Staphylococcus haemolyticus

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|70725218|ref|YP_252132.1| hypothetical protein SH0217 [Staphylococcus haemolyticus JCSC1435]
    MKQYDVVFIGSGHAAWHAALTLKHAGKDVAIIEKDTIAGTCTNYGCNAKILLEGPYEVLEESAQYNGIIQSQDLHVNWEN
    LMDYKKQVINPMNGMLKGMFEQQGIDVYMGAGVIKDAHTVTVNDEALQTENIVIATGQHSNKLDIEGKELTHDSRDFLSM
    DELPKRMTFIGVGIISVEFASIMIKSGVEVTMIHHSDKPLKGFNQTHVTQLIKKLEDEGVHFYFDEETQKVEKIGEAYKV
    STASGLTIDTDYVLDATGRNPNVEGIGLDQVGIEYSKKGISVDGHLRTNVSNIYASGDVLDKAIPKLTPTATFESNYIAA
    HILGMTQDEIQYPAIPSVLYSLPRLSQIGVSVQGAEQNERYTVKHIPFGKQMAFEYKNETDAEMYVVLDEEKRLVGADIY
    GVDAADLVNLLVFIINQRMTAQDLNQLIFAFPGASSGVIDMLKVNML

    >gi|70725224|ref|YP_252138.1| hypothetical protein SH0223 [Staphylococcus haemolyticus JCSC1435]
    MTDSYDLIVVGAGPGGYVAAIRAAQLGQKVGIVEKTNAGGTCLNVGCIPSKTLLEHGTKAHDIRKANDWGIETQAMKVNF
    SKLVQRKQHIVSTLTGGVKQLLKKNKVTFIKGEATVTKDLEVKVNNQTYQAKDIILATGSKPFIPPIEGLNDIKYETTDT
    FFDIETLPKQLAIIGGGVIATELASSMADLGVEVTIIEVNEDILLTEIEEVRELLKDHLKNQSIRILTGAKISKVTTSKV
    ILDNHEDVSFDTLLVATGRQPNIKVAEDLDIDMDGKFVQVDEHYQTTINHVYAIGDLVKGYQLAHSASAHGLHVVETLAG
    LKPTPVSPNNITRCIYTRLEAASVGLSESQAKEAGYDVSVTQSSFQGNAKALVKGEAQGFIKIVTDKAYGEVLGAFIVGP
    HATDLISEILGVKASEGTMNELSNIIQPHPSLSEAIGESADAYFGKAIHM

    >gi|70725228|ref|YP_252142.1| hypothetical protein SH0227 [Staphylococcus haemolyticus JCSC1435]
    MSKSYDLIVIGAGPGGYVAAIRAAQLGKNVAIVEKQHVGGVCLNVGCIPSKIFLEYGAKMRDIHSANNWGIKTNHIDIDV
    TSLVKRKDQVVKTVTDDVRDALRQHNVDFIEGEAEVLEGLKVQVDQAIYTAKDIILATGTKPFVPPIEGLDKAHFEIADT
    FFDMEQLPKQLVIIGGGVIASEIASSMADLDVDVTILEKGDSILSSEIKEIRDHLSTYLKQQGVNIITNSETKKVNAKTL
    EIGGKDGPKEIPYETLLFATGRQPNVHVAKALNLEQNGKCLQVNEHYETSYAHVYAIGDLVPGYQLAHTASAHGKYVAEY
    IAGKQLETINQEDIPRCIYTRLESASVGLSELQAQEAGYEVEVTTAPFQKNPKAILKGETQGMVKIVANKQDGKILGGFV
    VGPHATDLISEILGIKVSGGTLNDISRIIQPHPSLSEVIGESTDASFGKAIYQ

    >gi|70725300|ref|YP_252214.1| hypothetical protein SH0299 [Staphylococcus haemolyticus JCSC1435]
    MDYRVLLYYKYTTIDDPETFAAEHLEFCKSNNLKGRILVSTEGINGTLSGTKEDTDKYIEHMHSDERFADMTFKIDEAEG
    HAFKKMHVRPRNEIVALGLEDDVDPRVTTGKYYSPSEFKEALEDEDTVILDARNDYEFDLGHFRGAIRPDITRFRDLPDW
    IRENKDQLDGKNIVTY
    CTGGIRCEKFSGWLVKEGFENVGQLHGGIATYGKDPETKGQYWDGKMYVFDERISVDVNQVEKT
    VIGKEHFDGTPCERYINCSNPECNKQILVSEENEDKYLGACSYDCAKHERNRYVAKNNISDEEWNRRLENFKDVPEHAHA


    >gi|70725344|ref|YP_252258.1| methionine sulfoxide reductase A [Staphylococcus haemolyticus JCSC1435]
    METVYIAGGCLWGVQAFIKTLPGVLSTEAGRANGISETLSDKYDGYAECVKTSFDPMQTSITDLMNYLFEIIDPYSINKQ
    GVDEGPKYRTGIYSDEQKHLEEARDFISKRPDKERIAVEVLPLNNYVASAEEHQDRLDKHPEDISYCHVTPDMLKKYL

    >gi|70725496|ref|YP_252410.1| hypothetical protein SH0495 [Staphylococcus haemolyticus JCSC1435]
    MTGMINKVINVEGMSCDHCRNAVESALAKLNGVTSAEVDLDKNQVRVDYDENRVSVEQMKEAIEDQGYDVK

    >gi|70725497|ref|YP_252411.1| copper-transporting ATPase copA [Staphylococcus haemolyticus JCSC1435]
    MSNKQNATLNITGMTCAACSNRIEKRLNKMDNVKAQVNLTTEKATIEYDTNDYAINDFVTTVQKLGYDVVIDKAELDITG
    MT
    CAACSNRIEKVLNKAPGVKDATVNLTTEQAMVTYYPGQTDLDTLIGRIRNLGYDAQPKQSEEDQATRKQQELKHKRNK
    LMISTILSLPLLMTMLVHLFNMHLPDILMNPWFQFILATPIQFIIGWQFYVGAYKNLRNGGFNMDVLVALGTSAAYFYSI
    YEMIKWFSGATNMPHLYFETSAVLITLILFGKYLEARAKSQTTNALSELLNLQAKEARLIDDNGMEKMVPLNQVNVDDIL
    LIKPGEKIPVDGQIIKGETAIDESMLTGESMPVDKHVDDVVIGSTMNTNGVITIMATKVGKDTALSNIIKVVEEAQSSKA
    PIQRLADIISGYFVPIVIAIALLTFLIWITLVHPGQFEDALVAAISVLVIACPCALGLATPTSIMVGTGRAAENGILFKG
    GEYVERTHQVDTVVFDKTGTLTHGKPEVTYFEGDKDTLTLVASAENNSEHPLATAIVNYAKQHKVNLVNVTNYQTLPGHG
    IQAIIDDSMLFVGNQKLMLDHQINIQSIKQKMKQMEAEGHTVMLIAYDGKLRGMIAVADTVKASAKEAIQQLSSMNIRTV
    MLTGDNERTAKAIAKEVGIDQVIAGVLPEDKAHHITQLQEQKHNVAMVGDGINDAPALVKADIGIAMGTGTEVAIEAADI
    TILGGDIQLVPKAIHASHKTIRNIKQNLFWAFGYNIAGIPIAAMGLLAPWIAGAAMALSSVSVVSNALRLKRMKL

    >gi|70725508|ref|YP_252422.1| hypothetical protein SH0507 [Staphylococcus haemolyticus JCSC1435]
    MSYSMLYKSPVQNLELISDGESLTHVLYKYNDTTVTHPTNPDLDIFKKVVEWLNEYFSGNRPQIDFSLKPEGTDFQKSVW
    RKLQEIEYGQLKTYGDLANLVGEERNKPNMSAQAIGGAVGSNPISIIIP
    CHRVVGKDGSLTGYGGTINHKIKLLELEQVD
    MNNLYRPKNSTKP

    >gi|70725525|ref|YP_252439.1| hypothetical protein SH0524 [Staphylococcus haemolyticus JCSC1435]
    MAKHLSNMEAFHQIINNNQLVVVHVMRDHCSVCHAVLPQIEDIVASYPNVKLAVINQSDVEVIAGELSIFTVPVDLIFMN
    GKEMHRQARFIDMQRFEHQLKLMYDSCFET

    >gi|70725562|ref|YP_252476.1| hypothetical protein SH0561 [Staphylococcus haemolyticus JCSC1435]
    MGAHQITIVDMDIVETSNLHRQALYTEDDALNMVPKVHAIKEHIARINHHVDVQTYYQEITSNNIEDILDEVKPDIVIDG
    MDHFKIRYLINEVCHKHQIPWVYGAAVGNKGTVYGIDFKGPCLKCLLKQMPSSGES
    CAINGVLPTIITQVASYEVAEVLR
    YLSGEGFSKKLITIDTWHIDFKAMNVDILKNHACEICANQHYSLLETKHQQHIESLCGRTYLFRYQSSIFEHAHHLPGEI
    VKSTSFAKLIKDDDYEITLFKDGRMNVYGIEDDEEAFKLYHSYLKALK

    >gi|70725645|ref|YP_252559.1| hypothetical protein SH0644 [Staphylococcus haemolyticus JCSC1435]
    MKKIILIISMLMVLTIIMSACSNNNNEKQPPKTKNGKILIVEYGDFKCPYCKKVEKNVMPTIKKDYIDTNKVEYQFINAG
    FLGKDSIVGSRAGNAVQKVAPNEYLTFQRNVLSNQKDEDKKWLTEQFLDNEIDKLDITTQQKSDIKKQYKTKNSDAWKKA
    EEQKKMTEDNNIDTVPTVFINGKKVKDPYEVEEWKKYL

    >gi|70725777|ref|YP_252691.1| hypothetical protein SH0776 [Staphylococcus haemolyticus JCSC1435]
    MTSERYSRQTLFKGIGYEGQQKISQKHVLIVGMGALGTHVAEGLVRAGIKTLSIVDRDYIEFSNLQRQTLFTEEDANTML
    PKVVAAERHLKALRHDLKLNTFITHVDYYFLDKYAKHVDLIIDATDNFETRQLINDFAFKEKVPWIYGGVVQSTYIEAAF
    IPGETPCFNCLMPQLPAINLT
    CDTVGVIQPAVTMTTSFQLRDAFKLLTEQSVPTKLTYGDIWDGQHFTFGFSRMFRKECP
    TCGSNPSFPYLNKQHTLYATLCGRDTVQYDNDKISQEMVREFLKQHHLNYRENKYMIMFEYKGHRIVSFEGGRMLIHGTT
    KTLDAIHLINQLFG

    >gi|70725988|ref|YP_252902.1| hypothetical protein SH0987 [Staphylococcus haemolyticus JCSC1435]
    MIWMIISGLIVGILLGFVMQRTRFCLAGGFRDMYVQKNNKMFYALLVAITVQSIGLLILTGLNVISIPDSTFPIIGTIIG
    AFIFGIGIVLAGG
    CATGTWYRAGEGLIGSWVALVLYAVTAAITKTGILLPVMSWINKPTNINANMSQTTGIPMWVFTLVL
    TIITIIFVTKTLRKPKPKFAVPKLKQKYSGLRHYLFEKRYHPFVAGIAVGLIALIAWPMSISTGRDYGLGITTPSANLIT
    FLITGDTKLIDWGVLLILGIFLGSYIAAKGSREFKWRLPDKKTIRNSAIGGICMGFGASVAGG
    CSIGNGLVETAIMSWKG
    WIALGSMILGVWFMSYFIFIRPMKKLEKQTSKSQATTATKQVQTT

    >gi|70726099|ref|YP_253013.1| hypothetical protein SH1098 [Staphylococcus haemolyticus JCSC1435]
    MLKKGQKFPEFKLENQNGEWITNETIKGSKTIIYFYPRDNTPTCTTEACDFRDNIEQFNDLNVQIYGVSGDTKKKHQNFI
    AKHNLNFDLLVDEDFQLSKAIGVYQLKKSFGKESMGIVRTTFIIDEDGVIIDVIEKVKVKTQIEELNQILG

    >gi|70726165|ref|YP_253079.1| hypothetical protein SH1164 [Staphylococcus haemolyticus JCSC1435]
    MESITVDQLKEKVLESNPVNIVDVRTDEETAMGVIPEAKTIPMDQIPDNLNQFNKNETYYIICAAGMRSAKVVKYLEDHD
    IHAINVEGGMNEWGTAGTEINSI

    >gi|70726179|ref|YP_253093.1| hypothetical protein SH1178 [Staphylococcus haemolyticus JCSC1435]
    MIKLESESQFNSLKKENTVFEFTAGWCPDCRIIEPDLPRLEEKYNHFNFVSVDRDEFIDLAIENDIMGIPSFLVYKNDEL
    VGSYIGKERKSIEQIDEFLSKYV

    >gi|70726203|ref|YP_253117.1| hypothetical protein SH1202 [Staphylococcus haemolyticus JCSC1435]
    MVKHDFKVQTKWRGGREEVGTVNGDIISEQISIPAPLGGNGVGTNPDELLVSAASSCYIISLAATLERAKFTDINLINNS
    VGTALFENGKFKMVTITHYPKISVTAEDKENLEKRLPKLLEIADNN
    CMISNSIRNNVEIKIQASIQ

    >gi|70726213|ref|YP_253127.1| hypothetical protein SH1212 [Staphylococcus haemolyticus JCSC1435]
    MTQITFKNNPIHLAGSEVSEGQHAPDFKVLDNDLNEVSLENYKGQKKLISVVPSIDTGVCDQQTRKFNEEAAQEDGVVLT
    ISADLPFAQKRWCASNGLDNVITLSDHKDLSFGQQYGVVMEELRLLARSVFVLDSNDKVVYKELVSEGTDFPNFDAALEA
    YRNI

    >gi|70726398|ref|YP_253312.1| dihydrolipoamide dehydrogenase [Staphylococcus haemolyticus JCSC1435]
    MSENQYDLVILGGGTAGYVAAIRASQLGNKVAIVEKSLLGGTCLHKGCIPTKALLKSAEVLRTVKDSVHFGVNVGQYSFD
    LKSMMKRKDKIVNQMHQGIESLMQKNHIDIFNGTGRIMGTSIFSPQSGTISVEYDNVESELLPNQNVLIATGSLPTQLPF
    LPFNHNTVLSSNDILQLTDLPASIAIIGGGVIGLEFASLLIDLGVNVSVIEAGERILPNESAQIANFLKTSLIARGVTFY
    ENCALNESAVKVNSNSVTIQVNKDKTIEVEKVLVSIGRKPNTDDIGLNNTKIKTDDNGNILVNDFLQTEDKHIYAAGDCI
    GKLQLAHVSSKEAILAVEHMFNGNGLPLNYDKMPKCIYTHPEVASIGYNKESAEAKNIKTKSFKVSFNAIGKAVIEETTN
    DRGFCEMIINDETNEIIGINMIGPQVTELINEASLLQFMNGSAIELGLTTHAHPSISEVLMELGLKVENRAIHV

    >gi|70726483|ref|YP_253397.1| methionine sulfoxide reductase A [Staphylococcus haemolyticus JCSC1435]
    MAYATLAGGCFWCMVKPFTSYPGIEEVVSGYSGGHVENPTYEQVCTNQTGHREAVQIQFNSDITSFENILDVYFKTFDPT
    DGGGQFFDRGESYEPAIFYHDEEQKKAAELKIQQLNEEGIFKKPVITPILPYKNFYPAEDYHQDYYKKNPAHYEQYQRGS
    GRKSFIETHWGSQND

    >gi|70726484|ref|YP_253398.1| methionine sulfoxide reductase B [Staphylococcus haemolyticus JCSC1435]
    MIKKDKNELNEMEYLVTQENGTEPPFQNEYWNHFDKGIYVDKISGKPLFTSEEKFESNCGWPSFSKSIDDDEIIELVDKT
    FGMIRTEVRSEDANSHLGHVFNDGPKESGGLRY
    CINSAAIQFIPYDKLEELGYGDLIPHFEK

    >gi|70726549|ref|YP_253463.1| methionine sulfoxide reductase A [Staphylococcus haemolyticus JCSC1435]
    MNINTAYFAGGCFWCMTKPFDQFDGIETVTSGYMGGSTHNPTYEDVKSGTTGHYETVKIEYDVALFSYNKLLEVFFSVID
    PIDDGGQFQDRGSQYRTAIFYTNEDQKRLAEQYVHQLEQTIHSEKAIATKILPASTFYKAEEYHQDFYKKNPERYAQEQQ
    DRANYKSN

    >gi|70726605|ref|YP_253519.1| glutathione peroxidase [Staphylococcus haemolyticus JCSC1435]
    MENIYDFVVQKSNGEDYKLEEYKGKVMLIVNTASECGFTPQFEGLQALYEKYKDQGFVILGFPCNQFGGQEPGSGAEANQ
    NCKINYGVTFPIHEKVDVKGENQHPLFRYLTDAAKGMLSEKIKWNFTKFLVDRDGNVISRFSPQKKPAQIEKDIEKLL

    >gi|70726817|ref|YP_253731.1| thioredoxin [Staphylococcus haemolyticus JCSC1435]
    MAIVKVTDSNFDENIQSGVKLVDFWATWCGPCKMIAPVLEELAGDYDGKADILKLDVDENPSTAAKFEVMSIPTLIVFKD
    GEPVDKVVGFQPKENLAEVLDKHL

    >gi|70726857|ref|YP_253771.1| dihydrolipoamide dehydrogenase [Staphylococcus haemolyticus JCSC1435]
    MVVGDFPIETDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIAES
    VSLKFDKVQEFKKSVVNKLTGGVEGLLKGNKVEIVKGEAYFVDNNSLRVMDEKSAQTYNFKHAIIATGSRPIEIPNFEFG
    KRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSDVTILEGAKEILGGFEKQMVQPVKKGMKEKGVEIITEAMA
    KNAEETENGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELGLEELGLKFADRGLLEVDKQSRTSIDNIYAIGDIVPGLP
    LAHKASYEAKVAAEAISGQASEVDYIGMPAVCFTEPELAQVGYTEAQAKEEGLDYKASKFPYAGNGRALSLDDTTGFVKL
    ITLKEDDTVIGAQIAGNGASDIISELGLAIEAGMNAEDIALTVHAHPTLGEMSMEAAEKAIGMPIHTM

    >gi|70726871|ref|YP_253785.1| hypothetical protein SH1870 [Staphylococcus haemolyticus JCSC1435]
    MTELVIYTQNDCPPCTFVKNYLTEHKVDYIEKNISNNEYRSEMIDYDAFATPFILLDGEPMYQVDLDKINTKCHIKS

    >gi|70726962|ref|YP_253876.1| transcriptional regulator Spx [Staphylococcus haemolyticus JCSC1435]
    MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTRSKTYQKLNVDIDSLPLQDLY
    AIIQDNPGLLRRPIILDEKRLQVGYNEDEIRRFLPRKVRTFQLQEAQRLVD

    >gi|70726980|ref|YP_253894.1| coenzyme A disulfide reductase [Staphylococcus haemolyticus JCSC1435]
    MRKIIVVGAVAGGATCASQIRRLDKDSEITIFEKDRDMSFANCGLPYFIGNIVNERKDVLPITPDVFKEKKDITVKTYHE
    VIAINDKDQTVTVVNRQTNEKFEASYDKLILSPGAGANSLGFDSDYIFTLRNMEDTDAIDQFIDQHQAKKALVVGAGYIS
    LEVLENLYARGLDVTLIHRSEKVNKLMDQDMNQVIFDELDSRHIPYRLNEEIVSVKDHLVTFKSGIQEDFDIIIEGVGTH
    PHSKFIESSNVALDDKGFVKVNDKFETNIPNIYALGDVITSTYRHVNLPAQVPLAWGAHRGASVIAEQLAGNKNIIFKGF
    LGTNIVKFFDYTLASVGIKVEELTHFDYQMVELNSGTHAGYYPGNTNVHLRVYFDTNNRHLLRAAAVGKTGVDKRIDVLS
    MAMMSELTIDELTEFEVAYAPPYSHPKDLVNMIGYKARDL

    >gi|70727012|ref|YP_253926.1| hypothetical protein SH2011 [Staphylococcus haemolyticus JCSC1435]
    MSTVTLTEAAAYEVKDMLKSNDMEGGYLKIKVNGGGCTGLTYGMSAEEQPGENDEVLEFYGLKVLVDKYDVPVLNGTTID
    FKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPEEC

    >gi|70727050|ref|YP_253964.1| hypothetical protein SH2049 [Staphylococcus haemolyticus JCSC1435]
    MSKSVEIEDICENFNKEKHLIFGYTPMCGTCKMSERMLDIANEILQLPVKKIDLNYHPKYSERNKIMSVPVLIVMNKDIE
    IDRIYAFQSVPYLLEKLK

    >gi|70727053|ref|YP_253967.1| hypothetical protein SH2052 [Staphylococcus haemolyticus JCSC1435]
    MIKFYQYSNCTTCKKAAKFLDTHGVSYEPIDIVQHTPTKKEFEEIIDKTGVEVNKLFNTHGAKYKELGLKDKLKDLSTDE
    KLNLLASDGMLVKRPLAIAGDNITLGFKEDQYKEIWL

    >gi|70727054|ref|YP_253968.1| hypothetical protein SH2053 [Staphylococcus haemolyticus JCSC1435]
    MQSINTTDAFKSTIESDKPVIVKFEAGWCPDCKSMDMWIDPIVEKYNDYDWYTVNRDELEDVAADNDVMGIPSLLVFENG
    NKLAHLHSANAKSPEQVESFLSETFNK

    >gi|70727057|ref|YP_253971.1| hypothetical protein SH2056 [Staphylococcus haemolyticus JCSC1435]
    MAVQYETKATNVGGRKGHVNTDDNAINVDVLPPQQADGNATNPEQLFAAGYASCFNGAFDLILKQNKVRDAEPEVTLTVR
    LEDDPDAESPKLSVAIDAKVKNVLSQEDAEKYLQDAHEF
    CPYSKATRGNIDVDLNLQVVD

    >gi|70727126|ref|YP_254040.1| thioredoxine reductase [Staphylococcus haemolyticus JCSC1435]
    MTEVNYDVAIIGAGPAGMTAAVYASRANLSTVMIERGMPGGQMANTEEVENFPGFEMITGPDLSTKMFEHAKKFGAEYQY
    GDIKSIEDKGDYKEINLGNKEITARAVIISTGAEYKKIGVPGEQELGGRGVSY
    CAVCDGAFFKNKNLFVIGGGDSAVEEG
    AFLTKFADKVTIVHRRDELRAQKILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLVSTKDASEETLDADGVFIYIGM
    KPLTAPFVNLGITNDMGYIVTEDNMSTKVPGIFAAGDVRDKGLRQIVTATGDGSIAAQSAIDYIEELKDKQEA

    >gi|70727331|ref|YP_254247.1| hypothetical protein SH2332 [Staphylococcus haemolyticus JCSC1435]
    MTHFNLLVIGFGKAGKTLAKYVASQGQHVALVEQSSDNYGGTCINVE

    >gi|70727591|ref|YP_254507.1| alkyl hydroperoxide reductase subunit C [Staphylococcus haemolyticus JCSC1435]
    MSLINKEILPFIAQAYDPKKDEFKEVSQDDLKGSWSVVCFYPADFSFVCPTELEDLQNQYDKLQDLGVNVFSVSTDTHFV
    HKAWHDHSDAISKIQYQMIGDPSQTITRNFDVLDEEAGLAQRGTFIIDPDGVVQAAEINADGIGRDASTLVNKIKAAQYV
    RQHPGEVCPAKWEEGSESLQPGLDLVGKI

    >gi|70727592|ref|YP_254508.1| alkyl hydroperoxide reductase subunit F [Staphylococcus haemolyticus JCSC1435]
    MLNADLKQQLQQLLGLMEGDVEFRTSIGSDDKSKELKELLDEIAEMSEHITIVEKELKRTPSFSVSKPDEEAGVTFAGIP
    LGHEFNSLVLAILQVSGRAPKEKQSIIDQIKGLEGKYNFETYVSLT
    CQKCPDVVQALNLMSVVNPNITHTMIDGSVFREE
    SEDIMAVPAVFLDGEEFGNGRMTISDILTKLGSTQDASEFEGKDPYDVLIIGGGPASGSAAIYTARKGLRTGIIADRIGG
    QVNDTAGIENFITVKETTGSQFSANLAAHIEEYDIDTMTGIRATNIEKTDQAIRVTLENNAVLETKTAIISTGASWRKLN
    IPGEDRLINKGVAF
    CPHCDGPLFENKDVAVIGGGNSGVEAAIDLAGIVKHVTLFEYSSELKADTVLQDRLRSLSNVDIHT
    NARTAEVLGEDHVTGISYEDLNSGEMKELSLDGIFVQIGLVPNTSWIGDAVELNNRGEVVIDRNNNTNVPGIFAAGDVTD
    QKNKQIIISMGAGANAALNAFDYIIRN