMMAGANAAANAPLPVEGTLPALDGATGWLNSPPLTAQQLRGKVVLVDFWTYS
    CINCLRAMPFVHEWER
    RYRDHGLVVVGVHTPEFAFERDPRNVMKAVQQLKVEYPVALDNQYTIWRAFNNRYWPAQYFVDAQGNIRGHQFGEGNYAR
    SEQVIRRLLTEAGQTNLPPPADPAAADLKGVAAQADMGNLRSPETYLGHARAEQFASPGGQRSDTAFDYTLPATLALNQW
    GLSGRWTVTGEAAQLQQAGGRIAFQFHARDLHLVLAPGQEGKPVRFRVLLDGKPLPATDAGTDVGADGSGVVDEHRLYQL
    VRQRGTVSPHRFEIEFLDAGVQAYAFTFG

    >gi|190572649|ref|YP_001970494.1| putative methionine sulfoxide reductase [Stenotrophomonas maltophilia K279a]
    MSLTRRHLLGLGGVATAAGLLGLGACSRAAPAAAEARPSRQFEVMRSDADWRQRLTPAQYAVLRQQATERPYSSPLNKEH
    RQGTFACAGCALPLFSSSTKFESGTGWPSFWAPLHNAIGEDRDVTFGMLRVEVHCRRCGGHLGHVFNDGPRPTGLRY
    CMN
    GAAMVFVPGAAEGGTADGWRVPVGSSPASGA

    >gi|190572732|ref|YP_001970577.1| putative thiol:disulfide interchange protein DsbC [Stenotrophomonas maltophilia K279a]
    MLRFAIAAVFGALSLTACAQPAPPAAKAPAAAAKPGPAANAPADQAVRAALTALNPGFKVDYIGAAPFPGFREVVVSGQL
    LYVSDDGRYLFQSQPYDTRAKGPANSEGLLGYRRDLLAKANHGDRIVFAAPNAKYTISVFTDIE
    CGYCRKLHQDIAELNR
    NGISVEYLAFPRMGLGSKDYTDMISVWCAADRRQALTNAKRGGNVPAKNCTNPVAMQYALGQQLGVNGTPAIFAPDGTQL
    GGYLPPAQLRAALEKLSAKR

    >gi|190572879|ref|YP_001970724.1| methionine sulfoxide reductase A [Stenotrophomonas maltophilia K279a]
    MLGIGQGILGIGAFKQRLPRPEEALSGRDQPLPLHSNQHFVNSHPLKDRFAGLQQIRFALGCFWGAERKFWTEPGVYSTS
    VGYAGGITPNPTYEEVCSGLTGHTEVVQVVFDPAVVSLERLLQLFWESHDPTQGMRQGNDTGTQYRSAIHATDEAQYKAA
    LASREAYQAQLDAAGYAPITTEIVYPAPAYYYAEDYHQQYLAKNPNGYCGIGGTGVSCPIGLDVEAPR

    >gi|190572885|ref|YP_001970730.1| putative alkyl hydroperoxide reductase subunit F [Stenotrophomonas maltophilia K279a]
    MLDANLQSQLKTYLERVTRPIQITAHADDGAKSQEMLELLQTLESLSDKISLQVLRDGQGRVPSFDLGTPGQDIHLTFAG
    LPMGHEFTSLVLALLQVGGHPSKATAELIEQVQNLEGDYRFETYFSLS
    CQNCPDVVQALNLAAVLNPRIQHVAIDGALFQ
    DEVEKREIMSVPTVYLNGDVFDQGRMTLEQIVAKLDTNASKRDAEKIAAKDAFDVLVVGGGPAGAAAAIYAARKGIRTGI
    AAERFGGQVLDTMAIENFISVKETEGPKLATALEQHVREYEVDIMNLQRASALVPAGEDGLVQVQLENGAVLKSRSVILS
    TGARWRQMNVPGEDQYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVSHVTLLEFDSSLRADEVLQKKLR
    SLANVTVLTSAQTTEVLGDGSRVTGLVYKDRVGGDAHRVELEGIFVQIGLLPNTEWLKDVVALSPRGEVVIDDRGQTNLP
    GVFAAGDCTTVPYKQIIIAMGAGSTAALSAFDHLIRSSVSNSSGAVAEAA

    >gi|190572886|ref|YP_001970731.1| putative alkyl hydroperoxide reductase subunit c [Stenotrophomonas maltophilia K279a]
    MSLINTQIQPFEANAYHNGEFIKVSDASLKGQWSVLIFMPAAFTFNCPTEIEDAADHYAEFKKAGAEVYIVTTDTHFSHK
    VWHETSPAVGKAQFPLVGDPTHQLTNAFGVHIPEEGLALRGTFIINPEGVIKTLEIHSNEIARDVSETLRKLKAAQFTAA
    NPNQVCPAKWKEGEKTLTPSLDLVGKI

    >gi|190572910|ref|YP_001970755.1| putative thioredoxin electron transport-like protein [Stenotrophomonas maltophilia K279a]
    MTRKTPLLLPLALLLALSACKPAQEPTPASSQPPAQAPTPTAPAPVEETPAERTTAEFPTLKMKAVDGSDYDLAAHRGKW
    VVVNFWATW
    CAPCRKEMPELSALHAMRSNIEVVGLAYEDIEVPEMQSFLTKHPVTYPIVIVDPFDPPADFATPRGLPLTH
    LLDPQGKLAHTFLGPVTAADIEKQIAAAK

    >gi|190572970|ref|YP_001970815.1| disulfide bond formation protein B [Stenotrophomonas maltophilia K279a]
    MNPLRWPFRAQFFLGFLICAGLLGYAIFLQLKMGLEPCPLCIFQRLAFAALGLLFLIGALHGPSNRPGRATYGVLAFIAA
    AVGAGIAARHVYVQMLPPEMGST
    CGPPLAFLSETMGPLEVFRTVLTGTGNCGNIDWTFLGLTMPMWSGAWFVLLALWALV
    VSLGKVKR

    >gi|190572983|ref|YP_001970828.1| putative glutathione S-transferase [Stenotrophomonas maltophilia K279a]
    MKLYSKPGACSTADHIALQWTGQPFEVELLNKDTLKGPEFLKINPAGAVPALVDGDFVLLQNAAIMGYIADTYPQAGLGG
    DGSARQRAEATRWLAFVNSDVHPAFSPLFAPGKFIADESQFDAIRAAAHKRLRGLFETADRQLADKPWLAGFRSFADPYF
    YITLRWAAGTKVDLSGLDNLAAYKARMDADAGVQAALKAEGLA

    >gi|190573013|ref|YP_001970858.1| putative glutaredoxin [Stenotrophomonas maltophilia K279a]
    MEFPVTAQTAGGAPAITIYSTAVCPYCVAAKNFLKSKGQQWTEVRIDLDPAEREKMMALTRRTSVPQIFVGDVHVGGYDD
    MMALHREGKLEPLLAGQGQA

    >gi|190573014|ref|YP_001970859.1| putative decarboxylase [Stenotrophomonas maltophilia K279a]
    MSAADDGSKDRIAEFTDFRKRMNERILGEPNQVVRRFFALDTQTYQAGALDVKTKELLGLVASMVLRCDDCISYHVAQCK
    DAGVTREEFFETFSVGLVVGGSIVIPHLRRAVDFLDQLEGGASAPAAHEH

    >gi|190573190|ref|YP_001971035.1| putative osmotically inducible protein C [Stenotrophomonas maltophilia K279a]
    MGISRHATAHWEGDLKSGKGQLSTPQSGLLDKTRYGFNSRFGDEKGTNPEELIAAAHAGCFTMALSAKLGEAGFTPTSLD
    TEAKVDLSLEGGPQLSQIRLKVKAVVPGIDATQFRAIADDAKQN
    CPVSKALSAVPISLEAELG

    >gi|190573242|ref|YP_001971087.1| putative exported thioredoxin [Stenotrophomonas maltophilia K279a]
    MAALRGYALPLLLALLGGAALLLAWPGADADAQPLDAEPMAGFDGGGPWHNSPPLTLKQLRGQVVLVEFWTYTCRNCLNV
    APHVHQWHARYASQGLRVIGVHTPEFAYEGLPGNVRKAIARLDITWPVVQDNQYRIWNAWRNRFWPALYLLDRQGRVVYR
    HYGEGDYARTESEIQRLLASP

    >gi|190573453|ref|YP_001971298.1| putative methylated-DNA--protein-cysteine methyltransferase [Stenotrophomonas maltophilia K279a]
    MTLLFDRFDSPIGVLTIAGDERGLSHVLFPENRHPARGRDDWHYAPDALPEAREQLLQFLHGERNSFDLVLAPRGTPFQL
    RVWQALALIPFGQTWSYLQLAQHLGQPSATRAVGAANGRNPLPIILP
    CHRVIGSNGALTGFGGGLETKAALLRLEQRQAP
    LFG

    >gi|190573513|ref|YP_001971358.1| putative arsenate reductase [Stenotrophomonas maltophilia K279a]
    MSTTVYGLKNCDTCKKATKWLDRFGVPYTFVDYRENKPSPEMLLEWAAQLGGLAAMVNKSSTTWRQLPDNRKAADSEAEW
    KLLLREYPQLIKRPLVVTADGTVSQGFSDNGFKARFGVGDA

    >gi|190573554|ref|YP_001971399.1| putative sulfurtransferase [Stenotrophomonas maltophilia K279a]
    MNPIDPPWTTLVDVATLAAALGEGIRVVDARATASTAVRVVDARSSLADPQAGSGHYLAGHIPGAVYADLNRDLSDLSRV
    GHGRHPLPDSDAFAAKLGQWGIGPDTQVVVYDGSDGSMAASRLWWLLRLIGHSKVAVLDGGIAAWQAAGQPLATGPDEVT
    ALPAYLGRFDTAQIANAEEISARLKHAPGWLVDARAGERFRGEVEPLDPVAGHVPGAVNRPFALNVADGRLRDAQELRVE
    LQGVIGNRDPQQVVLM
    CGSGVTACHLLLAMESAGLSGARIYADSWSGWVSDSSRPVATGA

    >gi|190573598|ref|YP_001971443.1| putative stringent starvation protein A [Stenotrophomonas maltophilia K279a]
    MAASVRMRNTLTLFSSNDDVLCHRVRLVLAAKGVTFDFVPVDPQNPPEDLIDLNPYHSVPTLVERELVLYAASVVSEYLD
    ERYPHPPLMPVDPLSRARIRLAMLRIEHDWVPQVQAIQLGNKTQAEAGRKRLKELLTASLPLFKASKFFLNPEMSLADCA
    MAPIIWRLQSLDVPLPKDGKAIEDYGNRIFRHPGFVRSLTDQEKKLRDLPV

    >gi|190573606|ref|YP_001971451.1| putative Alkylhydroperoxidase/carboxymuconolactone deacetylase [Stenotrophomonas maltophilia K279a]
    MLDWNAYRKELKGRIGEIGKLSPYTVKGYATLANAGAQTNHLDAKTRELIALAVAVTTRCDGCITVHVDAALKHGANREE
    IAEALGVAVSLNAGAALVYSARVMDAVAAHENA

    >gi|190573608|ref|YP_001971453.1| putative glutaredoxin protein [Stenotrophomonas maltophilia K279a]
    MQQIQAEVDRYPLVLFMKGTPQYPMCGFSSRAVQALMAAGAVTLRTVNVLEEPEIRANLPRFSNLPTFPQLFINGELIGG
    CDIVLELFEAGELKRIVEEATQG

    >gi|190573622|ref|YP_001971467.1| putative redoxin [Stenotrophomonas maltophilia K279a]
    MLKRVLFPVVALLLSVLVIALGWQNRQLRQINEQMATQLQDMRLAAHGLELGSRPDALALRTTQQTFVDIGGAREVPQIL
    YFFSTA
    CRYCLASVPQLQQIAAARGNSELVGVGMPPYDQLADYAGKHALRFPIAIDNEAAASTRYRATVTPMLMVLAADG
    RVAYKHVGQLDAQVVQAAVASLAPKPALP

    >gi|190573751|ref|YP_001971596.1| putative AhpC/TSA family protein [Stenotrophomonas maltophilia K279a]
    MNNGDTLDSTTLSLPLALSGGDQATLGDYAGQWLVLYFYPKDSTPGCTTEGIDFNALLPKFKKAGAVVLGVSRDSVKSHD
    NFCARQGFNFPLVSDGDEALCSAFDVIKMKNMYGKQVRGIERSTFLISPDSRIVQSWRKVKVAGHADAVLAELKASQSK

    >gi|190573984|ref|YP_001971829.1| hypothetical protein Smlt2017 [Stenotrophomonas maltophilia K279a]
    MSTIRCDVVVIGAGAAGLMTAITAGQRGRQVQVIDHANKVGKKILMSGGGRCNFTNTGTTPANFLSANPHFCKSALARYT
    PWHFIELVSKHGIAYHEKELGQLFCDISSKQIVKMLVDECQAAGAQIRTECSVQRIEHGSDGFRVHTTQGLFHCASLVVA
    TGGLSIPSMGATGFGYEIARQFGHQVLPTRAGLVPLTLSGKHQERLADLSGVALPIEARCNGKSFQNFMLLTHRGVSGPA
    ILQISSFWQPGDALELDLLPGQDAGEWLRQMKRERPAAELRTVLAEVLPKRLAQRLCEHWLPDRPVRQLDEPVLRQAAQL
    LGAFPLVASGTEGYRTAEVTLGGVDTAEVSSSTMESKRVPGLHFVGEVLDVTGWLGGYNFQWAWASGHAAGGVV

    >gi|190573990|ref|YP_001971835.1| hypothetical protein Smlt2024 [Stenotrophomonas maltophilia K279a]
    MDTDSPRFDNRLLHTLPGDPESGPRRREVLGAAWSPVMPTPVTAPTLLAWAPDVAAMLGFDTAEVESEGFARVFGGNALY
    AGMQPWAANYGGHQFGHWAGQLGDGRAISLGELVAPDGRHWELQLKGAGPTPYSRGADGRAVLRSSIREFLCSEAMHHLS
    VPTTRALSLVGTGEDVVRDMFYDGHPRAEPGAIVCRVSPSFLRFGSFELPASRGETALLRQLVDACIARDFPELEGQGEA
    LYGDWFAQIAVRTAEMIAHWMRVGFVHGVMNTDNLSVLGLTLDYGPYGWVEDFDPDWTPNTTDAQGRRYRFGTQPQVAYW
    NLSRLAQALSPLFADVAQLQAGLAAYQSTFVACTRRDAAAKLGLAAADDDDLGLYQRWQQLMQDGGMDMTLAWRALMRVD
    PAAPDVGVLDAVYYDESRQQAVQAPLQQWLQDYAARLQADPLSASERAAKMAKANPLYVLRNWLAQEAIDRAEQGDLGGV
    HALQDVLRDPYTERAGLEHFAGKRPAWADNRAG
    CSMLSCSS

    >gi|190574028|ref|YP_001971873.1| molybdopterin biosynthesis protein MoeB [Stenotrophomonas maltophilia K279a]
    MSIQELSPAQARERLAHGAVLIDVREAHERAGGMAEGARGVAKGELQADPAAHLPRHDQEILLICQSGKRSADAAQFLLQ
    AGYTHVASVTGGTVAWREQSLPLVQPLASAADRDFYDRYSRHLLLPQVGEPGQRRLQQSRVLVLGAGGLGAPAGFYLAAA
    GVGYLRFADHDRVERSNLHRQIVHTEASVGQLKVDSARERLLALNPSIEVEAVPERVTSENVDALLDGVDVVLDGSDNFP
    LRYLLNDACIKHAIPMVYAAIERFDGQVSVFDAGRQRGVAPCYRCLFPEPPPPEFAPN
    CSEAGVLGVLPGLAGVLQATEV
    LKLLLGIGEPLVGRLLRFDALGMRFRETGIRPDPQCRVCAPDVPFPGYIDYAAFCRGG

    >gi|190574077|ref|YP_001971922.1| putative ArsR family transcriptional regulator [Stenotrophomonas maltophilia K279a]
    MNAATEPPPSPLEALAEIARTLGHAHRLALLEHIAQGERAVERLAELTGLSVANTSQHLQQLRRAGLVQTRRDGKRILYR
    SGDGPLGNLLAALRDYADHQRSEMHGVIHDSLQRRDALEGLTVEQLLEQRSSVVLLDVRPREEFDLGHLPGALNIPVTEL
    RARMDELPRAVHIVAY
    CRGPYCVLSNDAVAMLREAGLTAQRLAAGYPEWKAAGLQVDLPRH

    >gi|190574105|ref|YP_001971950.1| putative transmembrane protein [Stenotrophomonas maltophilia K279a]
    MNLPWSAAAGGALIGAAAVLLFATIGRVAGISGITAGSLRAGKGERAWRWAFLAGLTASAGLVLWWQSVPEASPRALLRD
    ALPAWQLMGAGLLVGFGTRLGNG
    CTSGHGVCGMARASKRSLAAVLVFMVCAMLTTFLVRHGGGPT

    >gi|190574131|ref|YP_001971976.1| putative copper-transporting P-type ATPase [Stenotrophomonas maltophilia K279a]
    MSTPRTAAVPASPSTISLPIEGMTCASCVGRVEAALSRVEGVGSVSVNLATERADIRPSGPVDRAALIQAVERVGYDVPP
    ATVELAVEGMT
    CASCVGRVERALLAVPGVSQASVNLATERATVRGVTDTAALVAAIDKVGYAARPIEAGVQSDDEAAEKK
    DAERAELKRDLIVATALALPVFVLEMGSHLIPGMHEWVMATIGMQASWYLQFVLTLLVLAIPGRRFYQKGFPALLRLAPD
    MNSLVAVGTAAAFGYSVVATFAPRLLPPGTVNVYYEAAAVIVALILLGRFLEARAKGRTSEAIKRLVNLQAKVAHVIRDG
    RTVDVPVNEVLSGDVVEVRPGERVPVDGEVVEGRGYIDESMISGEPIPVEKQPGSSVVGGTVNQKGALTVRATAVGAQTM
    LAQIIRMVEQAQGSKLPIQAVVDKVTLWFVPAVMLAALATFLVWLIFGPSPALSFALVNAVAVLIIACPCAMGLATPTSI
    MVGTGRGAEMGVLFRKGEALQLLKDAQVVAVDKTGTLTEGRPRLTDLEIASGFDHGTVLAAVAAVESRSEHPIARAIVDA
    ATEQGIALPSMVDFESVTGMGVRANADGARVEVGADRFMRDLGVDITLFATLAAELGTQGKSPLYAAIDGRLAAIIAVSD
    PIKPSTPAAIAALHQLGLKVAMITGDNAGTAQAIARQLGIDEVVAEVLPEGKVEAVRRLKATHGHVAFVGDGINDAPALA
    EADVGLAIGTGTDIAVESADVVLMSGNLQGVPNAIALSKATLGNIRQNLFWAFAYNTGLIPVAAGVLYPVWGVLLSPVFA
    AGAMALSSVFVLGNALRLRRFQPPMADAAAATH

    >gi|190574291|ref|YP_001972136.1| putative thioredoxin reductase [Stenotrophomonas maltophilia K279a]
    MSTSLPSRHQRLVILGSGPAGWTAAVYAARANLKPVVITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMARMQAHAERFE
    TEVIFDHIHTADLSQRPFKLIGDSHEYTCDALIIATGATAKYLGIPTEDEFKGRGVSA
    CATCDGFFYRDQDVVVVGGGNT
    AVEEALYLSNIARKVYLVHRRDTLKAEKIMQDKLFKKVAEGKIETVWHHQVEEVLGNDAGVTGVRVKSTLDGSTRDIDAH
    GFFVAIGHHPNTTLFDGQLAMNNGYLEIRSGLGGNATQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDAQG
    KAS

    >gi|190574352|ref|YP_001972197.1| putative mercuric transport protein [Stenotrophomonas maltophilia K279a]
    MADPSNGRGALAAGGLAAILASTCCLGPLVLITLGFSGAWIGNLTALEPYRPIFIGVALVALFFAWRRIFRPARACAPDD
    ACAVPQVRTAYKVIFWIFTALVLIALVFPYLMPLFY

    >gi|190574354|ref|YP_001972199.1| putative mercuric reductase [Stenotrophomonas maltophilia K279a]
    MTEAITLHIDGMTCGSCAEHVKQTLEKVPGVRSASVSYPQRRAEIEASVGTAADVTSLVAAVSALGYRAQLADAPGQPSD
    LLNNAQERLGGEPKREDDEAALHVAVIGSGGAAMAAALKAVEQGARVTLIERSTLGGT
    CVNVGCVPSKIMIRAAHIAHLR
    RESPFDDGIAAASPKILRKRLLAQQQGRVDELRHAKYEGILTSTPTITVLRGDARFKDAHTLTVATADDGMREVSFDRCL
    IATGASPAIPPIPGLKDTPFWTSTEALASDTIPDRLAVIGSSVVAVELAQAFARLGSKVTMLARSTLFFREDPAIGEAIT
    AVFRAEGIEVLDHTQASQVAYEDGEFVLTTERGELHADRLLFATGRTPNTRTLNLDAAGVVVNAQGAITIDHAMRTTVPH
    IYAAGDCTDQPQFVYVAAAAGTRAAINMTGGNATLDLTAMPAVVFTDPQVATVGYSEAEAHHDGIETDSRTLTLDNVPRA
    LVNFDTRGFIKLVSEAGSGRLIGVQAVAPEAGELIQTAVLAIRNRMTVRELADQLFPYLTMVEGLKLAAQTFTKDVKQLS
    CCAG

    >gi|190574362|ref|YP_001972207.1| putative arsenate reductase [Stenotrophomonas maltophilia K279a]
    MNAVIYHNPKCGTSRNTLALIRHAGIEPEVIEYLVNPPSRTRLVELIAAAGLDVRGAIRQKGTPYLELGLHYPALSEDAL
    LDAMLANPILINRPFVQTTMGTRLCRPSEVVLDILPAVHEPFTKEDGEVVIDQDGKRVR

    >gi|190574367|ref|YP_001972212.1| putative thioredoxin reductase [Stenotrophomonas maltophilia K279a]
    MSTTRHIPLLILGSGPAGWTAAVYAARANLNPVVITGLQQGGQLMTTTEVDNWPGDAHGLMGPDLMARMQAHAERFETEV
    IFDHIHTADVTQRPFKLIGDSAEYTCDALIIATGATAKYLGIPTEEEFKGRGVSA
    CATCDGFFYRDQDVVVVGGGNTAVE
    EALYLSNIARKVYLVHRRDTLKAEKIMQDKLFAKVAHGKIETVWHHQVDEVLGNEAGVTGVRVKSTLDGSTRDIEAHGFF
    VAIGHHPNTSLFDGQLTMNNGYLDIRSGLGGNATQTSVEGVFAAGDVADQHYRQAITSAGFGCMAALDAERYLDALKISD
    QQQRKNAA

    >gi|190574440|ref|YP_001972285.1| putative organic hydroperoxide resistance protein [Stenotrophomonas maltophilia K279a]
    MTELKPPSPAMLDRYQGDDVKPLYTGRVRVSGGQAQHGRASGVVRSDDGALAVDLRLPPELGGPGGGANPEQLLAASYAG
    CFHGAMVLVAARAGLLLHNPSIEVAVTFARDPADGLYLLSAEIVVHLPGMDENLACELVRNTERV
    CPYAKMFHRGVSHVV
    HVRVGPQAPPL

    >gi|190574444|ref|YP_001972289.1| hypothetical protein Smlt2511 [Stenotrophomonas maltophilia K279a]
    MTARLDYAAQSPELFKKLGVYSHAAHTASIEGAIIDLVNIRASQLNGCGFCLDMHVKEATLRGERPLRLHHLAAWRESTL
    FSPRERACLAWTEVLTQLPAQGVPDELYARVRGPLSDQEMVDLTHAVMAINAWNRANVAFRTTPGTLDTAFGLDKAGLA

    >gi|190574598|ref|YP_001972443.1| putative carboxymuconolactone decarboxylase family protein [Stenotrophomonas maltophilia K279a]
    MSRVPLIDAANTTADRQALLGQVHAAFGATPAMFRAVANSPAALQSMWGSFGALGGGRLSPLLGEQIAVAIANRNACEYC
    LAAHTALGRKAGASGEQMAAAQIGQSSDPATSAALDFVLKVVDQRAQIADGDVQALRAAGFDDEQIVEILAHVALNLFTN
    YVNVAFDVPVDFPKVALR

    >gi|190574626|ref|YP_001972471.1| putative thioredoxin [Stenotrophomonas maltophilia K279a]
    MPFMRDHLSAEPDRLDVEAQVGWLLLEFGAPWCGHCQAAQPALQAFVEANDLPHWKIEDGKGRPLGRAFKVKLWPTVVLL
    HDGDEVARVVRPLDSADLMSLQGALPD

    >gi|190574643|ref|YP_001972488.1| putative OsmC-like protein [Stenotrophomonas maltophilia K279a]
    MENVMAYARIVSTADNYLHHISNGTFAVDADEPASLGGQGKGFAPFDLYLASLAACTAITLRMYAQHKGWELGEFHAELR
    SERDAGGRFHVHRVLHASAELSDAQWQRLLEVVEKTPVTLVMREGARITSERGAAA

    >gi|190574738|ref|YP_001972583.1| hypothetical protein Smlt2827 [Stenotrophomonas maltophilia K279a]
    MSKLNQRAPRRFLQWPVTLPFEMLPMRVALSVLLLASALSACTPAPVSTANSAEAPAPASAIAWRQGDVDDAFAEAADSG
    KPVLLYWGAVW
    CPPCNQLKAGLFKDPAFIALTSKFVPVYLDGDEEGAQAWGERFGVRGYPTLIVLDPQRNEITRVAGGND
    AAELTRALTVAAGRRSAVAATLATALATPDRLAAEDWQVLGDYGWEVDANRLAGERKSQVVLRQLSKAAPDAALQRRFAL
    LALATAEKPDASPTEVRELLQAVLAQPAEVRRNRELLGYAGVQLVKQASAGPATSNTLGQQLLVALERADAERGDRADDA
    LSRALTEVSLARQQQPKGALPAALVDRVKQRVASADAAATDAHARQATISSAVHALREVGDDAGAEALLLAELKRSEQPY
    YYMPELAELAEQRGDTAGALEWLKRAYDGAQGPATRVQWGVLYVEGLLKLAPDDAPRIEQATASLIAELEAQPSGYHQRT
    RQRFERLAGQLKAWSGKHQGAETLARLQQRMQQACGDQVDGACKDWLS

    >gi|190574747|ref|YP_001972592.1| hypothetical protein Smlt2836 [Stenotrophomonas maltophilia K279a]
    MRSEALRALLLACAVLVAVPAMAADLHAQVSASLMRPEQRSLRPMQWTPPPKLVALYFGADWCAPCHAFVPTLRSVRDAL
    REAGADTEVVYVSLDESDAALRRYMHAQDMPWPVLDPRRAARMPALQALAGLAPPNLVLIDADGTVLANGWQGRRYEGLQ
    PVLKEWTKRACAQEQARCPPGL

    >gi|190574750|ref|YP_001972595.1| putative thioredoxin [Stenotrophomonas maltophilia K279a]
    MQIIDATTPEQFQQLLAEHPRVLVDFHKDQCPGCRMLEMSLHRVANSVAGQGTTLLRVQLEVLGEAFFRELGLRQTPTLS
    LFRDGDERTRLAGFQSPQQIEAAIALHL

    >gi|190574828|ref|YP_001972673.1| putative thioredoxin DsbA family [Stenotrophomonas maltophilia K279a]
    MSSVPSPATAAPVVDFFHDVVCGWCFVLAPRLQQVSAELGIQVRHRSFVLQDSRAQMVEVFGSMERAKAIILRHWTDCAA
    HEDTARIDIEGMRAQDFEYPSGWLGALACQAAGMLGGNDAHGAMFDAVQWAHLHQHRNIGDAEVLLDIAESLGHPRGAFA
    DHMRSDAVRQRVQADRAEAAALGIRSIPTVIGGNGLRLQTLPLPHLRQALAPLVAA

    >gi|190574849|ref|YP_001972694.1| putative thiol:disulfide interchange protein [Stenotrophomonas maltophilia K279a]
    MLALAACSQAQTPPGKAATASATTAPASAAKGDRPAVLKGIEKHGFEVVAEFDAPDGLRGFAGVVGGQQPAAAYVTADGK
    HVLVGSLFDAEGNDVAAEAVEKLVAAPMSAKMWTKLEASAWVRDGKADAPRVVYTFSDAN
    CPYCHKFWEAARPWVDAGKV
    QLRHIMVGVIREDSPAKAAAILSARDPSAALLENEHQFDRGGIKALPNISREIAGKLDANQVLMLEMGFQGTPGILFQDA
    QGQVQRRAGLPQGDDLQTVLGPR

    >gi|190574850|ref|YP_001972695.1| putative thiol:disulfide interchange protein [Stenotrophomonas maltophilia K279a]
    MSSVGPVPIPVVLILMCTLLAMTVARLWPRRAVGMPLPSAAGIVLDMLLIGLLCGRVSFVVLNFALYRSEPWSILQVTDG
    GYHLMVVLVAGLSWGLWRLRPWRQLRAPVLTSALVGVLFWVAGGQLLSAWQERQMPLPALQVADLQGDRIDLQQFRGKPL
    VLNLWATW
    CGPCRREMPVLATAQQAHDDVQFVFLNQGETLDEVQGFLAGERLMLGNVLLDDDAAASTVLGIQAYPSTLFF
    GADGRLRELHLGELTAAGLEHKLRRLR

    >gi|190575043|ref|YP_001972888.1| putative iron-sulfur cluster assembly protein [Stenotrophomonas maltophilia K279a]
    MAVSLTPIAFERVQRFVAQTPGALGLRFGVTKTGCSGWGHITDLARDEREGDTVFEQDGVKIYVDAKSLALVDGTVIDFG
    KHGLSETFTFSNPNATAECGCGESFTTDADKA

    >gi|190575072|ref|YP_001972917.1| putative vitamin B12 transport protein [Stenotrophomonas maltophilia K279a]
    MPLPTVMPRRLRGLSLLTLLVAGLAGSTQVLAADLLDLDYRPLASKQQVNLQQRYHGQVLLVVNTASKCGYTPQYEGLEA
    LQKRYAGRGFAVLGFPSNDFKGQEPGDEKQIQDFCTLTYGVKFPMFEKVHVVGAEATPLYQRLTAATGVAPGWNFHKYLV
    GRDGKVIAQFASKVTPDDPQLTAAIDKALAAAAAH

    >gi|190575086|ref|YP_001972931.1| dihydrolipoamide dehydrogenase [Stenotrophomonas maltophilia K279a]
    MAEQFDVVVIGAGPAGYHAAIRAAQLGLKTACIDAALGKDGKPALGGTCLRVGCIPSKALLDSSRQFWNMGHIFGDHGIS
    FKDAKIDVEAMVGRKDKIVKQFTGGIGMLFKANKVAAYYGFGELQPGNVVKVTQHDGSIVELKGTNVIIAAGSDSIELPF
    AKFDGETIVDNVGGLDFTEVPNRLAVIGAGVIGLELGSVWKRLGAEVTILEAMPEFLAAADAEVAKTAAKEFKKQGLDIK
    LNAKVSKTEITGKGKKKEVIVTYTDAEGEKTLTVDKLLVAVGRRAATKGLLAEGTGVKINERGQIEVDAHCHTGVNGVWA
    VGDCVRGPMLAHKGFEEGIAVAELIAGLPGHVNFDTIPWVIYTEPELAWVGKTEAQLKAEGIPYKAGSFPFAANGRAVAM
    IEPAGFVKILAHAETDRILGMHLVGANVSELVHEGVLTMEFSGSADDLARICHAHPSLSEVIHDAAMAVSKRAIHKAN

    >gi|190575106|ref|YP_001972951.1| putative arsenate reductase [Stenotrophomonas maltophilia K279a]
    MPVTIWHNPACSNSRGALKLIRDAGFEPVVIEYLGNPPDVATLRQVLAESGLDAQALVRSKEAQFAELGLEGADEATLLA
    AMAEHPRLINRPVVRTDKGTRLCRPPETVLEIL

    >gi|190575111|ref|YP_001972956.1| putative carboxymuconolactone family protein [Stenotrophomonas maltophilia K279a]
    MSNHTSPRVPYTRLAAEAFKGLLATSQAVHDSSIDPTLMELVFLRVSQLNGCGYCMDMHGTALRKGGIEPRKLDTLPAWH
    ESRFFDERERAALGWAEALTRLTDGAPSQAAFDALAPHFDEKGISDLSMGIAVINAWNRLGAGLLPPLPA

    >gi|190575114|ref|YP_001972959.1| putative glutathione peroxidase [Stenotrophomonas maltophilia K279a]
    MTTAYDFSFRDLDGQPQALAGYRGHPLLLVNVASRCGFTPQYTGLEQLWQEYRERGLVVIGFPCNQFGAQEPGDAAQIRQ
    FCSLDYPVSFPLSEKIEVNGEGADPLWAWLSREKRGLLGSARIKWNFSKFLVDRQGRVAARFAPTTRPEQLRSAIEALL

    >gi|190575159|ref|YP_001973004.1| putative cytochrome C-type biogenesis protein [Stenotrophomonas maltophilia K279a]
    MSESPAPRPSRPLPPVAIVIGVLFFFGLLGLMIYGVMKSGDPQRDVLPSALIDKPAPAFALPVLHDPEMIVRSDELRGAP
    YLLNVWGSW
    CAACREEHPVLTRFAESKRVRVIGYNWKDEPTDALHWLEQLGNPFMVVLSDVEGRTAIDWGVTAAPETFLV
    DGSGIVRWKYSGAMTQRVVDEKLIPALEKIEKAQGNAGSTLHTAP

    >gi|190575224|ref|YP_001973069.1| putative O6-methylguanine-DNA methyltransferase [Stenotrophomonas maltophilia K279a]
    MDSTATTAFDARVERVCRHLQASLDEPSLQELADIAGCSPTRLHRLFKQATGLTPKQYAAALRADRLRTGLEQQERITDA
    FHDAGFGSSGRFYENAPKLLGMTPKQWRAGGRGEVIHFALAESSLGSVLVASSATGVVAILLGDDPETLLQSLQQRFRQA
    ELVGADQGYEQLVAQVVGLVEDPSRGATLPLDIRGTAFQQRVWQALQQIPRGQTASYADVAARIGAPRSSRAVARACASN
    PLAVAVP
    CHRVVRRDGDLSGYAWGLARKRELLRREKASTA

    >gi|190575324|ref|YP_001973169.1| putative glutathione reductase [Stenotrophomonas maltophilia K279a]
    MSTAPYDYDLIVLGGGSAGLAGAIRAAQHGKRVALLEPGELGGTCVNVGCVPKKAMWLAADLHERIGLASAMGFDVKARP
    ALSWKELVIHRQAYISNIHTSYHKRLDETGVVRIPARGHLLDAHTVACSDGVRYSAEHILIATGAHPLRPDIPGAELGLV
    SDDFFDLRAAPAEVAIIGGGYIAVELAGLLQALGSRVSLLVRGQRLLDRFDYELTDQLAENLKQQGVRIHFGYRLRELQR
    DGERVRAFGHDGPLDSVFDAVFFATGRRGNSRDLGLEALGIGIGEHQQVQVDEWQTTCVPSVHAVGDIAGKVGLTPVAVA
    ASRRLMDRLFGGRPQSKMDYENVASVVFSHPPLGAVGMSEEEARARFDQVSVYHSRFRPMLQGLANGTQRSLFKMVCAGP
    EERVVGIHLLGEAADEILQGFAVAVKMGATKAQFDDTVAIHPTSAEEVVLMR

    >gi|190575354|ref|YP_001973199.1| putative thioredoxin protein [Stenotrophomonas maltophilia K279a]
    MTETTYVFDATTATFEAEVLQKSLQTPVLVDFWATWCGPCKTLGPMLEKLAAEYNGAFELAKVDVDKEQQIAAAFQIRSV
    PTVFLVKGGQLVDGFPGAIPEGQLREFLAQHGIVPADVGDTAADDEAPLDPQAQVDVLRAQIAAEPDKDELKLDLALALL
    QIGGVDEAGTLIDGLPANLATDDRAVRARARLSFAAALKDAPAAEVLDARIAANGNDLKARHLRGVQLLLGGHDEAALAQ
    FLDMLRIDRSFEEGLPRKALIDAFNVISDEDLVGQYRRRMASLLF

    >gi|190575405|ref|YP_001973250.1| hypothetical protein Smlt3539 [Stenotrophomonas maltophilia K279a]
    MRIDIYSDVVCPWCWIGKHRFQQGVQLLGADAPELDIHWQPFQLDPDADDTPVPLREAYVRKFGGVERTEQILGQTQTTA
    RAEGLPMDFSRGQVRVTTLPAHRVLWLAGQHGVQDAVGEALFRAHFELGQNLADSAVLIEAGVAGGLDGGEIAQMLASDR
    GLAEVEAKLAEAHALGISSVPTFVIDGKWAISGAQPPEAFANALRQIAAEQGAPATPAGDDEACGPDGCKV

    >gi|190575461|ref|YP_001973306.1| putative redoxin [Stenotrophomonas maltophilia K279a]
    MTIHVGDRIPEVTLKRIREGIETLDTHSLFDARKVVLFAVPGAFTPTCSARHLPGYVEKFEAFRQRGINVYCMAVNDPFV
    MKAWAADQSVPDGLLMLSDGNAELTRALGLELDASASGMGIRSRRFALYVDDGVVREAWVEQPGQFEVSSAEYVLEHLPT


    >gi|190575698|ref|YP_001973543.1| putative selenide, water dikinase [Stenotrophomonas maltophilia K279a]
    MVTHAQSPAPSTADAPQRLTSLAHGGGCGCKIAPGVLSELLRGVPALPAPAELLVGRETSDDAAVYRLDDRQAIVATTDF
    FMPIVDDPFDFGRIAATNALSDLYAMGARPLFALAIVGMPINTLPQDTIRGILQGGERACADAGIVVAGGHSIDSVEPIY
    GLAAIGVLDPQRLKRNADARAGDVLVLGKPLGVGVYSSALKKEVLDADGYRQMIASTTRLNTVGVPLAALDGVHAMTDVT
    GFGLLGHLLEVCRASGVAAEVDSAQVPLLPQALELLQRGCVTGASHRNWASYGAEVRFADGLPAHWQPLLTDPQTSGGLL
    VSCAPEAADAVLACFHDAGFGQAAVVGRLSEGAPGVSVV

    >gi|190575803|ref|YP_001973648.1| putative glutaredoxin [Stenotrophomonas maltophilia K279a]
    MSLDPALRSRIESILNANRVVLFMKGQPSMPQCGFSAKAVGALQDLGVEFAHVNVLADQEIREGIKVYGDWPTIPQLYID
    GELVGGSDIVLQMAASGELSSVLGLAAPDRTPPSITVTPAAVEMLKGALADAPGAALQLSIDAGFQPNFQLAPHDEGAIA
    AESNGLRVQFDLASARRANGITIDWVDDIRGKGLAIDNPNAPKPVQEISVRDADDLVRAGNITLVDVRPAEEREIAAVGV
    PFKSFDGNGRAELEALPKDTALAFM
    CHHGGRSAQAAEQFRALGFTKVFNVTGGINAWSEEVDNGVPKY

    >gi|190575836|ref|YP_001973681.1| putative thiol:disulfide interchange protein [Stenotrophomonas maltophilia K279a]
    MRLISRLLLSVLVLLPLAACAATPANAPLVEGKDYERIAQPGPFQPLAGKIEVVEVFGYTCPHCAHFEPQLEAWAAKLPA
    DVRFTPVPAAFGGAWDAWALAYYAADEVGVAKRSHAAVFKALHEQGSLPMQNVSADELATFYKAYGVTPDRYLQALRGDA
    VQKKVDAARAFAQRTRIPGTPALIINGQYLVRGNSFDDQLRIASALIAQARAARGR

    >gi|190575837|ref|YP_001973682.1| putative thiol:disulfide interchange protein [Stenotrophomonas maltophilia K279a]
    MKIRYALALAALLPILAACKADDGSTNTTAAPAEPAAAPAATTEPAAAPAAGSEGAAPAAAEGEKAPAETAPATAPAPTT
    AALTGPAPVEGADYQVIPNGQPFQPATGKIEVTEIFGYV
    CPACAAFQPLVGPWKAGLPSDVNFVYVPAMFGGTWDDYARA
    FYAAQTLGVQEKTHEALYAAIHSQKTLKGERGRDSVEDIAKFYGAYGVDPKQFAATMGSFAVNAKTNSAKQFAQRSQISG
    TPSIIVNGKYLVKGKSFPDMLRIADHLIARERGAAQAH

    >gi|190575951|ref|YP_001973796.1| putative dihydrolipoamide dehydrogenase [Stenotrophomonas maltophilia K279a]
    MATIEVKVPDIGDYSDVPVIEVLVAVGDTVKKDQGLVTLESDKATLEVPSSAAGVVKEIKVKLGDTLSEGAVVVVLDAEG
    AAEAPAKAAAPAPAAAAPASKPPVTPSHRAPAEPAAPKPALSSGKPADIECEMVVLGSGPGGYTAAFRAADVGLDTVLVE
    RYASLGGV
    CLNVGCIPSKALLHAAAVIDEVAHAGDFGVEFGKPTITLDKLREYKEKVVNQLTKGLAGMAKQRKVRNVQGV
    GKFISANELEITVADGSTQLLRFQKCIIAAGSQAVKLPNFPWDDKRVMDSTDALELAEVPGSLLVVGGGIIGLEMATVYS
    ALGSKVTVVEFMDQLMPGADKDLVKPLADRLKKQGIEVHLKTKASGVTADAKGITVTFDAAEEGQAPALAQGTFDRVLVA
    VGRSPNGRKIDAEKAGVQVTDRGFIPVDRQMRTNVPHIFAIGDIVGNPMLAHKATHEGKLAAEVAAGHKKEWVARVIPSV
    AYTNPEIAWVGVTETEAKAKGLKVGVAKFPWAASGRAIGIGRTEGFTKLIFDEETHRIIGGAIVGVHAGDLLAEIGLAIE
    MGAEAEDIGHTIHAHPTLSESVAMASEIYDGTITDLYMPKKK

    >gi|190576046|ref|YP_001973891.1| putative transmembrane Thiol:disulfide Interchange Protein [Stenotrophomonas maltophilia K279a]
    MKTLFARGAALCALMWLSLPAFALDEKDLLPVDQAFALTASAPERGQVQLQFKIAPGYYLYRHRTSVKADPAFNAGALQM
    PKGDKHHDDFFGEVETYRERLQATLPGTPTEAASTISLEVRYQGCADAGVCYPPQKRVVQVTLPGSGAQAAAPAARAGAA
    SPFNNPLAGAGNSGGLRLPGAASNSQALPLPSEQAFGFDAIASDGNTLLLRFSPAPGYYLYRDRTSLKLEGSTGVQAGTP
    RWPAAQSHRDEHFGDVSVYFNQVEVPLPLRRTVADAVDGTLVVTFQGCQTDGICYPPMTRRVKLSIPAGKVSASADQAPP
    RNEVISPLAAAPREGANGAPLRLLPTVPNTDAAPPAVAGTVDGNEFAADARGDNALRTRPPATTPNPDRSFVWVLLLALA
    GGLVLNLMPCVLPILSLKVLSLAQSGESPQRARSHALWYTLGVLVAFAVIGALMVGLRAIGNAVGIGFQLQHPGVVAALA
    YIMFAVGLSLSGVFTLGGGIGNLGQSLASRSGPAGDFFTGALACVVGSACVGPFMGGAIAYAFIAPPLKAMTVFLFLGLG
    LALPFLLIGFVPALARRLPKPGPWMETLKHVLAFPMYATALWLLWVLGKQRGVDGMALVLGGLLLFAFGLWLFERNRWTG
    SRAVTLLGVLLAIGALVPAWGVTQLAAPARAAQAASDNVVEYSPQLLDRLRADNRVVFVNMTADW
    CVSCKANERAVLSRP
    EFKDLLKRTNAVYMRGDYTNVDPQITTFLEEHKAVGVPLYVVYGPGAPPTVLPTLLTQAVVEEALLRTAR

    >gi|190576047|ref|YP_001973892.1| putative thioredoxin-like protein [Stenotrophomonas maltophilia K279a]
    MKWQRPALLWTAVLAAGLGLWAGHRLAPAPVAPEAMPAAPAVAAAAPALQVGDSLPALSLPDLEGRPLDLRQHAGGRPLL
    INVWASW
    CAPCVEEMPELARFAHIQGEHGVQVLGLALDTPEDVRGFLQRVPVDYPIVIETPGPRDASVQLGNTQGLLPYS
    VLFDAQGRLVKAKLGPFAHGEIDSWVK

    >gi|190576090|ref|YP_001973935.1| putative thioredoxin 1 [Stenotrophomonas maltophilia K279a]
    MSDKVVHVGDADFDSAVLNSKEPVLVDFWAEWCGPCKMIAPALDELADAYQGRAKIAKVNVDHNRALAAKYHVRSIPYLV
    VFKDGEKVGEQIGAVGKAQLAGLLDKALA

    >gi|190576115|ref|YP_001973960.1| iron-sulfur cluster insertion protein ErpA [Stenotrophomonas maltophilia K279a]
    MSTLVSLPGATPAAAPDYQSLERPLNFTESAAAKVKSLIQEEGNPDLALRVYIEGGGCSGFQYGFEFDENRAEDDLAVQT
    SGVTLLVDPLSLQYLMGAEVDYTESLTGAQFVIRNPNAKTTCGCGSSFSM

    >gi|190576324|ref|YP_001974169.1| putative FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Stenotrophomonas maltophilia K279a]
    MNPDVLIVGGSYAGIAAGLILARARRPVTVIDAGSPRNRFASHSHGVLGLDGISGAELLKTARQQLLDYPTVRWVHAEAV
    QATASAEGVEVRTADGQVLAARKLLLASGIADQLPALPGLAERWGSTVLH
    CPYCHGYEVGGGAIGLLGGHPMSASKAPLF
    ADWGNVTFFSMGLDITDEERAAMQQRGVQIETSPVLGVQGDQPTWLEVELADGRRIAQRALFVPATQAMATPLVQQLGCT
    LVESPLGVLIEVDAMKHTSVPNVYAAGDATTVGNITLAMAEGVRAGIGVHHALVAEDSVPR

    >gi|190576458|ref|YP_001974303.1| putative glutathione peroxidase/vitamin B12 transport protein [Stenotrophomonas maltophilia K279a]
    MSTSIQDISLTTIDGQPSSLADYQGKVLLLVNVASKCGLTPQYEGLQALYAEKHAQGLEVLGFPANNFLGQEPGSEAEIQ
    QFCQLTYDVSFPMFSKISVAGDDTHPLYQQLTAAQPQSIGEGPLRERLASKEIPIHAAPAVLWNFEKFLVGRDGKVIARF
    APDVAADDARLREAIEAALAA