Staphylococcus saprophyticus ATCC 15305 uid58411

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|73661436|ref|YP_300217.1| hypothetical protein SSP0127 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MDYRVLLYYKYTTIDDPELFATEHLAFCKDLELKGRILVSTEGINGTVSGTVEATDKYMEALKNDARFQGITFKVDEAEG
    HAFKKMHVRPRQEIVALDLEDDVNPRELTGNYLSPKEFREALLSDDTVVIDARNDYEYDLGHFRGAVRPDITRFRDLPDW
    IKENKEQFMDKKIVTY
    CTGGIRCEKFSGYLLKEGFEDVSQLEGGIATYGKDPETKGEFWDGKMYVFDERISVEVNHVDKT
    VVGKEWFDGTPCERYINCSNPECNKQILVSEENEARYLGACSHECAKHENNRYVKKHNISDEEKAKRLENFKELVK

    >gi|73661438|ref|YP_300219.1| methionine sulfoxide reductase A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    METVYLAGGCLWGVQAFVKTLPGVINTEGGRANGITDTLHGEYDGYVEVIKTEFDPQKVSVTDLMGYLFEIIDPYSVNKQ
    GQDVGLRYRTGLYSEDEKHLKEAQQFIDGIEDHHLIATEVLPLTNYVRSAEENQDRLSRFPDDYCHLPKELVYKYK

    >gi|73661605|ref|YP_300386.1| putative copper chaperone [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MATETIQVEGMSCDHCKHAVETALTELDGVSTADVSLEAGNVKVDFDDDKVTMPQMKDAIEDQGYDVK

    >gi|73661606|ref|YP_300387.1| copper-transporting ATPase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MTEQKKTTIGITGMTCAACANRIEKNLNKLDDVEANVNVTTEKATISYNPESTSADDLTKTIEKTGYGVLNETAELDVIG
    MT
    CAACSNRIEKVLNRTDGVDQATVNLTTENATISYNPSATSVDALIKKIQKIGYDAQPKKEVAEKSSQKELELRSKLVK
    LIISAVLAAPLLLTMLVHLFGIQIPSIFMNPWFQFILATPVQFIIGWQFYVGAYKNLRNGSANMDVLVALGTSAAYFYSL
    YEMVKWLFNANVMPHLYFETSAVLITLILFGKYLETRAKTQTTNALSELLNLQAKEARVLRDNKEQMIPLNDVVEGDYLI
    IKPGEKIPVDGKIIKGKTSIDESMLTGESMPVEKVQDDNVIGSTMNKNGSITVKATKVGKDTALASIIKVVEEAQGSKAP
    IQRLADVISGYFVPIVVGIAVLTFIIWIAFVQQGQFEPALVAAIAVLVIACPCALGLATPTSIMVGTGKAAENGILFKGG
    EHIERTHQIDTVVLDKTGTITNGKPVVTDFDGDEEALQLLASAEKGSEHPLADAIVNYAQTMNIKLLDTTDFEAVPGRGI
    KANISGKNLIVGNRQFMNDENVDIKDSEDIMTQFEKSGKTAMLIAINQEYRGMVAVADTVKDSTATAIKQLHDLNIKVVM
    LTGDNERTAQAIANEVGIDTIIAQVLPEEKAAKIKSLQTQDKTIAMVGDGVNDAPALVQADIGIAIGTGTEVAIEAADVT
    ILGGDLLLIPKAIKASKATIRNIRQNLFWAFGYNVAGIPIAALGLLAPWIAGAAMALSSVSVVTNALRLKRMKL

    >gi|73661631|ref|YP_300412.1| putative 6-O-methylguanine DNA methyltransferase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MHYKSNYQSPIGQIALTSDGENITGLWLPNHKDFETQYKDELMTADLPIFDKAKRWLDAYFSGNNPKIDFPLKATGTSFR
    EQVWQILLEIPQGETWTYGEIAQKIAEKRGEAKMSSQAVGGAVGSNPISIIIP
    CHRVVGKDGSLTGYGGGIDTKIELLKL
    EGLDMNVFYRPKHSTKP

    >gi|73661649|ref|YP_300430.1| thioredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MPKTLTSIEAFHEFIAEHRLVVIHIMRDHCSVCHAVLPQIAGIVNEFPDVPLGVINQSELEEIAGELSIFTVPVDLIYFN
    GKEMHRQGRFIDMQQFEHQLTLMYKSMV

    >gi|73661798|ref|YP_300579.1| putative protein-disulfide isomerase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MKKAWLSIVLVLTLVLATACTNPEDTHKDDKTTSDGKIKIIEYGDFKCPYCKKVEKNVMPKLKKHYIDTDKVDYQFVNMA
    FLGDDSIIGSRAGHAVQRLAPEQYLKFQELMFKQQPNSEKAWITNQIVDQQIDKLKINTTLKKEIKDDYKQENSKSWVAA
    KKDQKQYKDNHIETAPTVFVHGQKVEDPYDFENYKKILEKE

    >gi|73661946|ref|YP_300727.1| putative molybdopterin synthase sulfurylase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MTQDRYSRQMLFKHIGSDGQDKIKRQHVLIVGMGALGTHLAEGLVRSGIGELTIVDRDYIEYSNLQRQTLFSEADADAAL
    PKVIAAETKLLAIRKDVVIHSHIAHVDRQFLEAHATNISLILDATDNFETRQLINDYAYQQNIPWIYGGVVQSTYIEAAF
    IPGTTPCFNCMVPQLPTINMT
    CDTVGVIQPAVTMTTSLQIRDALKLLIEHTPDTKLTYGDLWEGTHFSFGFSKLYRTNCP
    TCGQNPTYPHLNETKRQYVSLCGRDTVQYENPNISQEMLGVFLNQHKIAFKRNPYIIQFQYKGYRIVSFKGGRMLIHGMK
    QPQEAIKLINQLFG

    >gi|73662143|ref|YP_300924.1| putative transporter component [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MTWLIISGLVVGALLGFVMQRTRFCLAGGFRDMYIQKSNKMFYALLIAISVQSIGLLLLTSTRLVEIPESTYPIIGTVIG
    SFIFGLGIIMAGG
    CATGTWYRAGEGLIGSWMALIAYAFTSAATKFGLLLPLMNGLNKPTNVNTSMSQTTGIPTWVFVIVL
    IVITLFFVVKTLRKPKFAVPKLKQKFTGIRHYLFEKKYHPFVAAIAVGLIALLAWPVSESTGRMYGLGITTPSANLVQFF
    VTGDLKLLDWGVFLVLGIFFGSYIAAKGAKEFKWRLPDKKTIRNSIIGGVLMGFGASVAGG
    CSIGNGLVETATMSWKGWI
    ALASMILGAWTMSYFVFIRPMKKAQSQTSNTKVSSQTQTS

    >gi|73662239|ref|YP_301020.1| putative peroxiredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MLKKGDQFPLFELENQNGELITNETIKGKKAVLYFYPRDNTPTCTTEACDFRDNIALFNELNASVYGISGDSKKKHQNFS
    DKLDLNFDLLVDTDYKLSEAVGVYQLKKSFGKESMGIVRTTFVIDETGQIIDIIEKVKVKTQIDELKQILG

    >gi|73662316|ref|YP_301097.1| hypothetical protein SSP1007 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MESITVTELKEKILDANPVNIVDVRTDQETAMGIIPGAETIPMNSIPDNLNYFNDNETYYIICKAGGRSAQVVQYLEQNG
    VNAVNVEGGMDEFGDEGLDIKSI

    >gi|73662328|ref|YP_301109.1| putative thioredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MQQLESEQQFENLKNEQTVFLFTADWCPDCKVIEPDLPQLEAKYTNYKFISVDRDKFIDICINYDIMGIPSFLVFCDGNQ
    IGSYIGKERKSIEQIDQFLASL

    >gi|73662350|ref|YP_301131.1| OsmC-like protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MVQHEFKVQTNWNGGRDTVGNLQGDILEEQISIPSGLGGNGTGTNPDELLVSAASSCYIISLAAVLERSGFTDIKIAQSS
    IGTAIFENAKFRMDNIVHYPEIYVSQEQKDNLTKKLPKLLKVADNN
    CMISNSLRGNVEVKIVPKIK

    >gi|73662361|ref|YP_301142.1| putative peroxiredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MAQITFKQEPITLLGSQVKTGETAPEFTLLDNDLNEVNLSTYDGQKKLISVVPSIDTGVCDQQTRKFNEEASQEDGVVLT
    VSVDLPFAQKRWCASNGLDNVITLSDHKDLSFGKNYGVVMEELRLLARSVFVLDKNNKVVYSEIVSEGTDFPDFESALEA
    YRNI

    >gi|73662546|ref|YP_301327.1| putative dihydrolipoamide dehydrogenase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MSEEKYDLVILGGGTAGYVSAIRASQLGKKVALVEQSLLGGTCLHKGCIPTKALLKSAEVMRTISNATDYGVDVDNFRVN
    FSQMQSRKNDIVNQMFNGVTHLMEHNKIDVFNGVGRILGPSIFSPQSGTVSVEFENGESELIPNNNVLIATGSQPMDLPF
    LPFDHKIVLSSDDILKLEALPKSLAIIGGGVIGLEFASLMTDLGVDITVIEAGERILPTESKSIANTLKKELTQRGVSFY
    ENTQLTESQITIEATSIDIKLNEEVTHFEKALVAIGRKPNTEDIGLNNTKIKLSNSNHIIVNEFQQTEDKHIYAAGDCIG
    KLQLAHVGSKEGTTAIEHMFDKSPLPLDYNKMPKCVYTQPEVASMGQNLEQAKANNLNAKAFKVPFKAIGKAVIENVTNQ
    NGFCEIVIDQDNDTVLGLNMIGPHVTELINEVSLLQFMNGSTLELGLTTHAHPSLSEVLMELGLKVENRSIHV

    >gi|73662624|ref|YP_301405.1| methionine sulfoxide reductase A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MAYATLAGGCFWCLVKPFTSYPGIENVVSGYSGGHTDNPTYESVSTNQTGHVEAVQITYNSEITSFENILDVYFKTFDPT
    DNGGQFFDRGEHYEPAIFYHDENQKKAAEAKIQQLNEQGIFNKPVITPIKPYKNFYPAETYHQDYYKKNPLHYEQYQRGS
    GRKNFIEKHWGKQND

    >gi|73662625|ref|YP_301406.1| methionine sulfoxide reductase B [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MIKKNKNDLNEMEYLVTQENGTEPPFQNEYWNHFEKGIYVDKISGKPLFTSEEKFESDCGWPSFSKALADEEIVELVDKT
    FGMVRTEVRSEDANSHLGHVFNDGPKESGGLRY
    CINSAAVQFIPYEKLEELGYGDLIPHFEK

    >gi|73662700|ref|YP_301481.1| methionine sulfoxide reductase A [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MNINKAYFAGGCFWCMVKPFDTFEGIESVTSGYMGGHVDNPSYEQVKTGNTGHLETVEIEYDVALFSYNKLLEIFFSVID
    PSDEGGQFQDRGAQYKTAIFYTNEDQKNVAEEYIEQLKETIDKDKAIATQVLPAATFYEAEPEHQDFYKKNPERYAKEQQ
    DRQNYKQQTDK

    >gi|73662764|ref|YP_301545.1| glutathione peroxidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MTIYDIEVQKPNGDAYKLDAYKNKVMLIVNTASECGFTPQFEGLQALYDKYKDQDFIILGFPCNQFGGQEPGTGEEATQN
    CKINYGVSFPMHEKIDVKGEQQHPLFKFLTEAQNGFFNEKIKWNFTKFLVDKNGDVVQRFSPQKKPSQLESEIEALL

    >gi|73662912|ref|YP_301693.1| cadmium resistance protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MSTNCCNNKAESNTCCTSNSVNENKCCSNEPKVANQNDECCTNNGESIDSTHNISCNAMSNSSEEDDEVATPFSNYNFKV
    TGMD
    CSSCAITIEKALRPLDDVTNPKVNFSTSKLSVGLKSQSSINQVTQTLKKLGYGIEENDSNQNYTIFSIEGMDCGSC
    AKSIEKHLNNLPYVNDTQVSFSTGKMQIDFEGNQTKNIEKEVSKIGYSATLQSSNKNNNTKWRLFSKPIISTLFLILGIV
    SSMVSLPIWITNLMYIIAIVVSGIKPLKSAYYAIKSKSLDMNVLMSVAVIGAILIGEFFEGAIVVLLFTIGTLLQTISID
    KTRNSIQSLMDITPAEANVVTETGIISKNLKDISIGEILLVKPGDRVPLDGTIIEGYSSLNQAPITGESIPVDKTINEEA
    YAGSINENGTLKIRVSRLVKDTTLSKIIHMVEEAQENKAPTQAFIDRFSEIYTPIVFILALLVMVIPPIFSLGTWGEWFY
    KGLELLVIACPCALVISTPVAIVTGIGSAAKKGVLIKGGNHLEALGTLSALAFDKTGTLTEGRPKVSEIKTIESDKEMFL
    NIALSLESYSTHPISNAIVDYVSQFKSITYDVTDFENIVGRGIKGKIDHNNIYAGNIKLIESINENIVNYKEEIYSYEQQ
    GYTVIIIATADKIHGFITVEDPLRSDIKQTLQQLNGSNIKNTIMLTGDNKGTAHKIAQLSGIKEVYAELMPEDKLSAIKD
    LQSKGYRVGMIGDGINDAPALAQSEVGIAMGGIGSDTAMETADVVLMSDNVHQLTDTITISNKAKNIIKQNIYFSIIIKM
    IAFILVFPGLLTLWLAVFSDTGAAILVILNSLRLLRTKKNNLL

    >gi|73662945|ref|YP_301726.1| putative dehydrogenase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MKQYDVVFLGSGHAAWHSALTLNKAGKSVAIVEKDRIAGTCTNYGCNAKILLENPYEVLEQASHYPNIINTEALSVNWEN
    LMSYKHKIIDPMANTLKGLFEQQGIDIIEGAGKLLDEHHLVVDGEQYYGENIVIATGQHSNKLDIEGSEYTHDSRDFLSL
    EQMPNSITFIGVGIISIEFASITIKSGVETHMIHVDDEPLKGFYSAHIAKLMDKLATEGVQFHMNENTTVIKEQGDNYTV
    STESGLEITTNYVLDATGRRPNVNGIGLEEAGVNFTTRGIQVDEYLRTNIPNIYASGDVLDKVIPKLTPTATFESNYIAA
    HILGMNKNPITYPAIPSVLYTLPRLSNIGVSVDEANTSEDYKVIDIPFGKQMVFEYKNETEAEMTIVLNNDKQLVGAAIY
    ADDAPDLVNLLTFIVNQKLTAQDLNKMIFAFPGSSSGVIDQLKLAML

    >gi|73662946|ref|YP_301727.1| glutathione peroxidase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MIYKLLTKMIVGITYCLNDYKGKVIMLVNTATKCGLSGQFEELEEIYQKYKEQGLIILGFPCNQFAK

    >gi|73662959|ref|YP_301740.1| thioredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MAIVKVTDSNFDDNIQSGVNLVDFWATWCGPCKMIAPVLEELAGDYDGKANILKLDVDENPSTAAKFEVMSIPTLIVFKD
    GEPVDKVVGFQPKENLAEVIEKHL

    >gi|73663002|ref|YP_301783.1| dihydrolipoamide dehydrogenase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MVVGDFPIETDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGELGGVCLNVGCIPSKALLHASHRYDETKNSENLGVIAES
    VSLKFDKVQEFKQSVVKKLTGGVEGLLKGNKVEIVKGEAYFVDNNSLRVMDEKSAQTYNFKHAIIATGSRPIEIPNFKFG
    DRVIDSTGALNLQDVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTEAMA
    KSAEETDNGVKVTYEVKGEEQTIDADYVLVTVGRRPNTDELGLEELGLKFADRGLLEVDKQSRTSVENIFAIGDIVPGLP
    LAHKASYEAKVAAEVIAGEASEVDYIGMPAVCFTEPELATVGYTEAQAKEEGLAVTASKFPYAANGRALSLDDTTGFVKL
    LTLKEDNTLVGAQVVGTGASDIISELGLAIESGMNAEDLALTIHAHPTLGEMSMEAAEKALGLPIHTM

    >gi|73663015|ref|YP_301796.1| putative glutaredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MNEIIIYTQNDCPPCTFIKNYLADNDVAYREKNISNTQYRNEMIDYDAFATPFILLNGEPMHQIDMDKINSTLNIK

    >gi|73663063|ref|YP_301844.1| putative general stress protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MVKPLYETKVISNGGRDGKVFSEDNTFYQDLAVPKEMGGNGVTESNPEQLFAAGYSACFNNALMHILKSDSKGTIEPEVS
    VTAYLLPDKNDGGVKLAAELDVTLTDMTQEEAETYVEKAHNY
    CPYSKALKESIDIEIQVSVN

    >gi|73663097|ref|YP_301878.1| transcriptional regulator Spx [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTRSKTYQKLNVDIDALPLQDLY
    SIIQDNPGLLRRPIILDEKRLQVGYNEDEIRRFLPRKVRTFQLQEAQRMVD

    >gi|73663113|ref|YP_301894.1| coenzyme A disulfide reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MNKIVVVGAVAGGATVASQIRRLDQESEIVVFEKDRDMSFANCALPYYLGNVVDSRNKVLEATPESFYEAKNIVVKPCHK
    VTSINDTENTITVYDRIQDTYFETHYDTLILSPGCSANSLNLDSPIAFTLRNMEDTDAIETFIKENQVKNALVVGTGYIG
    LEILDNLYERGISPTLIHRSTHINKLMDQDMNQAILDEMDKRDIHYRFNEEISKVVGNAVHFESGKVENYDLIIEGVGVK
    PNSEFIKNSNVTLDDKGYIPVNDQFQTNIPNIYALGDIITSHYRHVDLNAHVPLAWGAHRGASVIAEQLAGDHKIHFKGY
    LGSNIVKFFDYTFASVGVSPKELSNFDYAMVEANQGEHAGYYPGNTKLHLRVYFDKTNRRIIRAAAVGMKGVDKRIDVLS
    MAMMHKLTIDELVEFEVAYAPPYSRPKDIINMIGYKARNK

    >gi|73663144|ref|YP_301925.1| hypothetical protein SSP1835 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MTVINMTESAAYEVKDMLQQNDMPDGYLKVKVNGGGCTGLTYGMSAEEEPGENDEIFEFYGLKVLVDKYDKPVLDGTTID
    FKQSLMGGGFQIDNPNAIAACGCGSSFRTAKVAGTPEDC

    >gi|73663176|ref|YP_301957.1| putative thioredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MKVTNQQRVNIDEHINQEKYLIFGYTPTCGTCKVSERMLDIANEILKLPITKIDLNFHPDFSQEHEIQSVPVLMLMSKGE
    EQKRIYAFQSVPNLLENLK

    >gi|73663179|ref|YP_301960.1| hypothetical protein SSP1870 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MIKFYQYPNCTTCKKAAKFLQDYGVSFEPIDIVQHTPTKNEFKEILEVTDIDINKLFNTHGAKYRELGLKDKLKDLTDDE
    KLDLLSANGMLVKRPLAISGDKVTVGFKEDEYKATWLS

    >gi|73663180|ref|YP_301961.1| putative thioredoxin [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MKPINTNDAFKETIQSDNPVIVKFEAGWCPDCKAMDMWIDPIQEKYNDYGWFTVNRDELEDVAAENDVMGIPSLLVFKNG
    EKLAHLHSANAKSPDQVESFLEETFK

    >gi|73663183|ref|YP_301964.1| OsmC-like protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MAVNYETKATNTGGRNGHVQTDDKAIDVAIVPPAQADAEKGTNPEQLFAAGYASCFNGAFDLILKQNKVRGAEPEVTLTV
    RLEDDPEAESPKLSVSIDAKVKNVLSQEEAEKYLQDAHEF
    CPYSKATRGNIEVDLNVAVVD

    >gi|73663262|ref|YP_302043.1| thioredoxin reductase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MAEQVDFDIAIIGAGPAGMTAAVYASRANLSTVMIERGMPGGQMANTEEVENFPGFEMVTGPDLSTKMFEHAKKFGAQYQ
    YGDIKSIEDKGAYKEVNLGNKVITAHAVIISTGAEYKKIGVPGEQELGGRGVSY
    CAVCDGAFFKGKKLFVIGGGDSAVEE
    GTFLTKFADSVTIVHRRDELRAQKILQDRAFKNEKIDFIWSHTLKTINDKDGKVGSVTLESTKDGSEQTLDADGVFIYIG
    MKPLTVPFQDLGITNEVGYVLTNEDMSTSIPGIYAAGDVREKGLRQIVTATGDGSIAAQSAIAYIEHIKDTIEA

    >gi|73663642|ref|YP_302423.1| putative alkyl hydroperoxide reductase subunit C [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MSLINKEILPFTANAYDPQKDEFFEVSDENLKGSWSVVCFYPADFSFVCPTELEDLQGQYDKLQELGVNVYSVSTDTHFV
    HKAWHDHSDAISKIQYTMIGDPSQTITRNFDVLDEELGLAQRGTFIVDPDGVVQAAEVNADGIGRDASTLVHKIKAAQYV
    RQHPGEVCPAKWEEGSETLQPGLDLVGKI

    >gi|73663643|ref|YP_302424.1| putative alkyl hydroperoxide reductase subunit F [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MLNNQLKSQLQQLLQLMEGDVVLKASLGSDDKSKELKELLDEVSAASDYITIEASDLKRTPSFSVDKPNETSGITFAGLP
    MGHEFNSLVLALLQVSGRPPKEEQAIIDQIKAIDRPLHFETYISLT
    CQKCPDVVQALNLMSLLNPNISHTMIDGSIFREE
    SENIMAVPAIFLDGEEFGNGRMTIQDILANLGSQADPAEFNDKAPYDVLIVGGGPASGSAAVYTARKGLRTGIVADRIGG
    QVNDTATIENFVTVKETDGPKFSSALEDHIKQYDVDVMTGIRASDIEKTDDGIVVTLDNGAQLTSKTVIISTGARWRKLE
    VPGEEALINKGVAF
    CPHCDGPLFENKNVAVIGGGNSGVEAAIDLAGIVEHVTLLERNANLKADNVLQERLNSLPNVTVIK
    NAQTTEVLGDDAVTGIKYQDKAQGEEHTLDLEGIFVQIGLLPNTEWLNNYVELNDAKEIKVDRTNATSIPGIFAAGDVTD
    DRNKQIIISMGAGANAALNAFDYIIRH

    >gi|73663657|ref|YP_302438.1| putative pyridine nucleotide-disulphide oxidoreductase protein [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MKQYDLVIIGFGKGGKTLAKFASAQGKKVAVVEKSQEMYGGTCINIGCIPSKTLVHEGLGHGSFDQAFSRKTDVVNALNS
    KNYHNLADEDNIDVLDYTAKFKSNREVNLLNDQGDVVETLSAEHVVINTGAKSVIPPINGVESSKNLYDSTGIMNLDFQP
    KKLVIVGGGYIALEFASMFANFGTQVTVLERGDDIMPREDEDIVKEVKKDLADKQVDIVLNANTERFEDVEAGTLVHTTD
    GTYEADAVLLATGRKPNTDLNLENTDIELGEHGEIKVNEHLQTTAANVYALGDVKGGMQFTYISLDDFRIVKDQLFGNGE
    RSTENRGAVPYTVFIDPPLARVGLTSKEAKAQGYHIMENTVPVNTIPRHKVNNDPRGLFKAVVDKDSETILGVTLYGKES
    EEIINLVKLAIDQKLSYKVLNTNIYTHPTMVESFNDLFNM

    >gi|73663773|ref|YP_302553.1| putative dehydrogenases [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MKKIVIIGSVAAGTSVAAKARRNSEDVEITVFDKDSDISYSVCGIPYYIGGNVSDIDELTPRNAKWFKERFNIDIYTEYE
    VNKINDSDQTITVTNLVNDEKMIQKYDELVLATGSSPKELPQLNSEEYNNVFKVKNINDAKAIYNYINDHDVQNITIVGG
    GFIGLEMLEQLSNYNTSIVQRNTFMPHLDYDMSFMIQEYIEDKANVYTYNEIDIIDYDENHTINRVSLKTGELIDTDLII
    IGIGVTPNTKLAKEIGINIGESGAIQTNKYLETNIPHIYAIGDAAESYNLITGNPIYRPLGSTANKMGRILGDRLTGGNL
    EHKGILGTGIVRIFDMTIAQTGLTEKEAVELEIDIDVLHNVKPNRPEYMQGQEMVIKAIFDKNNSKLLGAQIVGYEGVDK
    RIDVLATAITFGAKAEDLFHLDLAYAPPFSTTKDPVIYTGMIGHNITRGRKIITPEEVVKQKNDLLILDVRSPKQFEVDH
    VDGAINVPLKTLRSYAKTLDENQTIVTY
    CNKGTTGNAAQNVLINLGFKQVYNLSGGNKNYQRYKRFQVEREKKN

    >gi|73663788|ref|YP_302568.1| putative dinucleotide-utilizing enzyme [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MIERYNRQVRYHQFGEYGQSQLQKTHVMIMGAGALGSHSAEMLVRMGVGSLTVIDMDIVELSNLHRQALYDELDAEKMLP
    KVEALKHKLNQINSNVQVIAIDREITNLNIENLLSTYHPDIVIDGMDHFKIRYLINESCNKQNIPWIYGAAVGSKGTVYG
    IDDQGPCLKCLLETMPSTGES
    CAINGVLPPVIYQVASIQVSELMRWVSGEAFSKKLITIDCFNMQYKSMDVNALKQSDCN
    VCKKHEYALLNDKYDNKIEKQCGDMFLLRFNADIFSHTDYLPVTVKKANNFVKLLSYKPYEITLFKDGRMHVYGVENEGE
    AEKIYREIGKSLS

    >gi|73663819|ref|YP_302598.1| putative cadmium-transporting ATPase [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MNVYRVQGFSCANCAGKFEKNVKKIPGVQDAKVNFGASKIDVFGSATVEELEKAGAFENLKVAPEKPKRRVEPVVIKDKN
    VYRVEGFS
    CANCAGKFEKNVKQIAGVEDAKVNFGASKIDVYGNASVEELEKAGAFENLKVSPEKLANQTIQRVKDDTKAH
    KEEKTPFYKKHSTLLFATLLIAFGYLSHFVNGEDNLVTSMLFVGSIVIGGYSLFKVGFQNLIRFDFDMKTLMTVAVIGAA
    IIGEWAEASIVVILFAISEALERFSMDRARQSIRSLMDIAPKEALVRRNGQEIIIHVDDIAVGDIMIVKPGEKIAMDGII
    VNGLSAVNQAAITGESVPVSKAVDDEVFAGTLNEEGLIEVKITKYVEDTTIAKIIHLVEEAQGERAPAQAFVDKFAKYYT
    PIIMVIAALVAVVPPLFFGGNWDTWVYQGLAVLVVGCPCALVISTPISIVSAIGNAAKKGVLVKGGVYLEKLGAIKTVAF
    DKTGTLTKGVPVVTDFEVLNDQVEEKELFSTITALEYRSQHPLASAIMKKAEQDNIPYSNVQVEEFTSITGRGIKGIVNG
    TTYYIGSPKLFKELNVSDFSLGFENNVKILQNQGKTAMIIGTEKTILGVIAVADEVRETSKNVIQKLHQLGIKQTIMLTG
    DNQGTANAIGTHVGVSDIQSELMPQDKLDYIKKMQSEYDNVAMIGDGVNDAPALAASTVGIAMGGAGTDTAIETADIALM
    GDDLSKLPFAVRLSRKTLNIIKANITFAIGIKIIALLLVIPGWLTLWIAILSDMGATILVALNSLRLMRVKDK

    >gi|73661747|ref|YP_300528.1| hypothetical protein SSP0438 [Staphylococcus saprophyticus subsp. saprophyticus ATCC 15305]
    MSCFNSIIDKVEGLIMTEVKHLTFGSKNAPITIESFINFACPFCKNYFKAADHALTPHIESGEVQHVVKHFDKTKQALLK
    GTVANIHLNYDKPEETLAIIRQLYDTQDQWKVSFATVEDKMANEFNLTPQKDADERSLAINEETFERGIKGIPTVFINNE
    KFEFNPLKDEQDKIESLLNEAISKLK