Starkeya novella DSM 506 uid48815

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|298290077|ref|YP_003692016.1| Peroxidase [Starkeya novella DSM 506]
    MTIRLGDVVPDFEAETTEGPIRFHEWLGNSWGVLFSHPKNFTPVCTTELGQVARLKPEFDRRNVKVIGLSVDPLDAHAKW
    SEDIAETQGYAPNFPLIADQDRKVSDLYDMIHPNASDTMTVRSVFIVGPDKKLKLSLTYPASAGRNFDEILRVIDSLQLT
    ATHAVATPANWKNGDDVIIVPSVSDEAAKEKFPEGWKTLKPYLRVVPQPGK

    >gi|298290255|ref|YP_003692194.1| UBA/THIF-type NAD/FAD binding protein [Starkeya novella DSM 506]
    MTTTDAPAPARASVFSADEVERYARHLVLAEIGGPGQQKLKKASMLVVGAGGLGAPALLYLAAAGVGRLVVIDDDIVSLS
    NLQRQVIHTTERIGQPKTESAGALVAALNPHVVFEGVDARITADNAMELVSSVDVVIDGSDNFSTRYLVSDACALAGRPL
    VTAALGRFDATVTTLRPHEKNADGTPNPTYRCLFPEPPPAGTVPT
    CAEAGILGALAGVAGSLVALEAVRAVVGFGEGLVG
    RLLMIDTMSMRFETLSYGWDPDNPLTGESPTITDLSAHRR

    >gi|298290319|ref|YP_003692258.1| thioredoxin [Starkeya novella DSM 506]
    MGVEKVSDQSFESDVIKSDGPVLVDFWAEWCGPCRMVAPVLDEVAGELGDKLKIVKLNVDENPATASKYGIMSIPTLLLF
    KDGQLASRQVGAAPKAKMLQWINSAI

    >gi|298290336|ref|YP_003692275.1| transcriptional regulator, AraC family [Starkeya novella DSM 506]
    MLAPNLDAAHPLEIAAHDYEIVRRAVEYVNLRFRDQPEVEEIARAAGVNPRALTDLFRRWCGLTPKDFLQAVTIDAARRV
    LTESDNVLDAAYELGLSGPGRLHDLFIVHESMSPGEWKTGGAGLVVRYGFHASQFGMALAMVTPRGLCGLAFADEGEEDK
    ALADMRRRWPNALYIEDPIATAPYAARIFDSQKWSLDDPLRIVFIGTDFEVRVWETLMRIPLGKATTYSNIASCVERPSA
    ARAVGAAIGKNPMSFVVP
    CHRVLGKNGDLTGYHWGLTRKRAILGWEAGQLCK

    >gi|298290487|ref|YP_003692426.1| methylated-DNA/protein-cysteine methyltransferase [Starkeya novella DSM 506]
    MDPLAQHYLVFETARGFCGLAWSAAGITRFQLPTSSAAATERNLLRRVPVARPGEPTPEIAETVAAVRRYFDGETVDFSD
    VRLDLGEQEAFFADIYAALRRVGWGATTTYGALAKELGAGPEAARDVGQAMARNPVPLIIP
    CHRVLAAGGKLGGFSAPGG
    ADTKAHMLELEGVDLRPPAPAQGSLF

    >gi|298290489|ref|YP_003692428.1| heavy metal translocating P-type ATPase [Starkeya novella DSM 506]
    MADHEHEAKPSGASCCGSHAKAPSEKPAEAADSCCGSHDHDHAGHDHSHHGHAHAQGHTHDHAGAAAHMAKDPVCGMDVD
    PHTAQHRAEHGGRTYYFCCAGCRTKFVADPEKYLGERAPVAPVPEGTEYTCPMHPEVRQIGPGS
    CPICGMALEPVLVSLD
    DGPNHELVDMTRRFWIGLALAVPVVVLEMGGHFLPAVHHFIPPQLSNWIQLVLATPVVLWAGWPFFERGWQSLLTRNLNM
    FTLIALGTGVAYLYSLVAVLAPGVFPPAFRDAQGAVAVYFEAAAVITVLVLLGQVLELRAREQTSGAIKALLDLAPKTAL
    RINPDESEEEIPLDQVAVGDKLRVRPGEKVPVDAQVVEGRSAVDESLVTGESMPVTKTEGDHVIGGTLNRSGGLVVAAEK
    VGRDTMLARIVQMVAEAQRSRAPIQRLADQVSGWFVPLVVLCAVLAFAAWAVWGPEPQLAHALIAAVAVLIIACPCALGL
    ATPMSIMVGVGRGAQMGVLIKNAEALERMEKIDTLVVDKTGTLTEGQPSVTAIVTSEGVEEAEALRFAAAVERPSEHPLA
    RAIVTAAQDRSLDIPKVRGFDSPVGKGAYGLVDGKRVVLGSAGFLKELGIATDALAGQADELRREGATAIFVGIDGKAAA
    VVAIADPVKATTPQALADLASEGIRVVMLTGDNRTTAEAVARRLGITEVEAEVAPDQKAAVVEKLKREGRVVAMAGDGVN
    DAPALASADVGIAMGSGTDVAIESAGVTLLRGDLGGIVRARRLSEATMSNIRQNLFFAFIYNAAGVPIAAGVLYPVFGLL
    LSPMIAALAMSLSSVSVIANALRLRAAKV

    >gi|298290677|ref|YP_003692616.1| methionine-R-sulfoxide reductase [Starkeya novella DSM 506]
    MNQTSGRPKVVKTDAEWRALLTPEQYRVTRGHGTECAFSGPHLSQKEPGTYSCVCCGAPLFRSDAKFESGTGWPSFFQPV
    DAEAVTEYHDHSYGMHRIEVRCATCDAHLGHVFPDGPRPTGMRY
    CMNGVAMTFKADEPAAQGAAS

    >gi|298290828|ref|YP_003692767.1| peroxiredoxin, Ohr subfamily [Starkeya novella DSM 506]
    MNILYSTRVAATGGRKGTIRSEDGILALDLAIPKELGGMGGATNPEQLFAGGYAACFENALLRIGRQAGHRFADGNVEVV
    AQIGLSRNEADAFMLSATLFVTIAGVDQATAEELVRGADGI
    CPYSNAIRGNVAVAKSVTVR

    >gi|298290831|ref|YP_003692770.1| methionine-R-sulfoxide reductase [Starkeya novella DSM 506]
    MLTRRFLMLTGAAGLTAAWLRPGRDARAAETYPVTYTDAEWRQRLTPQQYTVLRKDGTERPYSSPLNDEHRRGTFACAGC
    DNELFSSATKFDSGTGWPSFWAPLEKAVGETRDVSFGMVRTAVHCARCGGHLGHVFDDGPKPTGLRY
    CMNGVAMTFKPVA
    A

    >gi|298290832|ref|YP_003692771.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Starkeya novella DSM 506]
    MLLFVLAYLGGVLTIVSPCILPVLPFVFARAGQPFLRSGLPMLLGMAVSFALVASLAAVAGGWAVAANQYGRLAALVLLA
    LFGLALLIPSLAEKATAPLVALGGRLSQSADGSAGGIFPSVLLGVATGLLWAPCAGPVLGLILTGAALNGANVGTSLLLL
    AYAAGAATSLALALLVGGQVFAAMKRSLGVGEWMRRGLGALVLVAVGAIALGLDTGFLTRVSLAGTNALEQGLIDRLNPP
    PAGGPAMMASGDAMMSANPAMSSDAPAMMSANPAMTGAPAMTGSNPAMMASSNAAMMSANPAMMAKSDAAAGTNGAPSLP
    VEGMLPSLKGATGWLNSAPLTAESLKGKVVLIDFWTYS
    CINCLRTIPYVRAWAEKYKDQGLVVIGVHSPEFAFERDVDNV
    KKAVADLKITYPVAIDNDYAIWRAFKNQYWPAHYFIDAQGRIRYHHFGEGGYEESERVIQQLLAEAGRRDVTSGTVDVKA
    TGAEAASDMKDVMSPETYVGFERAENFVSPGGAAQGEPKDYAAGDPRLNEWGLVGKWTIGTEQASLDAPDGAIVYRFHAR
    DLHLVLGPGANGKPVRFRVTIDGKPPGDAHGMDVDAQGEGVVTGQRLYQLIRQPGEIGDRTFEIRFLDPGVEAYAFTFG

    >gi|298290833|ref|YP_003692772.1| peptide methionine sulfoxide reductase [Starkeya novella DSM 506]
    MKASSFLFVGAALLALAGAARIIPASAEEGIAIPAPTLDETAPKDQEVAVLAGGCFWGVQGVFQHVEGVTSAVSGYAGGD
    QSMAQYELVGTGSTGHAEAVKVTFDPRKVSYGKILQIYFSVAHDPTQLNRQGPDRGTQYRSAIFALSDEQAKIAKAYIAQ
    LNQARVFSAAIVTKIEPGKPFFPAEAYHQDFLTRNPTYPYIVINDLPKIENLKRLFADRYRDKPVLVADMGKPATQ

    >gi|298290909|ref|YP_003692848.1| glutathione-disulfide reductase [Starkeya novella DSM 506]
    MDQFDVDLFVIGGGSGGVRAARIAANHGAKVKIAEEYRLGGTCVIRGCVPKKLFVYAAQFAHDFADAAGFGWTVEGVSFD
    WKTLIANKDKEIARLEGAYRANLERSGVEIVKQRAVIEGPHLVRLADATGVTAKVILIATGGRPNIGLDMPGRELGITSN
    EAFHLERLPERIIIQGAGYIALEFASLFNGLGSKVTVVHRGDKVLRGFEGELQERIAAELASAGIAFEFGATIESIHEGE
    GEGEKRVRLNDGRDLFADEVMLAIGRVPNTVGLGLDAVGVHLNDAGAIAVDANSRTNVPSIYAVGDVTDRVNLTPVAIRE
    GHSFADSVFGGQPWEVDYENIPTAVFTEPEIGTVGLSEEEARARGYKLDIYKTDFRPLKATLSGSTSRTFMKLVVDQMTD
    KVLGVHLIGESSAEIVQIAAIAMNIGATKADFDRTMALHPSSAEELVTLRTKHATSDKVIPEVSAEATPAI

    >gi|298290936|ref|YP_003692875.1| Rhodanese domain protein [Starkeya novella DSM 506]
    MSQPNPFGGVIEHLSVEEVKAGLEDGSILLVDVREPNETAAERIPGAVEFPLSTFDAAVLPDPGEKTLVFSCRSGQRSQK
    AAAAAQAAGVDLHRHMAGGILAWKDAGFPTDKD

    >gi|298290977|ref|YP_003692916.1| hypothetical protein Snov_0974 [Starkeya novella DSM 506]
    MDMRLTRRSLALGASAALLPLGRARAATRLGDDGLYVQDWYVESFLDLAEDEAAAKAKRKILALQWSQRGCPLCKRLHTD
    YFADAAIEAYVREHFDVVHLDIYGSREVTDFGGQTLSEKALAGRYAVRATPTFQFFAARDGKVAEVARMPGLLPKPEFLA
    MFRYVEAGAYESAGFEAWMAAQKAL

    >gi|298290987|ref|YP_003692926.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Starkeya novella DSM 506]
    MTEQLISGADSARSAPRPLRIGDAAPVFSARSTQGQIRLSDYRGRWLLFFSHPADFTPVCTSEFIALARLAPQFEAAGFA
    LLGLSVDSLFSHMGWLRAIRGAFNVEVPFPVVEDTSLVISRAYGMLDETAQDSSTVRASFFIDPDGIVRALSWYPMSVGR
    SAQEMLRLAIALKRVEKGDAVTPEGWQPGDPVLRPLSDETLLSDDDPAWFCRTIEPR

    >gi|298291038|ref|YP_003692977.1| Rhodanese domain protein [Starkeya novella DSM 506]
    MTSPRPEPPLTRLAWLGIAGLAVALLALSPSSGRGDPAVPEPSGYRMDDYRAPTPASLNGARVIDTNEAERLWRGKAALF
    VDVMPRDVKPANLPPGTIWRDKKRDHLPGSVWLPNVGYGALSAGMDAYFRRGLGTLTEGRHDAALAFYCQTD
    CWMSWNAA
    KRALEYGYTNILWYPGGSDGWAKAGLPLEAATPLD

    >gi|298291062|ref|YP_003693001.1| arsenate reductase-like protein [Starkeya novella DSM 506]
    MTVTIYGIKNCDTMKKARAWLDAHGIAYAFHDYKASSVDAAHLKAWAGKVGWEVLLNRAGTTFRGLPDADKANIDEAKAL
    KLMQANTSVIKRPVLDVDGTLLVGFKPEIYEKQFA

    >gi|298291232|ref|YP_003693171.1| thiol:disulfide interchange protein-like protein [Starkeya novella DSM 506]
    MNPIDPIHLPDRPALSRRALLLAPITLTAFSTAATAVVRRTRVASVADFGAALGFLGQRHPNVLVYVSARWCPICRTIDA
    TVLTSARVRQALRDVPLLEVDVTAMGPQARALMQLVAAEGPPTLFVVDARVRAERPGTRLVGVFTEAVLLERLRPFTG

    >gi|298291233|ref|YP_003693172.1| Redoxin domain protein [Starkeya novella DSM 506]
    MSAYSLGPFVFAGDRLAAIVGIFAFLLVATFLDRRFAPGLGRAAWWALLTGLMGARLGHVVQHWGSFSQEPIRAFAFWQG
    GFAPLPGAVLASAAGAMAIRSWRAAAALVVSAAFGLLFWAGTGELTRATIGKAAPTVALAQLDGPPLAISDLRGRPSVVN
    LWATW
    CPPCRREMPLLARASAENREAAFVFVNQAEGPDRIRAYLKDEGLRLDRVLLDPALEVQRHYGAAGIPLTLFLRAD
    GTLADLHVGEISPELLQAGLDAAAAR

    >gi|298291235|ref|YP_003693174.1| DSBA oxidoreductase [Starkeya novella DSM 506]
    MQRRHFLTLAGMLVAGATFPTSPVLSQGVDVDAILRDPAAPTSGNPNGDVTVVAFLDYNCPYCKKAAPDLERAVKEDGGI
    RLVYKDWPILTEASVYGAQMALAAKYQDGYDKVHHALMAIPGRGVSKEQMAAAVRATGIDIDRLNADLNTHVGDIAALLR
    RNLAQAESIGLQGTPTYLIGPFRTSTLDYAGFKEAFAEARRRQAAE

    >gi|298291236|ref|YP_003693175.1| Protein-disulfide reductase [Starkeya novella DSM 506]
    MAWQFLAGVIRSVILGLACLSPLGATAGESASFTALLAPTAAAEPFTLQAGRSPSGALLLRWKVAPGNYLYRDSLEASRD
    GAPVALERPTGEAKDDPNFGVVQIFHRDVEANAGELARTGQLRVSYQGCSDKGICFPPQARLVNLASLQIAEVSPGLTSS
    PADAADPESPSLAASEAGSTPMAIVENESEGIAALFQGGLGWTMLAFLGFGLLLALTPCVFPMIPILAGMLTRSGEALTW
    RRSLVLTGSYVLAMAGAYGLIGAVAGWSGANLQAALQTPLALGVMAAIFVALALSMFGLFDLALPAGFSARLAGRGGGGS
    ISGAAVLGFGSALIVGPCVTPPLAGAMLYAAATGDAATGAAALFMLGLGMGLPLMLVGLFGASLLPRGGVWLEQAKKGFG
    VVFLAVAILLAGRLLPPPATLAMLGVLLVGSAAFFGGFDRLTASSGAAARLARGGGMVAALYGATLVIGAAGGAQDPFRP
    LAFVAAPAADQPVADTAVTVASSSGFDRAIVEASEGPAPDRPILVDFTADW
    CTVCKSNATVMAAPELRARLVGLPQITAD
    VTDYNEATRSLMKRFRVVGPPALFLVDAQGREIPGSRIVGPITVEEIARRLDAAGA

    >gi|298291307|ref|YP_003693246.1| FAD dependent oxidoreductase [Starkeya novella DSM 506]
    MDHDAVIIGGAFAGLAAATYLARARRRVCVIDAGRPRNRFAEASHGFLGSDGSDPLAIVARAREQLSAYPGVTIIGGEAT
    AARAFDDGFAVSLSTGEEISARKAILAFGLHDTLDPIPGLQERWGKTVLH
    CPYCHGFEFSDRQLGVLARTPMSVHQACLV
    AEWGPTTLFLNGAALDRADAELLARHGVMIESGEVARLVGNGSALSAVELGDGREKPVAALYVAPQTSLASPIAAQLGAA
    IDDGPMGPMIRTDADRMTTVPGLYAAGDIARAPHSVSWAVADGVTAGTSVHRALVFG

    >gi|298291317|ref|YP_003693256.1| DSBA oxidoreductase [Starkeya novella DSM 506]
    MPTFLRAGRRALAAVIATGFMLGAAIAPASALDDAQRKEFEGVIRDYLLKNPEVIQEAIMELQKRQAAAEASQRQQALTE
    LKPLVFDSPRGTVVGNPKGDVTLVEFFDYN
    CGYCKKALGDLVELVKSDNKLKVVLKEFPVLGPGSVEAARVAVAVRLTAP
    DKYFAFHQKLLGDRGQANKAKALEAAGEVGIDKAALEKALANPEIDATLQESLQLADALGIDGTPSYVLGDSVIVGAVGH
    DQIRNAIQSVRNCGKTQC

    >gi|298291327|ref|YP_003693266.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Starkeya novella DSM 506]
    MSKIAVGQPAPDFTLGTDTGESVTLASCRGRKLVLYFYPKAGTQGCTLEAHDFNQLKDAFDAADTRLIGVSADPAKALAR
    FRAKQGLGFTLLGDETHAVLEAYGVWTEKQMYGRKFMGIERTTLLIDRDGRIARIWPKVKVAGHAKEVLEAAKGL

    >gi|298291341|ref|YP_003693280.1| iron-sulfur cluster assembly accessory protein [Starkeya novella DSM 506]
    MADLRSRPPVMTLTDAAAERVRAIIARSDKPVAGLRVGIKNAGCAGMEYTMEFAEEAGRFDEVVEDKGVKVLIDPKAIMY
    LLGTQMDYKTDKLSAQFVFNNPNQTSACGCGESVAITPVKRDVADAHA

    >gi|298291391|ref|YP_003693330.1| Rhodanese domain protein [Starkeya novella DSM 506]
    MPEDSRFVSTEWLAAHLGAPNLVIVDASWHMPATGRSGRDEYLKAHIPGAVFFDIDAISDPSSGLPHMLPTETLFTAAME
    ALGIGRTMKIVVYDTAGLFSAPRVWWTLHAFGAVDVQILDGGFPKWLAEGHPTESGEAPHYPARFDAKLDRNWVASIDEV
    AKRLAEGSAQVLDARAAERFRGEVPEPRAGVRPGHIPGARNLPVSEVVKDGHLVDPAAIRAAVAAAGIDPSKPVITS
    CGS
    GVTAAILWLALDVIGTPPKALYDGSWTEWGSSDKPVATGPAD

    >gi|298291431|ref|YP_003693370.1| peroxiredoxin, Ohr subfamily [Starkeya novella DSM 506]
    MKVLYKTQATATGGRTGSAATYDGALKVDLVTPKELGGPGGVGNNPEQLFAAGYSACFLGAIKFVASQQKIKVSDESTVT
    ADVGIGPRDDGQGFGLDVALTIKLPGVERTVAEDLVQRAHIV
    CPYSHATKGSLDVRLTVA

    >gi|298291575|ref|YP_003693514.1| arsenate reductase [Starkeya novella DSM 506]
    MDIIVYHNPDCGTSRNTLALIRHAGIEPHVIEYLKTPPTPAMLLQLASRIGWPLRNLLRERGTPFKELGLDDSTLDDAAL
    LAAVAEHPILLNRPIVVTPLGVKLCRPSETVLDLLPVLPNVDLDKDDGSPFLRDEQVAASDPRLAKALREVGLPTDDLRS
    SAGRFYSYRTLSGTLVGYAGIEMSGEDALLRSLLVVPAARGAGIGRNIVLLLMSRAFDAGGRKAWALTTSAAAFFERLGF
    AVGPSDAAPEGLAQTPQFASLCPSTAPLLTRRILL

    >gi|298291581|ref|YP_003693520.1| Rhodanese domain protein [Starkeya novella DSM 506]
    MTFARVTAETAKSRLHAGDEVAFLDVREAAAFGDGHPLFAIPCPYSRLELSAISLVPRPDCPVLLIDDGDGVAEKAARRL
    AACGYTDVAVVEGGMPAWTAAGFGVFAGVNVPSKTLGELLEHEHHPEMIDAATLALWQREGRPHAFFDARPPGEFAKMRI
    AGARCVPNGELAHRLAAAVPDEETPIVVT
    CAGRTRGIVGTLGLRALGVRNPLYALENGTQGWALSGLPLDRGAQADPMPT
    LDEEATAISRQRADRLIAAARLSRATVAQAQSWLAEGNRTTFLFDLRSAAERSALPVPGAVPALTGQLVQATDQYVGVRH
    ARLILMDDTGLRAGLAGLFLRALGFEVHVLALGDDSGAGVPVVPPLSLTPPASPPEIGPRAAWAATLQGVPLFDLRSSSE
    WEERRLSCARRAMRTDLPDVVPTSVSRVLLQGEAGVVAAASVDLAETGIAAQWLSADFDACAAAGWPVETARRPLDRHLA
    RDRVWFVHDRHDGNAEASRRYLAWEMGLIAQLDAEERSAFGTVPIDELVEAPLSAS

    >gi|298291775|ref|YP_003693714.1| dihydrolipoamide dehydrogenase [Starkeya novella DSM 506]
    MADTYDVLIIGSGPGGYVGAIRAAQLGLKVGVVERSYVGGICPNWGCIPAKALLRSAEIIHYIEHAKDYGLVAEKTGVDI
    AGVVKRSRGIAAQMSNGVGFLLKKNKVDVIWGNATITAPGNVTVSATTEPAPKGALAPGEYKAKNIVIATGARPRVLPGI
    EPDKKLIWTYFEALAPASVPKSLLIMGSGAIGVEFASFYKAMGSDVTIVELLPQILPVEDEEIAEHARKRFEKQGIKILT
    GAKVSKVTKAADSVTATVETADGKVQNITADRLISAVGVVGNIENLGLEKLGVKTDRGCVVIDGLCRTNVPGIWAIGDVA
    GPPMLAHKAEHEGVICVEAIAGKHPHAMDKLMVPGCTYCMPQVASVGLTEKKAKEAGYDIKVGRFPFIGNGKAVALGESE
    GLVKTIFDAKTGQLLGAHLVGAEVTELIQGFVLAMNLETTEAELINAVFPHPTVSETMHESVLAAYGRAIHI

    >gi|298291875|ref|YP_003693814.1| iron-sulfur cluster assembly accessory protein [Starkeya novella DSM 506]
    MSASPSITPDSLHPVGVTASAARRIAEILSGEPADAMLRVSVEGGGCSGFQYKFDITREREADDLVLTEGAATVVIDPVS
    LEYMSGSHIDFVDDLIGASFRIENPHATASCGCGTSFAL

    >gi|298292019|ref|YP_003693958.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Starkeya novella DSM 506]
    MPQSFDAIVIGAGQAGPSMAGRLTGAGMKVAVIERLHFGGTCVNTGCKPTKTLVASAYAARMAQRAAEYGVVLSGAPGID
    MATVQARAEKVIQDSRASVEGWLGGMEGCTLFRGHARFTGPHAIEVDGETLSAERIFINVGGRAAVPDMPGIGEVPYLTN
    SDMVEMKTVPDHLVVIGGSYIGLEFAQMFARFGAEVTVIEKGPRLIGREDEDVSATIREILEAEGIHLRLGAECIRFARH
    ERGVAVSVDCTDGPPEILGSHVLVAVGRRPNTDDLGLEKAGIATDSRGYITVDDYLETSVKGVYALGDCNGRGAFTHTSY
    NDFEIVAANLLDGQDWRVSERVPAYALYVDPPLGRVGMTEAQARATGRPLLIGKRPMTRVGRAVEKGETWGFMKAVVDAE
    TKRILGAAILGTGGDEAIHGLLDIVNADVPYTIFQRAVPIHPTVSELIPTLLAEMQPATGAT

    >gi|298292128|ref|YP_003694067.1| glutaredoxin-like protein [Starkeya novella DSM 506]
    MSIHDFIDGQVKSNDVVVFMKGTPQFPMCGFSGQVAHIMGLLGVDYKGINVLDSDEIRQGIKEYTNWPTIPQVFVKGEFV
    GGCDIVREMYQSGELQTLLEEKGVAVMGRATA

    >gi|298292338|ref|YP_003694277.1| thioredoxin reductase [Starkeya novella DSM 506]
    MSPASPSRHHVKVLIIGSGPAGYTAAVYAARAMLEPVLIQGIQPGGQLTITTDVENYPGFADPIQGPWLMEQMQAQAEKM
    GTRIVSDLVTSLDLSSRPFRAKTDSGTEWIAETVILATGAQARWLDLPSEQAFRGYGVSA
    CATCDGFFYRGREVIVVGGG
    NTAVEEALFLTNFASKVTVVHRRDAFRAEKILQERLFAHPKVEVVWNAALHEVKGEDNPPKVTSVTLKDTVTGAFHERPA
    DGVFIAIGHAPATELIAGQLKLKPSGYVWTEPHSTQTSVEGVFAAGDVADDVFRQAVTAAGMGCMAALEAERFLAAREPL
    ADAAE

    >gi|298292749|ref|YP_003694688.1| periplasmic protein thiol/disulfide oxidoreductase DsbE [Starkeya novella DSM 506]
    MSDTSTPSGTGRRRLLVLLPLIAFVALAALFYGRLFSGDPSRIPSALIGRPAPALDLPPLQGLTRDGQPVPGLTSAGLKG
    EVTVLNVFASW
    CVPCRDEHPFLVELSKMQGFRLVGLNYKDEAENARRFLGRFGNPYAAVGVDAGGRAAIDWGVYGVPETF
    VIGRDGRIAYKFIGPIDAQGLKERLLPEIEKAKAPPAS

    >gi|298292752|ref|YP_003694691.1| glutaredoxin 3 [Starkeya novella DSM 506]
    MSQIEIYTTYSCPYCHAAKDLLKRKGVDFSEINVAGDPVMRSTMSQRANGRTSVPQIFIGGRHVGGCDDLYALEEAGELD
    ALLAS

    >gi|298292859|ref|YP_003694798.1| thiamine biosynthesis Thi4 protein [Starkeya novella DSM 506]
    MSKYDVIIVGAGHSGLVAGFYLARAGLKVLMLERSHQVGGTCITEEVFPGYRGSSIANSCHSLDPRIAGDMELEKHGLRL
    THPDLNSLTLFSNGDALVMWPERERRRAEMERLAEPGDMQGFSDVMQFYQNVAKKMGVSFYDPAPSLEEVAARFVEPADK
    EAFNLVMFGSVADVLDRHLKSPWLKSFLAGTAMATNLVGPRTPGSGYILLQRPLQEESMRRSGVVFESNELMMKNASPIG
    GVGAVTQAMARANESLGVEIRLEAPVRELLCDNGKVKGVVLESGEEIEAARVLANINPKTVLTKLVPANQLPPEIEERAR
    KLTMHGSSSKVHLALKGTPRFNRAGNDEENTQFLGTNFRVVPSIDVLQESYNEAAMGRWSPHVTISGVVSSAADPNMTPP
    GCHFMSLSVRGTPYHLSNGSWDDQREALGNAVVETLSRNIGNIKDIIEGISVYTPVDLERNYGMTEGNGAHGDIVPGRIF
    DARPMPGCANYTTPIEGLFMCGVGNWPGNFMSGLTGYNASRKMLGDFRPTH

    >gi|298292898|ref|YP_003694837.1| peroxiredoxin, Ohr subfamily [Starkeya novella DSM 506]
    MNAQPKLLYTAKVHTTGGREGGTSRSSDGNLDIRLSPPGGHGTGTNPEQLFAAGWSACFESAINIAARKSRVALPPGFTI
    DAEVDLSLIDGAYTLGARLNVNLPGLPHDAAQALVDEAHTL
    CPYSRATHGNIDVVTRVKV

    >gi|298293035|ref|YP_003694974.1| Redoxin domain protein [Starkeya novella DSM 506]
    MTIKVGDQLPSATFRVATADGPVPKSSEEIFKNKKVVLFAVPGAFTPTCHKNHLPSFIARADELFAKGVSVIAVTAVNDP
    FVLAAWEKASNAEGKILFLSDGNADFAKAIGMDFDASAAGLGTRSKRYSMLVDDGEVLILNVEDVPSKADKTNADVLLTQ
    F

    >gi|298293257|ref|YP_003695196.1| dihydrolipoamide dehydrogenase [Starkeya novella DSM 506]
    MSYDLIVIGTGPGGYVCAIRASQLGLKVAVVEKRATFGGTCLNIGCIPSKALLHASHLFDEAGHRFAEMGIGVGAPTLDH
    KAFLGFKDKAVDGNTKGVAFLMKKNKIDTYHGTASIPAPGKVDVAMADGSQQTLETKAIVIATGSDVAKLPGIEIDETRI
    VSSTGAIALEKVPGKLLVVGAGVIGLELGSVWRRLGAEVTVVEYLDRILPGMDLDVAKSFQRILEKQGIAFKLGSKVTGV
    DSKGKTLKASVEPAAGGAAETLEADVVLVAIGRVPYTEGLGLEALGVEKDKRGRVVTDHYYRTNVPGIFAIGDAIAGPML
    AHKAEDEGVALAELLAGQAGHVNYDVIPAVVYTSPEVASVGKTEEELKEAGVAYKVGKFPFLANGRAKANDETDGFVKIL
    ADATTDKVLGAHIIGVEAGEMIHECAVLMEFGGSSEDLARTCHAHPTRSEAVKEAAMAVEKRAIHM

    >gi|298293379|ref|YP_003695318.1| thioredoxin [Starkeya novella DSM 506]
    MLLNQPANPAQNGADAPAGDDVVIDVTTRSFMQDVVEESRRRPVLVDFWAPWCGPCKQLTPIIEKVVRGAKGKVRLAKMN
    TDEHPAVAQQLGIQSLPTVYAFVNGQPVDGFMGAQPETQVQALVDRLVAGAGGADDMAEVVASGEAALAEGDLVGAAEIF
    AAVLAEEPANLKAIAGLARTQLSAGNAEQAQATLALAPESAANDAGLAAVRAAIELEEAAAALGDVKELEAKVAANPLDH
    QARFDLAVALAAHDKREEAVDELLTIVRKDRNWNDDGARKQLVQFFEAWGPTDEHTVAGRRRLSSILFA

    >gi|298293415|ref|YP_003695354.1| Redoxin domain protein [Starkeya novella DSM 506]
    MTERPEDAPEPDNPGPARSGGRFALVVAAAVILGAIAGLAGVYGIGGGTRNAIATLPPPVAGDAGTTATAAGADAACTAA
    TDTAKRIAGLAKGELAAFAPTEKPTRIPDLAFLDPEGKPVKLSQVGGDGLKLVNIWATW
    CVPCREEMPALDELQATLGTK
    GGATPGFEVVAINMDTRDPAKPKAFMDETGIKNLALYTDPKGETFQELRAVGRGFGLPTTMLIDAKGCEIGHIAGPAEWA
    SPDAFALLRAALAEGGATQ

    >gi|298293417|ref|YP_003695356.1| heavy metal translocating P-type ATPase [Starkeya novella DSM 506]
    MSALKTRYRIEGMDCAACATKIDTAVRRVTGVAEVSVSVTAGTMTVEHDGADLAVLEKRVSGLGYGIALLPAAATPPVAP
    GLPEKAHDHAHDSCCAGHDHDHAHDDCCRHDHDHDHAHDRGHHHPDDGHRWHGESHHSGHQLEATSAAAPAALAGPSWLP
    GRKARLTIVCGAALVAAYVLGHFLPQLNPWIFIAALLVGLVPIARRAVAAAFAGTPFSIEMLMTIAAVGAVIIGASEEAA
    AVVFLFLVGELLEGFAAGRARDSIRALTALVPKTARLVQGSGTSEVPATSLRIGDVILVRPGERIPADGEVLEGIGAVNE
    APVTGESVPVPKQAGDPVFAGTVNAEAALTIRATTEPSDNTIARVVRLVEEAQESKAPTERFIDRFSRYYTPLVVVLAAL
    IAVLPPLVAGAPWDEWIYKGLAILLIGCPCALVISTPAAVAAGLASGARRGLLIKGGAVLENLRNVTAVAFDKTGTLTEG
    KPEVTDLVVFAGDEAALLARAAALEAGSTHPLASAILGEAAARGIAYPAVSGAGALGGEGVSGIVEGRALFLGSPKAAAK
    RASLSEALRAAIGRLNDEGKTVAVLLVDGVVEGLIAMRDEPRADAAESLAALKAAGIRTIMLTGDNERTANAIGADLGIE
    VRAGLMPADKQRIVGELKAEGFTVAKVGDGINDAPALASADVGIAMGGGTDVALETADAAVLHGRVGDVGAMVELSRATM
    RNIHQNITLALGLKAVFLVTTIAGITGLWPAILADTGATVLVTANALRLLGRKAD

    >gi|298293455|ref|YP_003695394.1| selenide, water dikinase [Starkeya novella DSM 506]
    MLDKPTETPPFRLTSLAHGGGCGCKLAPSVLRELLAEQPAAGSFEKLLVGTETGDDAAVYLLDDDTCLIATTDFFMPMVD
    DPYEFGRIAATNAISDVYAMGGKPLLALAILGMPLGKLAPEMVCEILKGGASVAAEAGIPVAGGHSIDAPEPIYGLAVIG
    TAKPSNIRKNSTAKAGDALILTKPLGVGIYSAAFKKEALPKPAYEEMIGSMTLLNRIGAELGKEEAVHAVTDVTGFGILG
    HGLEVARGSNLALEIAADALPVLGEAGALAQAGHVTGASHRNWASYGEAVHLPTGLPDWRRHLLTDPQTSGGLLVASAPE
    AAERLLGQIRAAGYPRAAIIGRAVAGEPAVTVV

    >gi|298293457|ref|YP_003695396.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Starkeya novella DSM 506]
    MLAPEAPACRGTVTWYYSSVVAALALTTLGGGPLLARESPLPFGQGVPSLALNSLNQGRQDLAALQGKVVLVHFFATWCE
    P
    CREERAGLSRLAGRLPNRSFAVLAVDVGEVELRVRRFFDAHPVPFPVLLDEDRAALKAWKVVGLPSSFVLDPSHTLRLY
    AGGPVDWDDPEAVRLLESLADPAGATAGGTLPPLDE

    >gi|298293540|ref|YP_003695479.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Starkeya novella DSM 506]
    MSEDAPSLRPRVVIVGAGFGGLQVARGLADAPVDIILVDKHNYHCFQPLLYQVATAVLSPADVAWPVRHILSRQDNVTML
    MAQVTGVDRAAQALITSEGPIPYDFLVLATGATHSYFGHEEWAPFAPGLKDIQDATHLRRRILVAFERAEASDDEAARRR
    LLTFVIIGGGPTGVEMAGSIAEIARHALAPDFKRVDPRTARILLIEAGPRLLPVLTEPLSAYARRRLEAMGVEVLTGRPV
    VDIGADHVELAGGEIIPASTKIWAAGVRASPAAQWLGVETDRAGRCLVGPDLSVPDAPEIFVIGDTAAVSDPAGKPVPGI
    APAAKQMGDHVAKAIEARLAGSTAPAFRYRHDGDLATIGRNSAVVKLGRLELTGFLGWMFWGFIHVYFLIGTRNRIAVAL
    AWLWNYVTHQRAARLITGEPEVSEAESKKPPLRQAS

    >gi|298293658|ref|YP_003695597.1| DSBA oxidoreductase [Starkeya novella DSM 506]
    MKRRALLLSAAGLWLAALLSAALLSAGPLAAATSDGRPSNKTLDVEALLNDPHAPTGGNPKGDVTIVAFFDYNCGYCRKA
    SPELERLVKEDGKIRLVYKDWPILSESSVVAAQLALAAKYQGKYEAAHKRLMTLPGRASTERMSAALGEAGVDRAKLAKD
    LKTHAREIGALLSRNNEQAEALELPGTPVYLVGPYKVAAALDYDGFKQVVKDARARAAAQ

    >gi|298293757|ref|YP_003695696.1| protein of unknown function DUF255 [Starkeya novella DSM 506]
    MPNRLQHAASPYLLQHSDNPVDWWQWQPEAFEEARRSGRPILLSIGYAACHWCHVMAHESFEDEATAAVMNELFVNIKVD
    REERPEVDQIYMSALQQLGVQGGWPMTMFLDAEGAPFWGGTYFPKEARYGQPAFTDVLKTMANAYGSGDPRIASNREALL
    ARLRQKAAPVGKVTIGPNELDDVAGRILGIMDSQHGGLQGSPKFPNTPFLELLWRAWERTGRQRLRDAALHALDGMSEGG
    IYDHVGGGYARYSVDERWLVPHFEKMLYDNAQILELLGLAYSETLADLFRARAEETVGWLQREMLTTSGAFAASLDADSE
    GHEGRYYVWTLKQVLDALGAEDAEFFARHYDIAPFGNWEGVSIPNRLKEMERSPADEMRLAMLRDKLLKVRETRVPPGRD
    DKVLADWNGLMIAALANVAPRFGRPEWVELAARAFRFIAESMAREGRLGHSWREGRLVFPGLSSDYAAMIGAALALHQAT
    GEASYFDHAVAWQAQLEAHHAAEDGGYYLTADDAEGLILRPDAAADDAVTNPNALIARNLVRLAAVTGDDGYRERADRLF
    DGLLPRAAPSLYSHAGLLNALDTRLRAPEIVVVGSGEVADALLDAARRLPRVDLMIERVSDPASLPENHPARAKAESIDG
    AAAFVCAGSVCSLPVTDANRLVEVVRAGVLSQ

    >gi|298293891|ref|YP_003695830.1| peroxiredoxin, Ohr subfamily [Starkeya novella DSM 506]
    MSGTVLFTGTATAIGGRNGHSQTSDGSVSVDLAMPKNGVLEPGKTTPEHLFATGYAACFGSAVEAVGHQKKLDVTGAAVT
    VAVSLVKGDDGFSLAAKLSLKAPALTQQETKEVLEAAHQM
    CPYSKATRGNIPVELSVG

    >gi|298293980|ref|YP_003695919.1| Glutathione S-transferase domain protein [Starkeya novella DSM 506]
    MQLYHHPFCAHSRLVRLALGEMGIEPELIEERVWERRPDFLMLDPAGSTPVLVEDDGFVVPGIDPITEYLDETRGPKLGD
    RRLLPVDIGARVEVRRLSAWFNHKFFAEVSEPLVREKVYKRYMPRELGGGPPDMAVIRAARANIRYHLHYIGWLLKARNW
    LAGDRLSYADLAAAAHISSVDYLGDVPWDEDEGAKIWYARIKSRPAFRPLLALTVAGMPPAPCYADLDF

    >gi|298293995|ref|YP_003695934.1| methylated-DNA/protein-cysteine methyltransferase [Starkeya novella DSM 506]
    MFFDLPDHSTLYQALLDRDEAYEGRAYVCVASTGVFCRLTCPARKPLAANCTFHATIGACIEAGFRPCKRCHPLQPAASA
    DPTIGRLLAALDARPHYRWGEDDIARMGLDLSTVRRAFKRQYGMTFLEMARHRRLREGFETLSEGGTVIAAQQDAGFQSA
    SAFRAAFARVIGCAPGELSTKGMLLADWIGTPLGDMIAISSASHLHLLEFVERKALPTEVARLRARAKGDLGIGSYAPTE
    QIRAELADFFAGKSAQFRTPLALDGSAFTRAVWAELQQIPAGDTRSYGEIARRIGQPSAVRAVARANGANQLALIIP
    CHR
    VIGADGALTGYGGGLWRKQRLLEIEQQYRENGGGVAAAG

    >gi|298294285|ref|YP_003696224.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Starkeya novella DSM 506]
    MTLQDKLDAMRDDFENGRFPLVPTRAQLQTMQRATQALIDSGQAENALRAGDRAPEFMLQDANGDSVSSRALLARGALVA
    TFYRGVW
    CPYCNYDLQALEEVRAEVEVRGASLAALSPQTLANSRKSQRDTKLGFPILSDPGAAVAAEFGLRFALPNDLIE
    VYRQFGNDLPKINDDPAWVLPMPARYVIGMDGMIAYAEVNPDYTQRPDPAELLPVLNGLRARTQA

    >gi|298294359|ref|YP_003696298.1| DSBA oxidoreductase [Starkeya novella DSM 506]
    MIDRRRFLEGVGTLALTTAAIAAFGAGDLGFIGRAEAQSADEAKLMALGALPDQVLGKADAPVTIVEYASLTCSHCAHFH
    ETTYPVLKSKYIDTGKVRFILREFPLDIVAKAAFMLARCAGDGKYYPMTDTLFETQKNWAYSQNPAQALMAIAKQGGMSE
    QQFNACLNDAKLAGQIDEVAKRGSELGVDATPTFFINGKKVSGALSPEDLDKELAPLLGSN

    >gi|298294399|ref|YP_003696338.1| peptide methionine sulfoxide reductase [Starkeya novella DSM 506]
    MFFFKKSLDLPTPEEALPGRASALPTATNHFVSGHALKGPYPEGYKTAIFALGCFWGAERKFWQTPGVYVTAVGYINGIT
    PNPTYEETCTGRTGHAEAVLVVYDPARVSYEQLLKLFWESHDPTQGMRQGNDVGTTYRSGIYVTSPEQRAAAEASKAAYE
    AVLKAKGFPAITTEIVDAPTFYFAEDYHQQYLAKNPGGYCGLGGTGVSCPIGTGVAA

    >gi|298294407|ref|YP_003696346.1| heavy metal translocating P-type ATPase [Starkeya novella DSM 506]
    MDAQVAGFPAMPAVPAEEPAQDYSLFLRRDPAGQAEMAFAIEGIDCAACIDEIEDAAETASGVVRARLNYTTHRLTVGWD
    AKAVPQPAAVMAALGKAGYRAYPFEADRLEAIEHATSRHLLRCLAVAGFAMMNIMLLSVSVWSGNVTDITPETRDLFHWL
    SAVIALPAAAYAGQPFFQSALRALRARSLNMDVPITLGVTLALGVSVFETLNHAEHAYFDSAVMLLFFLLTGRYLDHAMR
    RKTRAEAGNLTALKATTANRIEADGTLVTVPAAAVKPGDEVMLRAGERAPVDGIVLTGTAAVDESLVTGETLPRKVEPGE
    AVHAGSLIHDGTLRLRTTAVGEDTFLDEIERLLDKASTARGRYVRLADRAARLYAPVVHATALLSLLGWLLMGASIHQAV
    LIAVAVLIITCPCALALAVPAVQVVAAGTLMRNGILLNSGDAFERLAEVDTVAFDKTGTLTLPEPRLAVTRDVPPGLMNA
    AARLALASTHPLARAIAAAHPGAIPVEGAREISGAGVEAEIDGLPARLGSPAFCDCEGLAAQRAEQEPDASLVAVRLGHQ
    SAVLEVRQALRTDAVAVVEQLQREGRHVALLSGDRTAAVAPVARTLGIADWWAELRPAGKIAVLESFEARGRVLMVGDGL
    NDAPSLAAAHVSLSPITAADVTRAQADAVFLGDKLAPVATALHVAAKARQLMQQNLTIAVVYNLIAVPLAIGGFVTPLIA
    ALAMSGSSVIVTLNALRARNGAPAAKEVA