Staphylococcus aureus COL uid57797

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|57652415|ref|YP_184956.1| metallo-beta-lactamase family protein [Staphylococcus aureus subsp. aureus COL]
    MFFKQFYDKHLSQASYLIGCQKTGEAMIIDPIRDLSSYIRVADEEGLTITHAAETHIHADFASGIRDVAIKLNANIYVSG
    ESDDTLGYKNMPNHTHFVQHNDDIYVGNIKLKVLHTPGHTPESISFLLTDEGAGAQVPMGLFSGDFIFVGDIGRPDLLEK
    AVKVEGSSEIGAKQMFKSIESIKDLPDYIQIWPGHGAGSPCGKSLGAIPTSTLGYEKQTNWAFSENNEATFIDKLISDQP
    APPHHFAQMKKINQFGMNLYQPYTVYPATNTNRLTFDLRSKEAYHGGHIEGTINIPYDKNFINQIGWYLNYDQEINLIGD
    YHLVSKATHTLQLIGYDDIAGYQLPQSKIQTRSIHSEDITGNESHILDVRNDNEWNNGHLSQAVHVPHGKLLETDLPFNK
    NDVIYVH
    CQSGIRSSIAIGILEHKGYHNIINVNEGYKDIQLS

    >gi|57652416|ref|YP_184957.1| hypothetical protein SACOL0047 [Staphylococcus aureus subsp. aureus COL]
    MSQYKTKHINDFTKKELQELSSKGQLIDVRHPEEFELGHIKNALLHSVENIETFKQSKNKTYYIYCKSGNRSRKASQFLA
    QRGYDVVNLDGGYTAYEQQHHNDNLSKVKEDREIKDNRKTFNYSNLQCPGPIVNISKEIKNIAIGDQIEVVVTDHGFLND
    IKSWVKQTGHTLVRLNDFGNEIRAIIQKEENKNIEVTHTKSGTTIVLFSGELDKAVAAMIIANGAKAAGRDVTIFCTFWG
    LNALKKIQSQRIKKKGIAKLFDFMLPNSPINMPISKMNMFGLGNLMMRYVMKKKNVDTLPSLIDQAVEQGVKLIACTMSM
    DVMGITKEELRDDVEYGGVGAYIGYTEQANHNLFI

    >gi|57652427|ref|YP_184968.1| hypothetical protein SACOL0063 [Staphylococcus aureus subsp. aureus COL]
    MKQYGEKFIDEFSKAELEKLAKQGQLIDVRTEEEYALGHINGSILHPVDEIESFNKEKNKTYYVICRSGNRSANASKYLA
    KQGYNVINLDGGYKAYEEENDSYDTQEEYKSIEIKADRKQFNYRGLQCPGPIVKISQEMKNIEVGDQIEVKVTDPGFPSD
    IKSWVKQTRHTLVKLDENNNGINAIIQKEKAKDLDINYSAKGTTIVLFSGELDKAVAALIIANGARAAGKDVTIFFTFWG
    LNALKKVQTVNVKKQGIAKMFDLMLPKKNIRMPLSKMNMFGLGNMMMRYVMKKKNVDSLPTLINQAIEQNIKLIACTMSM
    DVMGIQKEELRDEVEYGGVGTYIGATENANHNLFI

    >gi|57652428|ref|YP_184969.1| metallo-beta-lactamase family protein [Staphylococcus aureus subsp. aureus COL]
    MFFKQFYDNHLSQASYLVGCQRTGEAIIIDPVRDLSKYIEVADSEGLTITQATETHIHADFASGIRDVAKRLNANIYVSG
    EGEDALGYKNMPSKTQFVKHGDIIQVGNVKLEVLHTPGHTPESISFLLTDLGGGSSVPMGLFSGDFIFVGDIGRPDLLEK
    SVQIKGSTEISAKQMYESVQNIKNLPDYVQIWPGHGAGSPCGKALGAIPISTIGYEKINNWAFNEIDETKFIESLTSNQP
    APPHHFAQMKQVNQFGMNLYQSYDVYPSLDNKRVAFDLRSKEAFHGGHTKGTINIPYNKNFINQIGWYLDFEKDIDLIGD
    KSTVEKAKHTLQLIGFDKVAGYRLPKSGISTQSVHSADMTGKEEHVLDVRNDEEWNNGHLDQAVNIPHGKLLNENIPFNK
    EDKIYVH
    CQSGVRSSIAVGILESKGFENVVNIREGYQDFPESLK

    >gi|57652638|ref|YP_185341.1| alkyl hydroperoxide reductase subunit F [Staphylococcus aureus subsp. aureus COL]
    MLNADLKQQLKQLLELMEGNVEFVASLGSDDKSKELKDLLTEITDMSPRLSLSEKSLKRTPSFSVNRPGEETGVTFAGIP
    LGHEFNSLVLAILQVSGRAPKEKQSIIDQIKKLEGSFHFETFISLT
    CQKCPDVVQALNLMSVINPNITHSMIDGAVFREE
    SENIMAVPAVFLNGEEFGNGRMTIQDILSKLGSTADASEFENKEPYDVLIVGGGPASGSAAIYTARKGLRTGIVADRIGG
    QVNDTAGIENFITVKETTGSEFSSNLAAHIDQYDIDAMTGIRATDIEKTDEAIKVTLENGAVLESKTVIIATGAGWRKLN
    IPGEEQLINKGVAF
    CPHCDGPLFENKDVAVIGGGNSGVEAAIDLAGIVNHVTLFEFASELKADNVLQDRLRSLSNVDIKT
    NAKTTEVVGEDHVTGIRYEDMNTGEEHLLNLDGIFVQIGLLPNTSWLNDAVELNERGEIVIDRNNNTNVPGIFAAGDVTD
    QKNKQIIISMGAGANAALNAFDYIIRN

    >gi|57652639|ref|YP_185342.1| alkyl hydroperoxide reductase subunit C [Staphylococcus aureus subsp. aureus COL]
    MSLINKEILPFTAQAFDPKKDQFKEVTQEDLKGSWSVVCFYPADFSFVCPTELEDLQNQYEELQKLGVNVFSVSTDTHFV
    HKAWHDHSDAISKITYTMIGDPSQTITRNFDVLDEATGLAQRGTFIIDPDGVVQASEINADGIGRDASTLAHKIKAAQYV
    RKNPGEVCPAKWEEGAKTLQPGLDLVGKI

    >gi|57650051|ref|YP_185525.1| pyridine nucleotide-disulfide oxidoreductase [Staphylococcus aureus subsp. aureus COL]
    MKTYDLIVIGFGKAGKTLAKYAASTGQHVAVIEQSPKMYGGTCINIGCIPSKTLVHDGLEGKSFEASYNRKNDVVNALNN
    KNYHLLADDNNIDVLDFKAQFKSNTEVNLLDQHDDIVDSITAPHIIINTGATSVIPNIKGLDQAKHVFDSTGLLNISYQP
    KHLVIVGGGYIALEFASMFANLGSKVTVLERGESFMPREDQDVVAYGITDLENKGIALHTNVETTELSSDNHHTTVHTNV
    DNFEADAVLLAIGRKPNTDLALENTDIELGDRGEIKVNAHLQTTVPHIYAAGDVKGGLQFTYISLDDYRIIKSALYGNQS
    RTTDNRGSVPYTVFIDPPLSRVGLTSKEAAAQHYDYTEHQLLVSAIPRHKINNDPRGLFKVVINNENNMILGATLYGKQS
    EELINIIKLAIDQNIPYTVLRDNIYTHPTMAESFNDLFNF

    >gi|57650105|ref|YP_185703.1| thioredoxin-disulfide reductase [Staphylococcus aureus subsp. aureus COL]
    MTEIDFDIAIIGAGPAGMTAAVYASRANLKTVMIERGIPGGQMANTEEVENFPGFEMITGPDLSTKMFEHAKKFGAVYQY
    GDIKSVEDKGEYKVINFGNKELTAKAVIIATGAEYKKIGVPGEQELGGRGVSY
    CAVCDGAFFKNKRLFVIGGGDSAVEEG
    TFLTKFADKVTIVHRRDELRAQRILQDRAFKNDKIDFIWSHTLKSINEKDGKVGSVTLTSTKDGSEETHEADGVFIYIGM
    KPLTAPFKDLGITNDVGYIVTKDDMTTSVPGIFAAGDVRDKGLRQIVTATGDGSIAAQSAAEYIEHLNDQA

    >gi|57650146|ref|YP_185744.1| OsmC/Ohr family protein [Staphylococcus aureus subsp. aureus COL]
    MAIHYETKATNVGGRKGHVYTDDRALDIDIVPPAQADGKATNPEQLFAAGYASCFNGAFDLILKQNKVRDAHPEVTLTVR
    LEDDSDSESPKLSVSIDATIKNVISQEEAEKYLQMAHEF
    CPYSKATQGNINVDLNVNVVD

    >gi|57650149|ref|YP_185747.1| thioredoxin, putative [Staphylococcus aureus subsp. aureus COL]
    MQSIKSNESFKSVINSDTPVIVKFEAGWCPDCRAMDLWIDPIVEQYNDYQWYTVNRDELEDVVVENEVMGIPSLLVFKNG
    DKIAHLHSANAKSPEQVESFLAETFK

    >gi|57650150|ref|YP_185748.1| hypothetical protein SACOL0876 [Staphylococcus aureus subsp. aureus COL]
    MIKFYQYKNCTTCKKAAKFLDEYGVSYEPIDIVQHTPTINEFKTIIANTGVEINKLFNTHGAKYRELDLKNKLQTLSDDE
    KLELLSSDGMLVKRPLAVMGDKITLGFKEDQYKETWLA

    >gi|57650154|ref|YP_185752.1| hypothetical protein SACOL0881 [Staphylococcus aureus subsp. aureus COL]
    MNNSLDIKDVTTFYEEDKHLIFGYTPTCGTCKVSERMLDIANEILQLPLLKIDLNFYPQFCKDMQIMSTPILLLMNKDKE
    VKRIYAFKSVTDLLENLK

    >gi|57651631|ref|YP_185812.1| hypothetical protein SACOL0943 [Staphylococcus aureus subsp. aureus COL]
    MPTVILTEAAAYEVKDMLKANEMPDGYLKIKVNGGGCTGLTYGMGAEEAPGENDEVLEYFGLKVLVDKKDAPVLNGTTID
    FKQSLMGGGFQIDNPNAIASCGCGSSFRTAKVAGNPENC

    >gi|57651662|ref|YP_185843.1| coenzyme A disulfide reductase [Staphylococcus aureus subsp. aureus COL]
    MPKIVVVGAVAGGATCASQIRRLDKESDIIIFEKDRDMSFANCALPYVIGEVVEDRRYALAYTPEEFYDRKQITVKTYHE
    VIAINDERQTVSVLNRKTNEQFEESYDKLILSPGASANSLGFESDITFTLRNLEDTDAIDQFIKANQVDKVLVVGAGYVS
    LEVLENLYERGLHPTLIHRSDKINKLMDADMNQPILDELDKREIPYRLNEEINAINGNEITFKSGKVEHYDMIIEGVGTH
    PNSKFIESSNIKLDRKGFIPVNDKFETNVPNIYAIGDIATSHYRHVDLPASVPLAWGAHRAASIVAEQIAGNDTIEFKGF
    LGNNIVKFFDYTFASVGVKPNELKQFDYKMVEVTQGAHANYYPGNSPLHLRVYYDTSNRQILRAAAVGKEGADKRIDVLS
    MAMMNQLTVDELTEFEVAYAPPYSHPKDLINMIGYKAK

    >gi|57650190|ref|YP_185870.1| transcriptional regulator Spx [Staphylococcus aureus subsp. aureus COL]
    MVTLFTSPSCTSCRKAKAWLQEHDIPYTERNIFSEHLTIDEIKQILKMTEDGTDEIISTRSKTYQKLNVDIDSLPLQDLY
    SIIQDNPGLLRRPIILDNKRLQVGYNEDEIRRFLPRKVRTFQLQEAQRMVD

    >gi|57651693|ref|YP_185957.1| hypothetical protein SACOL1093 [Staphylococcus aureus subsp. aureus COL]
    MSEIIVYTQNDCPPCTFVKNYLNEHHIDFEERNINNQQYRNEMIDFDAFSTPFILLNGNPMYHVDLDEINKVLNIQD

    >gi|57651705|ref|YP_185969.1| dihydrolipoamide dehydrogenase [Staphylococcus aureus subsp. aureus COL]
    MVVGDFPIETDTIVIGAGPGGYVAAIRAAQLGQKVTIVEKGNLGGVCLNVGCIPSKALLHASHRFVEAQHSENLGVIAES
    VSLNFQKVQEFKSSVVNKLTGGVEGLLKGNKVNIVKGEAYFVDNNSLRVMDEKSAQTYNFKNAIIATGSRPIEIPNFKFG
    KRVIDSTGALNLQEVPGKLVVVGGGYIGSELGTAFANFGSEVTILEGAKDILGGFEKQMTQPVKKGMKEKGVEIVTEAMA
    KSAEETDNGVKVTYEAKGEEKTIEADYVLVTVGRRPNTDELGLEELGVKFADRGLLEVDKQSRTSISNIYAIGDIVPGLP
    LAHKASYEAKVAAEAIDGQAAEVDYIGMPAVCFTEPELATVGYSEAQAKEEGLAIKASKFPYAANGRALSLDDTNGFVKL
    ITLKEDDTLIGAQVVGTGASDIISELGLAIEAGMNAEDIALTIHAHPTLGEMTMEAAEKAIGYPIHTM

    >gi|57651754|ref|YP_186018.1| thioredoxin [Staphylococcus aureus subsp. aureus COL]
    MAIVKVTDADFDSKVESGVQLVDFWATWCGPCKMIAPVLEELAADYEGKADILKLDVDENPSTAAKYEVMSIPTLIVFKD
    GQPVDKVVGFQPKENLAEVLDKHL

    >gi|57651874|ref|YP_186180.1| glutathione peroxidase [Staphylococcus aureus subsp. aureus COL]
    METIYDFVVETNKGVTYKLDAYKGDVMLIVNTASECGFTSQFEGLQSLYEKYKDQGFVILGFPCNQFGGQEPGSGEEAAQ
    NCKLNYGVTFPMHQKIDVKGEHQLPLFRYLTAAQHGFFNEKIKWNFTKFLVDREGNVVKRFAPQKKPVQIEREIEKLL

    >gi|57650365|ref|YP_186249.1| methionine sulfoxide reductase A [Staphylococcus aureus subsp. aureus COL]
    MNINTAYFAGGCFWCMTKPFDTFDGIEKVTSGYMGGHIENPTYEQVKSGTSGHLETVEIQYDVALFSYNKLLEIFFSVID
    PLDTGGQYQDRGPQYQTAIFYTNDHQKELAETYIEQLKNTINADKAIATKILPASQFYKAEDYHQDFYKKNPERYAEEQK
    IRQEYKNKQ

    >gi|57650475|ref|YP_186404.1| dihydrolipoamide dehydrogenase [Staphylococcus aureus subsp. aureus COL]
    MSEKQYDLVVLGGGTAGYVAAIRASQLGKKVAIVERQLLGGTCLHKGCIPTKSLLKSAEVFQTVKQAAMFGVDVKDANVN
    FENMLARKEDIINQMYQGVKHLMQHNHIDIYNGTGRILGTSIFSPQSGTISVEYEDGESDLLPNQFVLIATGSSPAELPF
    LSFDHDKILSSDDILSLKTLPSSIGIIGGGVIGMEFASLMIDLGVDVTVIEAGERILPTESKQASQLLKKSLSARGVKFY
    EGIKLSENDINVNEDGVTFEISSDIIKVDKVLLSIGRKPNTSDIGLNNTKIKLSTSGHILTNEFQQTEDKHIYAAGDCIG
    KLQLAHVGSKEGVVAVDHMFEGNPIPVNYNMMPKCIYSQPEIASIGLNIEQAKAEGMKVKSFKVPFKAIGKAVIDSHDTN
    EGYSEMVIDQSTEEIVGINMIGPHVTELINEASLLQFMNGSALELGLTTHAHPSISEVLMELGLKAESRAIHV

    >gi|57651928|ref|YP_186432.1| rhodanese-like domain-containing protein [Staphylococcus aureus subsp. aureus COL]
    MSASLYIAIILVIAIIAYMIVQQILNKRAVKELDQNEFHNGIRKAQVIDVREKVDYDYGHINGSRNIPMTMFRQRFQGLR
    KDQPVYL
    CDANGIASYRAARILKKNGYTDIYMLKGGYKKWTGKIKSKK

    >gi|57652011|ref|YP_186596.1| thiol peroxidase, putative [Staphylococcus aureus subsp. aureus COL]
    MTEITFKGGPIHLKGQQINEGDFAPDFTVLDNDLNQVTLADYAGKKKLISVVPSIDTGVCDQQTRKFNSDASKEEGIVLT
    ISADLPFAQKRWCASAGLDNVITLSDHRDLSFGENYGVVMEELRLLARAVFVLDADNKVVYKEIVSEGTDFPDFDAALAA
    YKNI

    >gi|57652020|ref|YP_186605.1| OsmC/Ohr family protein [Staphylococcus aureus subsp. aureus COL]
    MHQHDFKVQTSWQGGRNNVGNVQGDILSENISIPASLGGVGIGTNPDEMLVSAASSCYIISLAATLERAKFTDISIEQQS
    IGTACLNNGKFSMSKIVHHPQIQIPSDQIAQLEKRLPKLITIADNN
    CMISNAVRNNVDIKIYPIIQAK

    >gi|57652042|ref|YP_186627.1| thioredoxin, putative [Staphylococcus aureus subsp. aureus COL]
    MKQLESEQQFESLKQGATVFEFTAGWCPDCRVIEPDLPELEARYPMFDFVSVDRDKFMDICIENGIMGIPSFLVYKNGEL
    LGSYIGKERKSIEQIDAFLAQYV

    >gi|57652055|ref|YP_186640.1| rhodanese-like domain-containing protein [Staphylococcus aureus subsp. aureus COL]
    MKSITTDELKNKLLESKPVQIVDVRTDEETAMGYIPNAKLIPMDTIPDNLNSFNKNEIYYIVCAGGVRSAKVVEYLEANG
    IDAVNVEGGMHAWGDEGLEIKSI

    >gi|57650653|ref|YP_186746.1| bacterioferritin comigratory protein [Staphylococcus aureus subsp. aureus COL]
    MLQKGEQFPIFKLENQDGTVITNDTLKGKKAIIYFYPRDNTPTCTTEACDFRDNLEMFNDLDVAVYGISGDSKKKHQNFI
    EKHGLNFDLLVDEDFKLAKETGVYQLKKSFGKESMGIVRTTFIIDEQGKVLDVIEKVKVKTQIEELKNILG

    >gi|57650717|ref|YP_186851.1| hypothetical protein SACOL2034 [Staphylococcus aureus subsp. aureus COL]
    MWMIFSGLIVGGLLGFVMQRTRFCLTGGFRDMYVQKNNKMFYALLIAITIQSIGLLILTATDILQIPAHSFPILGTIIGS
    FIFGIGIVLAGG
    CATGTWYRAGEGLIGSWIALVLYAVTAAITKTGILKPVMDKINQPTNVNSDMSQTTGIPFWGLVVILT
    IITIFLVVRTLNNKKVRVAVPKLKQRYTGIRYYLFEKRYHPFIAAIVIGLIALLAWPMSASTGRNDGLGITTPSANLVHF
    LITGETKFIDWGVFLVLGIFIGSYIAARGSREFKWRLPDKITIRNSAIGGICMGFGASVAGG
    CSIGNGLVETATMTWQGW
    IALASMIVGVWTMSHFIFVRPMKKVHQQSAKVKQQTQIV

    >gi|57652209|ref|YP_187076.1| molybdopterin biosynthesis MoeB protein, putative [Staphylococcus aureus subsp. aureus COL]
    MSQERYSRQILFKQIGEIGQSKINQKCALIIGMGALGTHVAEGLVRAGIAKLIIVDRDYIEFSNLQRQTLFTEEDALKMM
    PKVVAAKKHLLALRSDVDIDDYIAHVDYYFLETHGQDVDVIIDATDNFETRQLINDFAYKYRIPWIYGGVVQSTYTEAAF
    IPGKTPCFNCLVPQLPALNLT
    CDTVGVIQPAVTMATSLQLRDAMKVLTEQPIDTKITYGDIWEGSHYSFGFSKMQRSDCT
    TCGDVPSYPYLNKNEQRYATLCGRDTVQYENASITHDILVQFLKQHQLNYRSNSYMVMFEFKGHRIVAFKGGRFLIHGMT
    RTSDATHLMNLLFG

    >gi|57650916|ref|YP_187174.1| pyridine nucleotide-disulfide oxidoreductase [Staphylococcus aureus subsp. aureus COL]
    MKDVTIIGGGPSGLYASFYAGLRDMSVRLIDVQSELGGKMRIYPEKIIWDIGGIAPKPCHEILKDTIKQGLYFKPEVHLN
    ERVVDIRKKAERHFEVETEAGEIYTSKAVIIAIGAGIINPKQLDVKGVERYQLTNLHYVVQSYRRFKDKDVLISGGGNTA
    LDWAHDIAKIAKSVTVVYRKEDVSGHEAMKTLVTDLNVKLCPKTRIKYLVGNDDETHISEVVLEHVESGDRHTVKFDDVI
    ISHGFDRCNTLLSETSSKLDMHDDCRVKGFGNTTTSIPGIYACGDIVYHDAKSHLIASAFSDGANAANLAKTYIQPDANA
    EGYVSSHHEVFKEANKTIVNKHLY

    >gi|57650952|ref|YP_187210.1| putative lipoprotein [Staphylococcus aureus subsp. aureus COL]
    MTKKLLTLFIVSMLILTACGKKESATTSSKNGKPLVVVYGDYKCPYCKELDEKVMPKLRKNYIDNHKVEYQFVNLAFLGK
    DSIVGSRASHAVLMYAPKSFLDFQKQLFAAQQDENKEWLTKELLDKHIKQLHLDKETENKIIKDYKTKDSKSWKAAEKDK
    KIAKDNHIKTTPTAFINGEKVEDPYDYESYEKLLKDKIK

    >gi|57650984|ref|YP_187280.1| alkylhydroperoxidase [Staphylococcus aureus subsp. aureus COL]
    MPYNYKKQNGELMSVMSQGEKFIHQSPVNDELSALIKLLISKINGCHYCVDIHKKELKELGVTQMKIDEVLSFRHLDLFT
    DQEKVTLEFAEMLNSIKDFKKFEIIDRLKSFYDEEQIIDLVFVVNQINGWNRLNIISDRL

    >gi|57651046|ref|YP_187342.1| hypothetical protein SACOL2550 [Staphylococcus aureus subsp. aureus COL]
    MVKQLNSVEAFREFIHQYPLAVVHVMRDQCSVCHAVLPQIEDLMQSYPNVPLAVINQSQVEAIAGELNIFTVPVDLIFMN
    GKEMHRQGRFIDMQRFEHHLKQMNDSVNNDVDEH

    >gi|57651058|ref|YP_187354.1| methylated-DNA--protein-cysteine methyltransferase [Staphylococcus aureus subsp. aureus COL]
    MEYKSYYDSPVGRLELLSDGVSLTAVLFENQQGDGTREENTSLAIFREATQWLDAYFKGDNPEITIPLKPTGSHFQQCVW
    NELRQVPYGTLTTYGAIAKKVGKLLNKPKMSAQAVGGAVGSNPLSIIVP
    CHRVVGKTGSLTGFGGTINNKIKLLELENID
    MSKLYVPKHSTKP

    >gi|57652294|ref|YP_187364.1| copper-translocating P-type ATPase [Staphylococcus aureus subsp. aureus COL]
    MANTKKTTLDITGMTCAACSNRIEKKLNKLDDVNAQVNLTTEKATVEYNPDQHDVQEFINTIQHLGYGVAVETVELDITG
    MT
    CAACSSRIEKVLNKMDGVQNATVNLTTEQAKVDYYPEETDADKLVTRIQKLGYDASIKDNNKDQTSRKAEALQHKLIK
    LIISAVLSLPLLMLMFVHLFNMHIPALFTNPWFQFILATPVQFIIGWQFYVGAYKNLRNGGANMDVLVAVGTSAAYFYSI
    YEMVRWLNGSTTQPHLYFETSAVLITLILFGKYLEARAKSQTTNALGELLSLQAKEARILKDGNEVMIPLNEVHVGDTLI
    VKPGEKIPVDGKIIKGMTAIDESMLTGESIPVEKNVDDTVIGSTMNKNGTITMTATKVGGDTALANIIKVVEEAQSSKAP
    IQRLADIISGYFVPIVVGIALLTFIVWITLVTPGTFEPALVASISVLVIACPCALGLATPTSIMVGTGRAAENGILFKGG
    EFVERTHQIDTIVLDKTGTITNGRPVVTDYHGDNQTLQLLATAEKDSEHPLAEAIVNYAKEKQLILTETTTFKAVPGHGI
    EATIDHHHILVGNRKLMADNDISLPKHISDDLTHYERDGKTAMLIAVNYSLTGIIAVADTVKDHAKDAIKQLHDMGIEVA
    MLTGDNKNTAQAIAKQVGIDTVIADILPEEKAAQIAKLQQQGKKVAMVGDGVNDAPALVKADIGIAIGTGTEVAIEAADI
    TILGGDLMLIPKAIYASKATIRNIRQNLFWAFGYNIAGIPIAALGLLAPWVAGAAMALSSVSVVTNALRLKKMRLEPRRK
    DA

    >gi|57652295|ref|YP_187365.1| copper ion binding protein [Staphylococcus aureus subsp. aureus COL]
    MSQEILNVEGMSCGHCKSAVESALNNIDGVTSADVNLENGQVSVQYDDSKVAVSQMKDAIEDQGYDVV

    >gi|57652359|ref|YP_187429.1| glutathione peroxidase [Staphylococcus aureus subsp. aureus COL]
    MNNRNVYDIEVSDYKGLTYKLEAFRGKVILVVNTATECIYSEQLKKLETLFQKYKDRGFVVLSFPNNNFDNRQPGSNEEI
    LKISREKFGVTFPVLAKISVNGNDEHPLFTHLKNEQPGIFGSPIKWNFTKFIIDRQGNVVNRFLPMEDPLDISTNIEILL
    QESSS

    >gi|57652400|ref|YP_187470.1| methionine sulfoxide reductase A [Staphylococcus aureus subsp. aureus COL]
    MAVVYVAGGCLWGVEAFFATIPGIIHTEAGRANGRSSKLDGPYDGYAECVKLHFDDRMLTITDIMNYLFEIIDPYSVNQQ
    GNDIGQKYRTGLYSCVDDHLIEARQFIERRKDRDQIAVEVLPLSNYIKSAEEHQQHLEKYPEDMHMCHISKDLLNKYK

    >gi|57651081|ref|YP_187499.1| hypothetical protein SACOL2713 [Staphylococcus aureus subsp. aureus COL]
    MNYQVLLYYKYMTIDDPEQFAQDHLAFCKAHHLKGRILVSTEGINGTLSGTKEETEQYMAHMHADERFKDMVFKIDEAEG
    HAFKKMHVRPRKEIVALDLEDDVDPRHTTGQYLSPVEFRKALEDDDTVIIDARNDYEFDLGHFRGAIRPNITRFRDLPDW
    IKENKALFADKKVVTY
    CTGGIRCEKFSGWLLKEGFEDVAQLHGGIATYGKDPETKSEYWDGKMYVFDDRISVDINQVEKT
    IIGKDWFDGKPCERYINCANPECNKQILVSEENETKYLGACSYECAKHERNRYVQANNISDNEWQQRLTNFDDLHQHA