Staphylococcus carnosus TM300 uid59401

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|224475528|ref|YP_002633134.1| hypothetical protein Sca_0034 [Staphylococcus carnosus subsp. carnosus TM300]
    MDNRIAYNEVAPEEIELMYQMEKQLKKANVDRRLRELIKIRASQINGCAYCLAMHTSDARKLGVSEEEIFLLNAWEDTNI
    YSKKDKLALELTEAITLIASAGVPDALYESVREEFSEEEYTGLVLTINQINMWNRLSISMGNQHNV

    >gi|224475532|ref|YP_002633138.1| alkyl hydroperoxide reductase subunit F [Staphylococcus carnosus subsp. carnosus TM300]
    MLKKELKSQLSQLLKLMEGDVVLTASYDDSEKSKELKDLLDEIADMSSHITVKEDTLERTPSFSVDRPDERTGVVFAGVP
    LGHEFNSLVLALLQVSGRPPKEEQSVIDQIKALDKPLHFETFISLS
    CHKCPDVVQALNLMSVLNPNISHTMIDGAVFKEE
    SKDIMAVPAVFLNGEEFGNGRMSISDILNMLGSKADPAEYDNKEPFDVLVIGGGPASGTAAIYTARKGLRTGIVADRIGG
    QVNETADIENFITVKETTGPEFSSALEQHINEYDIDVMDGMRATNIEKTEDGIVVTLDNDAKLKSKTVIISTGARFKNLD
    IPGEDELRNKGVAY
    CPHCDGPLFEGKDVAVVGGGNSGAEAAIDLAGIVKHVTLVEYKDFLRADEILQERLQELPNVTILK
    NAQSSEIVGDDHVTGLKYTDNKTGEKHQIDVEGVFVQIGLLPNTEWLEGAIDTNDGGEIIVDRKQSTSMPGVFAAGDVTD
    DRFKQIIIAMGSGADAALNAFDYIIRN

    >gi|224475533|ref|YP_002633139.1| alkyl hydroperoxide reductase subunit C [Staphylococcus carnosus subsp. carnosus TM300]
    MSLINKEILPFTADAYNPKEDEFIEVSDETLRGAWNVIVFYPADFSFVCPTELEDVQNQYDELQKLGVNVYSVSTDTHFV
    HKAWHDHSDAISKLQYTMIGDPSQTITRNFDVLDEEKGLAQRGTFIVDPDGVVQAAEINADGIGRDASTLVHKIKAAQYV
    RQHPGEVCPAKWEEGGETLEPGLDLVGKI

    >gi|224475906|ref|YP_002633512.1| putative thioredoxine reductase [Staphylococcus carnosus subsp. carnosus TM300]
    MAIQQPDYDVVIIGAGPAGMTAAVYASRADLKTLMIERGVPGGQMANTEDVENFPGFESISGPDLSTKMFDHAQKFGAVY
    QYGDIKSIEDEGDVKKIVYGDKSVTAYAVIITTGAEYKKIGVPGEEELGGRGVSY
    CAVCDGAFFKGKKLFVIGGGDSAVE
    EGAFLTKFADSVTVVHRRDKLRAQKILQDRAFKNEKMDFIWNHTLAAINEENGKVGSVTLQSTIDGKEETLPADGVFVYI
    GMKPLTAPFIDLGITNDAGYIVTNDEMETKLPGIYAAGDVREKGLRQIVTATGDGSIAAQNAQAYIEEVKDKLATEA

    >gi|224475943|ref|YP_002633549.1| putative thioredoxin [Staphylococcus carnosus subsp. carnosus TM300]
    MEAIKTREDFDKIIQSAEPVIIKFEAGWCPDCRAMDMWIDPIIKKYDEYKWYSVNRDELEEVTQENEVMGIPSLLVFQYG
    DKLAHLHSANAKSPEQVESFLSETFNK

    >gi|224475944|ref|YP_002633550.1| putative ArsC family protein [Staphylococcus carnosus subsp. carnosus TM300]
    MIRFYQYQNCTTCKKAAKFLDEYGVSYEPIDIVELNPNKRELQDIIDKTGVEIDKLFNKRGGKYRELGLKDRLDDLSDDE
    KLDLLASDGMLVKRPLAVSGDKITLGFNEKEYKETWVN

    >gi|224475947|ref|YP_002633553.1| hypothetical protein Sca_0454 [Staphylococcus carnosus subsp. carnosus TM300]
    MSTSKEERTDITQNFDKDKHLIFGYTPMCGTCKISERMLDIANEILQLPVTKVDLNFHADFSEQYQIQSVPVLLIMSKDE
    EMKRIYAFQSVPYLLENLK

    >gi|224476038|ref|YP_002633644.1| conserved hypothetical protein with HesB-like domain [Staphylococcus carnosus subsp. carnosus TM300]
    MPTVILTEAAAYEVKSMLESNDMPDGYLKIKVNGGGCTGLTYGMTAEEEPGENDEVIEYYGLKVLVDNYDKPVLEGTTID
    FKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPEDC

    >gi|224476071|ref|YP_002633677.1| coenzyme A disulfide reductase [Staphylococcus carnosus subsp. carnosus TM300]
    MTKIIIIGGVAGGATFASQLRRLDPDCDITIFEKDRDVTFANCGLPYYLGNIIDDRSELLHFTPEQFKENKGVTAKVFHE
    VIQVDPNNQTVTVKNLKTDEVFTEDYDYLVMSPGCRANQLPLNSDMAFTLRNLEDTDDIESYISNNNVKKAPIIGAGYIS
    LEVLENLYNRGIQTTLIHRSEQINKLMDQDMNKVIFDEMDKRQIDYRLNEEVDSVDGHTVHFKSGNTEDFDIIIEGIGIK
    PNTEFLEGAGIEEDDAGYIPVNEYFQTNYRNVYAIGDIVSNYYRHVNIPTHVPLAWGAHRGASIVAEHITQTRNVPFKGF
    LASNAVKFFDYTLTSVGVSPSDLKHFDYTMVETEQMNHAGYYPGAEPLHLRVYFENKSRKILRAAAAGKSGADKRIDILS
    MAMQNDMTVDELTEFESAYAPPFSSPKDIINMIGYKAQNK

    >gi|224476090|ref|YP_002633696.1| putative ArsC family protein [Staphylococcus carnosus subsp. carnosus TM300]
    MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTRSKTYQKLNVDIDSLPLQELY
    TIIQDNPGLLRRPIILDEKRLQVGYNEDEIRRFLPRKVRTFQLQEAQRMVDL

    >gi|224476119|ref|YP_002633725.1| putative pyridine nucleotide-disulfide oxidoreductase [Staphylococcus carnosus subsp. carnosus TM300]
    MEQYDLAVIGFGKAGKTLAKFAASQGKRVAMIERDQKMYGGTCINVGCIPSKTLIHDGLEGDSFESAFDRKRQVVSALNQ
    KNYHMLADEPSIDVIDAVAQFKSNHEIVLLDHENQDLGELTADDILINTGATPVIPDIEGIETSEHLYDSAGIMDLPFKP
    KQLVIVGAEYIALEFASLFAHLDVDVTVLANHDDILPKEDPEIVELVKEDLTAAGVNLVFNVDTKRFEDIENGTIVYTND
    GEYEADAVLLATGRQPNTQGLGLENTDIKVGERGEIVVNDHLQTDVPNVYAAGDVVGGMQFTYISLDDFRIIKDQLFGNG
    ERSTQNRGAVPYTVFIDPPLSRVGMTGDEAREAGYSVYETKLPVNNIPRHKINNDGRGMLKAVMDEKTGLILGATLYSTG
    SEELINLVKLAIDQKIPYSVLGNNIYTHPTMAEAFNDLFK

    >gi|224476196|ref|YP_002633802.1| putative glutaredoxin [Staphylococcus carnosus subsp. carnosus TM300]
    MTQVTIYTQNECPPCQFVKNYFDEHKVAYTEKNVSNSTFRNEMIDYDAFSTPFILIDDHPMYQVDLDKINQLLQIHH

    >gi|224476211|ref|YP_002633817.1| dihydrolipoamide dehydrogenase component of pyruvate dehydrogenase E3 [Staphylococcus carnosus subsp. carnosus TM300]
    MVVGDFPIETDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGELGGVCLNVGCIPSKALLHVSHVFQEAQHSDNLGIIAKD
    VELKFDKVQDFKKSVVNKLTGGVEGLLKGNKVEIVKGEAYFHDSNSLRVMDEKSAQTYNFKNAIIATGSRPIEIPNFKFG
    ERVIDSTGALNLQEAPKKLVVVGGGYIGSELGTAFANFGTEVTILEGAKDILGGFEKQMTQPVKKKMKEKGIEIVTEAMA
    KSAEETADGVKVTYEAKGEEKSIEADYVLVTVGRRPNTDEMGLEELGLKFADRGLLEVDDQSRTSIKNIFAIGDIVPGLP
    LAHKASYEGKVAAEAISGEKSAVDYIGMPAVCFTEPELATVGYNEAQAKEEGLDYKASKFPYAANGRALSLDDTTGFVKL
    LTLKEDGTLIGAQVVGTGASDIIAELGLAIESGMNAEDIALTVHAHPTLGEMSMEAAEKAIGLPIHTM

    >gi|224476252|ref|YP_002633858.1| putative thioredoxin TrxA [Staphylococcus carnosus subsp. carnosus TM300]
    MALVKVTDSNFDEKVQDGVKLVDFWATWCGPCKMIAPVLEELAQDFEGKADILKLDVDENPNTAAKFEVMSIPTLIVFKD
    GKPVDKVVGFQPKENLAEVLNKHL

    >gi|224476317|ref|YP_002633923.1| putative thioredoxin [Staphylococcus carnosus subsp. carnosus TM300]
    MKTITTFDDLENEINTNEKLLLFVMSDGCTVCHADQPRVQSLVEDIDLPAVQITVNQMPEAAGQLSLFTSPVVILFNQGK
    EFHRQARIIDFEKLNRSMEQLKML

    >gi|224476441|ref|YP_002634047.1| putative glutathione peroxidase [Staphylococcus carnosus subsp. carnosus TM300]
    MNIYDIEVTKVNGDTYRLNKYKGDVMLIVNTASQCGFTPQFEGLQALYEKYKDQGFTVLGFPCNQFGKQEPGNGQEAMQN
    CKINYGVTFPMHEKIKVNGEERHPLYKFLTEQQNGFFNSKIKWNFTKFLVDRDGNVVNRFSPQKSPSQIESDIEDLL

    >gi|224476492|ref|YP_002634098.1| putative peptide methionine sulfoxide reductase I [Staphylococcus carnosus subsp. carnosus TM300]
    MNINTAYFAGGCFWCMTKPFDSYDGIEKVTSGYMGGTVENPTYEEVKKGETGHLETVKVEYDVALFSYHKLLEIFFSVID
    PTDAEGQYQDRGSQYRTAIFYTNEDQRETAEQYIEELKSTINRDKAIATQILPVSEFYEAEEYHQDFYKKNPERFAEEEQ
    QREAIKQQQNK

    >gi|224476554|ref|YP_002634160.1| putative peptide methionine sulfoxide reductase [Staphylococcus carnosus subsp. carnosus TM300]
    MLKKNKDELNDLEYLVTQENGTEPPFQNEYWNHFEKGIYVDKLSGKPLFTSEEKFESDCGWPSFSKALSDDEVVELVDKS
    FGMVRTEVRSEDSNSHLGHVFNDGPAETGGLRY
    CINSAAVQFIPYDKLEELGYGDLIPHFKDQGEK

    >gi|224476555|ref|YP_002634161.1| putative peptide methionine sulfoxide reductase [Staphylococcus carnosus subsp. carnosus TM300]
    MAYATLAGGCFWCMVKPFTSYPGIKSVVSGYSGGHVENPTYEEVCSNTTGHVEAVQIEYDPEVTSFENILDVYFKTFDPT
    DDKGQFFDRGESYEPVIFYHDEDQKKAALAKIQELNEQMIFNKPVITPVKPYKNFYPAEGYHQDYYKKNPMHYEQYQKGS
    GRKDFIEKHWGNQDA

    >gi|224476627|ref|YP_002634233.1| putative E3 component of branched-chain alpha-keto acid dehydrogenase complex [Staphylococcus carnosus subsp. carnosus TM300]
    MAEEQYDLVILGGGTAGYVAGIRASQLGKKVAIVENQLLGGTCLHKGCIPTKSLLKSAEVLHTVKTSSLYGIDTDEYSIN
    YSKILDRKDEIVNQMYTGIEYLMQHNHIDIYNGTGRILGSSIFSPRPGTISVEYENGESELIPNDYVLIATGSQPADLPF
    LKFNHETIVSSTDLLKLKELPKSIVIVGGGVIGMEFASLLNDFGTDVTVIEAGESILPNENKSVVSNLKDHFAKRGIKIH
    ENVLLSEDNIKINNESIEINNKELNVTADKLLLAVGRKPNTSDIGLNNTKIKLDSKGFIEVNENQQTAEQHIFAAGDCIG
    KLQLAHAGSKEGTAAVEFMFEDGSIPVDYNSIPRCIYTHPEIASIGMTLEEAKNADFKKARSFKVPFKAIGKAVIEDAEH
    HDGFCEIVVDQSTDSVLGMSMIGPHVTELINEVALLQFMNGSTLELGLTTHAHPSLSEVLMEAGLKASKRSVHA

    >gi|224476802|ref|YP_002634408.1| putative thioredoxin peroxidase [Staphylococcus carnosus subsp. carnosus TM300]
    MVQITFGGDPVTLSGNPVEEGQTAPDFTVVNNDLEEVTLKDYDGKKKLISAVPSIDTGVCDKQTRKFNEEASSEEGGVVL
    TISEDLPFAQKRWCAASGLDNVILLSDYQKHSFGKNFGVLMEGLELLARSVFVLDKDNKVVYSEIVSEGTDFPDFESALK
    AYKELD

    >gi|224476812|ref|YP_002634418.1| hypothetical protein Sca_1328 [Staphylococcus carnosus subsp. carnosus TM300]
    MPEHDFIINTQWSGGRDEVGRAQGNVINEEISIPGSLGGQGVGTNPDEMLVAAASSCYIISLAAALERARFTSVSINQQS
    IGTASLNNGKFKMERITHKPQITVNRTEKEQLEKRLNSLLKIADNN
    CMISNSIRGNVEIKIEPTIL

    >gi|224476834|ref|YP_002634440.1| putative thioredoxin [Staphylococcus carnosus subsp. carnosus TM300]
    MKTLESVEQFEELKQGKTVFMFTADWCVDCRFIKPRLPELEENHKDFTFVSVDRDKFIDLCVDLGIMGIPSFLVYENGEQ
    VGSYVSKDRKTIEQIDEFINNI

    >gi|224476846|ref|YP_002634452.1| hypothetical protein Sca_1363 [Staphylococcus carnosus subsp. carnosus TM300]
    MESITTDELKKKILDHSPVHVVDVRTDEETATGIIPNATTIPMDQIPEHLDDFNDHDTYYFICAAGVRSGRIVEYLNQHK
    PEVHAVNVEGGMKAWGDEGLEIDSI

    >gi|224476920|ref|YP_002634526.1| putative bacterioferritin comigratory protein [Staphylococcus carnosus subsp. carnosus TM300]
    MLEKGEKFPEFALENQDGEVITNETLKGKKAILYFYPRDNTPGCTTEACDFRDNMAMFNDLDIAVYGISGDSKKKHQNFI
    AKHDLNFDLLVDEDYKLAEQTGVYQLKKSFGKESMGIVRTTFVIDENGVVTHVIEKVKVKEQMDQLKEMLG

    >gi|224477035|ref|YP_002634641.1| hypothetical protein Sca_1551 [Staphylococcus carnosus subsp. carnosus TM300]
    MIWMILSGLIVGGLLGFVMQRTRFCLAGGFRDMYVQKNNKMFYALLIAISVQAIGLLAFTAIIGKPLDNGTFPIVGTVIG
    SFIFGVGIVLAGG
    CATGTYYRAGEGLIGSWLALISYAIFSAITKAGLLKPVMEKLNSKTNVNADMSTSTGIPAWIFVIGL
    VAVTGYLVVRTLRKPKPKIAIPKLKQRYTGIRHFFFEKKFHPFVAAIAVGLIALLAWPMSYSTGREGGLGITTPSSNLVQ
    FILSGKTSFLDWGVFLVLGIFIGSYIAAKGSREFAWRLPDKKTLRNSVIGGAFMGFGASVAGG
    CSIGNGLVATAALSWQG
    WIALAAMILGTRFMSYFLFVKPMKAMQKSSKQNAARPAAQS

    >gi|224477069|ref|YP_002634675.1| putative copper-transporting P-type ATPase [Staphylococcus carnosus subsp. carnosus TM300]
    MLEKAEFKISGMTCAACSARIERVLNRTEGVDSANVNLVTEKAAVDFKGNDIDINEIFEKVKNLGYEPIAIETAEETQKR
    KKKELDKQKYKFIISLILSLPLIYTMVGHFSFLSFLPLPHFMVQPWFQFILATPVQFILGWQFYKGAYSSLRNKSANMDV
    LVALGTSAAYFYSIYLAIIHYGESHIPLYFETSAVLITLILLGKYFEAKAKGHASDAINKLLSLQVKEARVERNGEAVEV
    PVDQVEKGDILLVKSGEYIPLDGEIIEGNTSIDESMLTGESIPVDKEKDDEVIGATLNHGNFIKVKVTQTGDDLVLNQII
    RIVEEAQGEKPNIQRLADKISGIFVPTVLIIALIVFIVWFSLITPLDFQSSLEVFIAVIVIACPCALGLATPTSIMAGSG
    RAAELGVLFKSSESLEQTQNVDTIVFDKTGTLTEGHPTVYKVIDNTDNQQFGTLVKSMEQQSEHPLSQAITEYYADTPSV
    PVEHYQTHAGNGISGEINGQKIQIGSISFIKPVLDNWDNQIEEEIEGLQKQGATVVLAAIDKKFAGMIALRDEPKETAKN
    LIHQLRDEYDIIMLSGDTQTTAESIAFELGIEHVIAGVKPDDKANQIGRLQDEGKNVMMVGDGINDAPALAKSNIGLAMG
    TGSDIAIEAGDIMIVGGDIQKVDIALDMSKKTLKNIKENLFFAFCYNAIGIPVAAFGLLAPWIAGTAMAFSSVSVVLNAL
    RLQKVKYQKNLQK

    >gi|224477070|ref|YP_002634676.1| putative copper-ion-binding protein [Staphylococcus carnosus subsp. carnosus TM300]
    MEEKQLKVEGMSCGHCKSAVESAVGNIEGVDNVNASPENDTVDVKFNGEANVLSEIEKAIYDAGYDVVK

    >gi|224477249|ref|YP_002634855.1| putative molybdopterin biosynthesis protein moeB [Staphylococcus carnosus subsp. carnosus TM300]
    MNERYSRQILFKNIGVEGQEKISQKHVLIIGMGALGTHLADGLVRAGVRKLTIVDRDYIEFSNLQRQTMYTENDAKEALP
    KVIAAKERLTEIRSDIEIDAYIDQVNPPFLEEHAQHVDLILDATDNFDTRLLVNDFAYKYNIPWIYGGVVQSTYIEAAFI
    PGQTPCFNCVMPQLPVINMT
    CDTVGVIQPAVTMTTSLQLRDALKILTDTPFTPKLTYGDIWEGTHYTFGFSRMFDSTCTT
    CGPNPTYPHLHQTDQQYATLCGRDTVQYSNENITQEMLKQYLDAHHIHYHANPYMLRFEFNGHRIVSFSGGRMLIHGMTK
    PTEAIKLMNQLLG

    >gi|224477392|ref|YP_002634998.1| hypothetical protein Sca_1907 [Staphylococcus carnosus subsp. carnosus TM300]
    MKKLALLVCIGIIAAVLQGCSQKDPDLNSKNGKIRVVEFADYKCPYCKKVEDNIMPKLEKDYIDKGKVDYQMVNVAFLGK
    DSIIGSRAGHAVKNIAPKQYLDFQKKIFAVQPDTEDHKKPWINEKLLDKLIDGLKISNKQKADIKKDYKTKNSKSWKDAE
    KDKAFAKKKNIDTVPVVFVDGTKLDDPYHFKEYKDLLEK

    >gi|224477484|ref|YP_002635090.1| putative methylated DNA-protein cysteine methyltransferase [Staphylococcus carnosus subsp. carnosus TM300]
    MMYITDYQSPVGVLTLESDGENLTGLYYDGQLDKENPKLEKVNQADQKIFETVSLWLDEYFQGKNPSINFPYKAEGTEFR
    EQVWHELAKIPYGETVTYGNIAKKIAALRGKEKMSAQAVGGAVGSNPISIVIP
    CHRVVGQDNHLTGYGGGINVKKHLLEC
    EHHNLDDFKE

    >gi|224477564|ref|YP_002635170.1| putative molybdopterin biosynthesis protein MoeB [Staphylococcus carnosus subsp. carnosus TM300]
    MIDNAHHSEKNSNNNIRSDERFSRQTRYTPFGNDGQKALENAHIMVMGAGALGSHLAEQLVRMGIGKLTIVDMDIVEISN
    LHRQALYDENDAIEMQPKVYALAEKLSQINSNVEIYPIYQEITPTNIEHMIKDASPDILLDGMDHFAIRFLFNEVCHKLH
    LPWVYGAAVGGKGSIYAIDFTGPCLRCLMQETPETAES
    CAINGVIPPVIMQVVSYQIAEVMRYLSGKRFSGKLITVEPFN
    IKQQSIDVSHLRNPDCPLCGNGEYERLGIAQPKWIEGSCGDTYVFRFKPQHFENAVLFPGNILKSNAFVKLLNIEGHSAT
    LFKDGRMNVHGIENDNHAEKLYQQLLKSMK

    >gi|224477584|ref|YP_002635190.1| putative NADH oxidase [Staphylococcus carnosus subsp. carnosus TM300]
    MKYVVVGTSHAGYAAIQTLLISDPEAQIEVFESASSPSFLSCGIQSYLEDIAPSLQSLHYADAESLKSQGVNLHLETTVT
    DLDTKNKTVTVEKDGNQSEVSYDKLFLSPGGVPNEPPIDGINDYNNVLFMRGEEWAGKIKERMQNAKKAIVVGGGYIGIE
    AAEAFTKAGIDTTIMDDGDRIIKTYLDKEFTDILEKISAEHGLKFKGNENVKALKADDNNNVTGVVTDSGEYEADTVLFA
    VGVNPATDWLDGKVELGKKGIIKINERLETSEEDVYASGDATLIPYAPIHEERYIALATNSRRQGYVAARNMAGKEMKMP
    RVSGTSGLALFDYKFGQTGVHETEADSYDGNLGAKYIEVPVRPKFRQDDTKVHLKIIYDEDTHRILGGQIMSTEDLVESI
    NTISVAVNAGWTLEDLALVDFFFQPDFDRPWNYLNVLAQSALGDDVFPEDKQLF

    >gi|224477653|ref|YP_002635259.1| hypothetical protein Sca_2169 [Staphylococcus carnosus subsp. carnosus TM300]
    MVKFKTVQITDLTDADLEAMGQQGQLIDVRETEEYEAGHIDGAQSYPLSSLNTKFPLDQSKTYYLYCQAGKRSQQASQML
    SDSGFTVVNLNGGYQAFQDKAEAEKAQTAPTKNEKEATDSAITETAQETTAPPSLKSRRKKVNYSGMQCPGPLMNVNQEL
    KQLKPGDQLEVVVTDPGFASDIKSWASQTGNTLVDLKQSEKEVTAVIEKAEQQPKDLSVQHTEKGTTIVLFSGELDKALA
    AFIIANGARAAGREVSIFCTFWGLNALKRPNPGKVKKTGIERLFGMMLPSGPENMPLSKMNMFGLGRLMMKMIMKQKNVD
    SLPTLIDKAIDNDIKLIACTMSMDVMGIKKEELRSEVEFAGVGTYIGDTEHANHNLFI

    >gi|224477768|ref|YP_002635374.1| putative peptide methionine sulfoxide reductase [Staphylococcus carnosus subsp. carnosus TM300]
    MNEVIYLAGGCLWGVQAFVKTLPGVVETEAGRANGSTHDLDGQYDGYVECVKTIFDSNKVSAKDLIGHLFEIIDPYSRNQ
    QGEDIGPKYRTGIYSEQASHLEEAKEYIQDRSDRIRVVVEVLPLTNFVPSAEEHQDRLDKYPDDYCHIPKKLLQKYNA

    >gi|224477785|ref|YP_002635391.1| hypothetical protein Sca_2303 [Staphylococcus carnosus subsp. carnosus TM300]
    MDYRVLLYYKYVTIDDPETFAAEHLEFCKENNLKGRILVSTEGINGTLSGTKEDTDQYIAHMRADERFKDITFKIDEAEG
    HAFKKMHVRPRHEIVALDLENDIDPRETTGKYLSPSEFREALEDDDTIVIDARNDYEFDLGHFRGAVRPNITRFRDLPDW
    IKENKEVFMDKKIVTY
    CTGGIRCEKFSGFLLKEGFEDVAQLEGGIATYGKDPETKGELWDGKMYVFDERISVDVNQVEKT
    VIGKEWFDGTPCERYINCSNPECNKQILVSEENEHRYLGACCKECAEHERNRYVAKHNISDEEKEKCLENFKETVQQ