Stackebrandtia nassauensis DSM 44728 uid46663

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|291298306|ref|YP_003509584.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Stackebrandtia nassauensis DSM 44728]
    MPSIVIIGGGPAGYEAALVAAQLDADVTLIEETGAGGACVLSDCVPSKTFIASSTARTSIDRAERLGVSAKDVTVDAQLV
    HDRVKMLALQQSGDICNKLVKSGVEYITGRARLTGVTEGFNHKVEILPVDGEAYEVDATVVLLATGATPRVLRDARPDGE
    RVLSWRQVYDLEELPEKLIVVGSGVTGAEFASAYLAMGVDVTLVSSREHVLPHEDTDAAMAIESVFRERGMTIVPNARAL
    KVCAEGDGVVAELADGQRLTGTHALMTVGSVPNTAGLGLAAAGVTCNDWGFVETDRVSRTNVPGVYAAGDVTGVQMLASV
    AAMQGRIAMWHALGETVKPLQLQTVAANVFTDPELATVGATQADVDSGKVPARSVTLPLEGNPRAKMSGFADGFVKLFCR
    PASGLVVGGVVVAPKASELILPISLAIQNHLTVEELARTVTIYPSMSGSLAEAARQLMQHEFE

    >gi|291298354|ref|YP_003509632.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stackebrandtia nassauensis DSM 44728]
    MRTRLLLAGLALTMLAGCAGNQAQATTEDGKTIVYTDESERPKAPTLSGEVLDGEKFEAPDAEVTVVNFWASWCAPCRRE
    GPELVEAYDKTKDDGVAFVGINIRDDRDKGIAFEKGLGVDYPSIFDPSGRLALKYKDVPPNTIPATIVIDDKNRIAAVFR
    QELTADTLLDAIEDVRGDK

    >gi|291298481|ref|YP_003509759.1| peptide methionine sulfoxide reductase [Stackebrandtia nassauensis DSM 44728]
    MSSPTVLPWLALFTVWIFWGSTYLGIQFAVETIPPLLMAGFRYLLAGAVMFAIVGPRHARGPNRPTPRQWRSMVIVAVLL
    LVGGNGLLSVGETSIDSGLAALIVATVPVWMLLIDAAVNRSRITVTMAIALALGTAGVGVLVGGPGSRVDLFGAIVVLIG
    ALSWASGTVYARRAPQPKHPLVVASLQMIAGGVVLILVAAVTGEFGRLELAAISARSIAGFGWLVVAGSMLAFTAYGYAN
    ANLPTSTVATYAYVNPVVAVVLGVLLGDESLSANLLLGGGIIVSAVVLIVGGQAAKRREKPRPREVHRQALRWYRRHPEA
    QRSRRHMFATRHTTKLPADEALPGRPGPLLDPSDRNAALGTPLLGPYPDGMEIAEFGVD
    CFWGGEAQFWDVPGVWTTVAG
    FQGGHTPNPLADEILSHRTGHTEAVRVVFDPAKTSYEKLLAVFWCSEDPTRRVDMRGHGRSAIFTQDAGQLAKAEASRKV
    YQRELDRRGYGAIITEILSAQEFPFYPAQLRHQQHLARH

    >gi|291298555|ref|YP_003509833.1| Thiosulfate sulfurtransferase [Stackebrandtia nassauensis DSM 44728]
    MSRAETLVSADWAEQNLNTDKTVFVEVDEDTTAYDNSHIPGAVKLDWKTDLQDQVRRDFVDRQQFSDLLSQRGIANDDTV
    ILYGGNNNWFAAYAYWYFKLYGHDSVKLLDGGRKKWELDARPLSSDPVNRPATSYVAAEQDRSIRALRDDVLGALGSSNL
    VDVRSPDEYAGRLLAPAHLPQEQSQRAGHIPTALSVPWSKAANEDGTFKSDKELSELYSEAGVDSSKPTIAY
    CRIGERSS
    HTWFVLRELLGHNDVRNYDGSWTEYGSLVGVPIALGDEPGKAL

    >gi|291298595|ref|YP_003509873.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stackebrandtia nassauensis DSM 44728]
    MRLRTLLLGFTVAALTASCSSGGQTADASQDVDWDVPCDESDIGTAAEDFKDFTLECLSNGKDHALGVLDERPTVITLWA
    TW
    CGPCRKEAPEFRKFHEEYGDQVNLIGVDTQDDRSSGLAFAADAGWRFPSVSDPKGSVMRARGITALPATFLIDEKGTT
    VATYNDPGLTFEKLEKAALKHFEVERS

    >gi|291298858|ref|YP_003510136.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Stackebrandtia nassauensis DSM 44728]
    MVKQVDVIVIGMGVGGEAVAESLAGEGLSVVGIEGRLVGGECPYWGCIPSKMMIRAADLIAETRRVDGIAGTATVTPDWS
    PVAIRIRDEATTNWDDAIAVKRFTDAGGEFVRGWAKLTGPGQVEVDGQAFEADKGVVIGTGTTPVIPPIDGLADTPYWTN
    RDAVETTTVPDSMIVLGGGAIGLELAQAFSRFGANVTVVEAADRLLPPEEPESSALARQALEADGITVHTGSRAERVEHD
    GHTFTVATADGKSLTAEKLLVAVGRRVDLSTLGVDTLGLDPKARNLTVDEFMRAGEKLWAVGDVTGHGAFTHVATYQADI
    AVADILGRSTPGADYRALPRVTFTDPEIGAVGLTESQAREQGLEVATASAQIPSTARGWIHKAGNEGFIKLVVDTEREVL
    VGATSAGPNGGEVLGALTVAVHGEVPIGRLKHMIYAYPTFHRGIQDALRELP

    >gi|291299016|ref|YP_003510294.1| peptide methionine sulfoxide reductase [Stackebrandtia nassauensis DSM 44728]
    MSDNVHTVLNTAIDGPVPAGHEVAVFGMGCFWGAERLFWRLDGVYTTSVGYSGGSDSPPSYEMVCTGTTGHAEVVQVVYD
    PAKVSYETLLKTFWENHDPTQGNRQGNDIGTQYRSVIYTTSEQQLKTAEESREAFQPVVTAAGLGPITTEIQPLPNYFLA
    EDYHQQYLDKNPNGYCNHGPNGMSCPIGVAR

    >gi|291299052|ref|YP_003510330.1| methylated-DNA/protein-cysteinemethyltransferase [Stackebrandtia nassauensis DSM 44728]
    MTTPDKDPLLDGLATLGVDAPDTLLDRFAARWTSLATPIGELRAAFTDHGIAFVRQATDDFGEQFRQRFARPLLPALSVP
    DGLEAALVTGDARGISVDLRELGEFQESVLLAARTIPPGQVRPYAWIAAEIGRPKAVRAVGTALAKNPVPLVIP
    CHRVVR
    TDGGVGQYIFGAEAKQRLLRFEHADI

    >gi|291299082|ref|YP_003510360.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stackebrandtia nassauensis DSM 44728]
    MTTRLAPGDTAPAFDLPTHDGGRLSLDSLKGHKVILYAYPAAMTPGCTKQACDFRDSLASLQAAGYRVVGISPDKPAKLA
    KFVERDALTFPLVSDGDKEVLNAYGAYGEKKNYGRVYEGVIRSTFVIDADGKIEVAQYNVRATGHVAKLRRDLGLD

    >gi|291299180|ref|YP_003510458.1| transcriptional regulator, HxlR family [Stackebrandtia nassauensis DSM 44728]
    MPRRTRLSDGDCAIAQSLDVVGEWWTLLVVRDVARGRHRFEELRAELGISRKVLTERLATLVDNGVLRRDRYSEHPPRHE
    YRLTELGHGLLPVLAALQDFGDRWLLGDGSLTATAEPGSAEAARMHALKGTAVPEVDGIDPIAATGLTVLYFYPATGLPH
    AASIPGGPG
    CTVESCTYRDRLDAFTALGATVHGVSTQRPEEQAAFARTNRIQFPLFSDAELRLATALRLPTFRAAGVRRI
    KRLTLIVDADRRIREVLYPIPDAGGSVADALAACRELVGT

    >gi|291299204|ref|YP_003510482.1| Rhodanese domain-containing protein [Stackebrandtia nassauensis DSM 44728]
    MTPDAAPPGSQSIDDILAAARARLHRLDPAETHAAVRDGAVLVDIRPAAQRAANGEIPDAVIVERNVLEWRFDPRSDARL
    RVAGRYDLRVIVF
    CQEGYTSSLAAASLHDLGLHRATDLDGGFAAWRAAGLPTSDGPSAAVG

    >gi|291299236|ref|YP_003510514.1| Methyltransferase type 11 [Stackebrandtia nassauensis DSM 44728]
    MTTIDNTSCCGPTAIPEPTDPVALRERVRESYAAAARKVNEGGGGCCGPATTDDLDFFGPEAYAAADRDSLPDAAVAASL
    GCGNPVAVADLAEGETVLDLGSGGGIDVLLSAKRVGPTGRAYGLDMTDDMLELARANASKAGATNVEFLRGEIEEVPLPD
    ASVDVIISNCVINLSTDKPAVFAEMTRVLRPGGRIGLSDVVAADTLSPSDRAARGGHVG
    CIAGALSFEEYREQLAAAGFG
    QISITPTHEVTDGMHSAIVRAHKPS

    >gi|291299297|ref|YP_003510575.1| glutaredoxin-like protein [Stackebrandtia nassauensis DSM 44728]
    MVTMYSTQWCTYCRRLKSQMDREGIEYEVVDIEDDPKAADYVMSVNGGNQTVPTVTFPDGSAMTNPTIVQVREKLAAVAD
    TAA

    >gi|291299436|ref|YP_003510714.1| Thioredoxin domain-containing protein [Stackebrandtia nassauensis DSM 44728]
    MNTPEPSQAPQRLLAGAVDLSSLAAPRPAPPRPTDGEAPAAANGAAVIDVTEATFQAEVLERSLSVPVVIDFWADWCQPC
    KQLSPVLEKLAVESGGAWTLAKIDVDANPQLQAAFQVQSIPMVIAMWQGRPVDGFQGVQPETTLRQWIGRLIEATGGEAP
    EVPADPQLVAAESALDAGDLTGAENAFTSYLDLHPGDAAAESGLAQVRLLRRVEAAGPAAQEAAVTNPTDIPQALLASDI
    QVINGQAENAYRQLIDLIARLNGEDRDTVRKHLLDLFTIAGPEDPVVAQARRKLAAVLF

    >gi|291299468|ref|YP_003510746.1| alkylhydroperoxidase AhpD family [Stackebrandtia nassauensis DSM 44728]
    MGIDTLKQELPEYARDTKLNLGSVTTTSSLTPQQLWGTLVATAVASRNARVLREITEEAAKNISEEALRAAKAAASIMAM
    NNVYYRAKHLVGDEAYQTIPARLRMQIIASPGVAKLDFELWSLAVSAVTGCGV
    CLESHEKTLTGSGASRDNVNDALRIAG
    VVHAVAVTLDAEAALA

    >gi|291299469|ref|YP_003510747.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stackebrandtia nassauensis DSM 44728]
    MLTVGEKFPEYELTACVSLEPENAFDTINHKTYEGQWRVLFSWPKDFTFVCPTEIAEFGRLTGEFADRDAQVLGWSVDSE
    FVHYAWRKDHPDLRELPFPMLSDIRRELTEAAGVLGEDGVAQRATFIVDPDNVIQFVMVTAGSVGRNVAEVLRVLDALQT
    DELCPCNWNKGGDTLDATKLLAA

    >gi|291299790|ref|YP_003511068.1| uncharacterized peroxidase-related enzyme [Stackebrandtia nassauensis DSM 44728]
    MSNVPLVELESASGAVKEQLDQIQAAFGTVPAMFKAVANSPAALASMWGSFGAFADGALGSALSEQIAVAVANRNSCEYC
    LAAHTALGRKAGVTRAALAAAQDGESDDPRVAALLGFAVKLVRERGQVTPDDVQALRGHGWGDEQIVEVIAQVALNLFTN
    YVNIALAVPVDFPTVELRRVD

    >gi|291299845|ref|YP_003511123.1| hypothetical protein Snas_2344 [Stackebrandtia nassauensis DSM 44728]
    MTDDKVTANFWFDPVCPWAWMTSRWMLEVEKQRDVQVRWNIMSLQVLNEPKVDELPERYAEAIRDGGWWEPVRIVAAAER
    EFGNEVVGKLYTALGTRFHNRGLDRGEEVYADAVAEAGLPATLVEARKSTEFDDDIRASHKRGIDLVGQEVGTPVIAVPG
    ADGELVAFFGPVVTPAPKGEAAAKLWDGTLLVASTPGFFELKRTRTQDPIFD

    >gi|291300053|ref|YP_003511331.1| Peroxiredoxin [Stackebrandtia nassauensis DSM 44728]
    MSIYDIPLNTLDGKPATLADYSGKALLVVNVASRCGLTPQYDGLEKLHEQLSGKGFAVLGFPCNQFGGQEPGTADEIAEF
    CSTTYGVTFPMFAKIDVNGPDRHPVYEELTRTPDADGEAGDVQWNFEKFLLGTDGKPVARFRPQTTPDDPQLLAAIEAQL
    PS

    >gi|291300139|ref|YP_003511417.1| thioredoxin [Stackebrandtia nassauensis DSM 44728]
    MATIELTEETFNSTIEADGIVLVDYWAEWCGPCKRFGPVFEAASDKHEDVVFAKVDTEAEQGIAQAANITSIPTLMAFRD
    GILVFAQPGALPATALDEIIGKVRDLDMDEVRAQIAAEDN

    >gi|291300161|ref|YP_003511439.1| methylated-DNA/protein-cysteinemethyltransferase [Stackebrandtia nassauensis DSM 44728]
    MASVNVNTPIGPLWFAASEVGLRRVSFGEGEVVAGSVGARELLGVVRGQLEEYFGGGRRVFEVPLDWGLSEGWALEVRRV
    LWEKVGYGDTVSYGELAALAGRPDGARAVGGIMAGNPIPVVVP
    CHRVIAADGGIGGFAGSGGTQVETKRRLLTMEGAMPP
    TLFDL

    >gi|291300186|ref|YP_003511464.1| OsmC family protein [Stackebrandtia nassauensis DSM 44728]
    MGTVRVERTDAGYVARNGRGGEISIGDSTSGADFTPVELLLAAVGGCNIVSVEPLTAKRGHRLVRLAMTVEGEKVATNLL
    GPVTVTYDVELPEGDDKAEEVFKAVAQRVHERACTVSRTLSEGTPVTVTT

    >gi|291300229|ref|YP_003511507.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Stackebrandtia nassauensis DSM 44728]
    MGRRIVVVGASAAGLTAADTLRREGHDGPIIVVGDETCPPYDRPPLSKQILAGTWQPEKITLRDEAALRRSEITLRLGTT
    ATGLDTGARTVKLRDGETLGYDGLIIATGVAPRRLPIGVGMAGVHVMRTLDDALRLRDAITESTRLVVIGAGFLGAEVAA
    SARTRGADVTVVDPLPVPMLRQFGERIGQRVAQMHRAHGVGLRLNTAVTGLRGDDAVTGVELDDGSVLDADVVLIAVGST
    PNTGWLADSGLHVDDGVVCDSMCQASPDVYAAGDVARWFNPRFGLSMRVEHRMNATEQGMAAARNLLGQEKAFDPIPYFW
    TDQFDVKIQAYGHFPTDSEVAIVHGDLAEDKFVARYLTDGVITGVLGWNMPKQVRLERACVGDKP

    >gi|291300676|ref|YP_003511954.1| methylated-DNA/protein-cysteinemethyltransferase [Stackebrandtia nassauensis DSM 44728]
    MSRVHTVVDSPLGPLTLVATKGVLSGLFMDCDNRHRPDPSQLGSADAGVFGDVVEQLEAYFRGELRVFDVPLALEGTEFQ
    LRVWRELSRIPFGETVTYADLAALVGRPASAARAVGTANGSNPVSVIVP
    CHRVVGSDGGLTGYAWGVERKRWLLDLESGT
    PALF

    >gi|291300902|ref|YP_003512180.1| Methyltransferase type 11 [Stackebrandtia nassauensis DSM 44728]
    MSHKNIVDKYSSLARSALDGATVSDCEPRAFADGKFGAGGYVTLDDLPEGAARASLGCGDPVAVANLRPGDVVLDLGSGG
    GIDVLLSARRVLPGGSAYGLDASADMVALARRYAAEAGVDNVEFLQGDIENIPLPDGSVDVVISNCVLCLSSDKSATLTE
    AFRVLKPLGRFGISDVVAAGEADPLERERIEERIG
    CSAGTLTTIEYRDMLSAIGFADVAITLTADHGAGVHSAIVQAAKP
    G

    >gi|291301380|ref|YP_003512658.1| methionine-R-sulfoxide reductase [Stackebrandtia nassauensis DSM 44728]
    MDGVTEDPWRAKLTAEEFKVLRQGGTEAPFTGEYTDTETVGVYCCRACGAELFTSDTKYHSGCGWPSFADADPDKVTLLE
    DSSLGMVRTEVRCASCDSHLGHLFKGEGLAPKDLPDQRY
    CINSISLKLRPKTD

    >gi|291301403|ref|YP_003512681.1| arsenate reductase [Stackebrandtia nassauensis DSM 44728]
    MKATVFHNPRCSKSRQALDLVNQSGAEVTVVEYLKDPPSKAELAKLIADAGLAPRDAARRKDALYKELGLDNPDLSDDEV
    IGIMADNPAVIERPFVVTDKGTRLARPTELVNDIL

    >gi|291301516|ref|YP_003512794.1| hypothetical protein Snas_4049 [Stackebrandtia nassauensis DSM 44728]
    MTQAKPVEFWFDPSCPYTWLTSRWLIEAATVRPIEIRWHIMSLAVLNEGREVDPEGDTEGYLWYPVRVCAAVERHRGKTK
    LAAFYTALGNRLHKDQPQWDDNVFTDALTEAGLPVELAKAATSDDLDVDVRASHERGIGLVGDHVGTPVIAATGPSDEPV
    AFFGPVISRIPRGEEAGRLWDLVVPLAGFDGFHELKTTAPKPPDYA

    >gi|291301612|ref|YP_003512890.1| iron-sulfur cluster assembly accessory protein [Stackebrandtia nassauensis DSM 44728]
    MTETQTETDAPTGVALTDEAAAKVKALLEQEGRDDLRLRVAVQPGGCSGLRYQLFFDERSLDGDVVNTYDGFELVVDRMS
    VPYLAGASIDFVDKIDAQGFQIDNPNAGGSCACGDSFH

    >gi|291301664|ref|YP_003512942.1| dihydrolipoamide dehydrogenase [Stackebrandtia nassauensis DSM 44728]
    MSDPNAGYDVVILGSGSAGYACALRAAQLDLSVAIIEKDKLGGTCLHTGCIPTKALLHAGEVADSARHGEEFGVKTEGVS
    IDMAGVNAYKDGVVAKMYKGLQGLIKASKVTVIEGSGKLVGPNTVEVNGERVTGRNIVLATGSYSKSLPGLDVDGTKVIT
    SEHALRLDKVPSSAIVLGGGVIGVEFASAWKSLGADVTIVEALPRLVAAEDADSSKMLERAFRKRGIKFKTGKGFESLKE
    TAGGVSVTIAGGETIDAELLLVAVGRGPSTAGLGYDEQGVSMDRGFVLVNEHLQTNLPGVYAIGDIVPGVQLAHRGFGHG
    IFVAEHIAGLNPRPIDEAGIPKVTYSEPQVASVGYSEEAAKEKFGADVVVSYNYNLGGNGKSNILKTQGFVKLVSVKDGP
    VVGVHMVGANMGEQIGEAQLIYNWEAFPSDVAQLIHMHPTQNEALGEAHLALAGKPLHAHA

    >gi|291301954|ref|YP_003513232.1| OsmC family protein [Stackebrandtia nassauensis DSM 44728]
    MATVRTARTNWEGDLTGGAGVVHFESSGRPDAEVTWAARSQDANGKTSPEELIAAAHSSCFSMALSAGLAKAGTPPQSLD
    TSAEVTFDPAAGGITKIRLTVRGDVPGISAEEFNAAAADAKAN
    CPVSKALGAVQDITVDAALK

    >gi|291302009|ref|YP_003513287.1| CMP/dCMP deaminase zinc-binding protein [Stackebrandtia nassauensis DSM 44728]
    MADEHWLRQAIALAAKCPPSDTAFSVGAVIVADGRVLATGYSRETDPHDHAEEAALSKLDQDLSGATVYSSLEPCGQRAS
    RPVSCAELIIAARVPRVVYAWREPDTFVQPKGLRLLAEARVELVQLSHLAEAAAAPNAHLLLSATMSPMPLMTAGQLREL
    LETQAPTVLDVRWSLAAGADRDGYQAGHLPGAVFLDLDADLCGPPGPGGRHPLPEPDALRAVLRSAGVTRTGPVVVYDGG
    DMLAAARTWWTLRWAGVQDVRVLDGGFAAWQAEGGPVTAETSDVAASDFDVTPGGLPELDSAAAAALARTGTLLDVRTPE
    RYRGETEPIDPVAGHIPAAVNAPAGDTMAPDHGFRAPGELAETYRRFDGEVGVY
    CGSGVTAARTALAMTAAGLDTPAVYI
    GSWSHWVADPARPVALGDE

    >gi|291302051|ref|YP_003513329.1| UBA/THIF-type NAD/FAD binding protein [Stackebrandtia nassauensis DSM 44728]
    MALSPLVEPAAELSREEVGRYSRHLIIPDVAMDGQKRLKNAKVLCVGAGGLGSPALMYLAAAGVGTLGIVEFDVVDESNL
    QRQIIHGQSDVGKPKAESAAASIKEINPYVTVNIHNEALTNDNVMDIFADYDLIVDGTDNFATRYMVNDAAVLLGKPYVW
    GSIFRFDGQASVFWAENGPCYRCLYPEPPPPGMVPS
    CAEGGVLGVLCASIGSIQVTEAIKLLTGIGEPLVGRLMVYDALE
    MSYRTVKVKKDPNCALCGENPTVTGLIDYDDFCGAVTEEAATAVRGSTITAQELKDWQDAGKDIDIIDVREPAEWEIVRI
    PGARLIPKGDIVSGQALSQLPTDKQAVFY
    CKAGVRSAEALAAAKAAGLSNAVHVQGGVIAWINQVDPSLPSY

    >gi|291302226|ref|YP_003513504.1| OsmC family protein [Stackebrandtia nassauensis DSM 44728]
    MTNSGEPNEGLVTVTGTGPGSFVQRIRAGAHELTADEPQPTGTDTGASPYDLLLAALGSCTSMTLQMYADRKKWPLEKVS
    VSLRHDRIHATDCANCETEAGMVSQITRVIRLEGPLDEEQRTRLLQIADRCPVHRTLSGEIDIQTEMDAAKPH

    >gi|291302230|ref|YP_003513508.1| Rhodanese domain-containing protein [Stackebrandtia nassauensis DSM 44728]
    MTALITRDELAKDIANLTVVDALGAEYHAKRHLPGAVPLAPGEVEARAAEVLPDRDAAIVTYCSNVACPNSGQVADKLTK
    LGYTNVRKYREGIEDWADAGLPLE

    >gi|291302248|ref|YP_003513526.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stackebrandtia nassauensis DSM 44728]
    MTVAVGTQAPDFTLKDQNNQEVTLSSFKGHKNVLLVFYPLAFTGVCEGELCGVRDNLSSYQSDEVQVLTVSVDSVFTHKV
    WADKEGFEFPLLSDFWPHGGVAKTFGVFDEDKGIANRGTFVIDTTGTVRFAEMNLPGEPRDQGAWQKALAELTG

    >gi|291302398|ref|YP_003513676.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Stackebrandtia nassauensis DSM 44728]
    MAVRLVKGDKVADFALPDQTGTTRKLSEFLAEGPVVLFFYPAAMTRGCTMESCHFRDLATEFAEVGAQRVGISRDPVDKQ
    RKFAEMNDFDYPLLSDREGAIAEQFGIKRSIPLGPLSIKRKTFVIDVDHTIMDVFHSEINMNGHADQALEVLRRRAG

    >gi|291302744|ref|YP_003514022.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Stackebrandtia nassauensis DSM 44728]
    MRKTSENDNEQLVDVLVIGGASAGLSGALTLARARRSVVVIDSGKPRNLPAAASHGFLTRDGVAPTELVRLGAEEVAAYG
    GTVVTDIVTGVSGHNGDFTVTTEAGRSFHARRLLVTTGLSDELPDVPGLWQRWGRDVFH
    CPYCHGWEVRDQPIGVLDSGP
    NGVHQALLLRQWSDSVTLFLHRAADPSDEQFAQLAARGITVVDGEVSGLDIVDDQLAGVRLETGTRLPVRALAVAPTFTA
    RAGFLADLGLTTVEHPSGMGDHLAADANGLTAVAGVWAAGTVTDPMANVAMSVGAGARAAVMLNADLMFADVAEAVADTG
    LAA

    >gi|291302775|ref|YP_003514053.1| OsmC family protein [Stackebrandtia nassauensis DSM 44728]
    MRVLYTANATATGDGRNGHVATSDGLLETNLAIPTAMGGPGGATNPEQLFAAGYAACFHSALQTVARKSKTDLGTTAVSA
    EVGIGPVDGGFGLTAALTISAPDLDPETAERLVAQAHQV
    CPYSNATRGNIDVTLTITKETPA

    >gi|291302819|ref|YP_003514097.1| mercuric reductase [Stackebrandtia nassauensis DSM 44728]
    MTDYRTHDLAIIGSGGGAFAAAIAARKQGLSVVMVEAGAVGGTCVNTGCVPSKALLAAAEARHQAQGSRFAGAPTRAGAV
    SWRELRASKDDLVAAMRADKYTGLAAEYGWEIVAETAAFAGTPDAPAIEVTLHDGGGRRLQASHYVIATGSIPWVPPIPG
    LAEAGYLTSTTAMDLEELPESLIVIGGNAIGLEQAQLFARLGVKVTIVEALDRLAPFEEPDISSVVEHALADEEVDVVTA
    AVVTKVHTRPGGYAVEVIGPDGAVRQLAGERLLVATGRRPNTAGLRLASVGVEVGDRDEVIVDDRLRTANPRIWAAGDVT
    GHPQFVYVAGRHGSVIVDNAFNEANRTVDHSHLPRVTFTSPTVASVGLTDAQAVAAGYTCECRVLPLEYVPRAVVDRDTI
    GVVKLVADANTGRLLGAHIAAKAAGDMILAATYALDHGMTVADMADAWCPYLTWAEALKLTAQTFTTDVTKLSCCAA

    >gi|291302833|ref|YP_003514111.1| transcriptional regulator, ArsR family [Stackebrandtia nassauensis DSM 44728]
    MKEDDGAPLDKADADEYASWFKALSDGTRIRIVSLLAKRREPMKVGAIVDAVGVGQSTVSHHLKILAEVGFVLAQHSGTS
    TLYQVNESCVTAFPSAADVVMGRPAPPRTCLGVSMSHKNIIDKYSSLARTALDGAQVTDCEPRAFADGKFGAGGYVKLDD
    LPEGAARASLGCGDPVAVADLRPGDIVLDLGSGGGIDVLLSARRVSPGGKAYGLDASADMVALARRHAAEAGADNVEFLL
    GDIENIPLPDASVDAVISNCALCLSSDKTATLTEAFRVLKPAGRFGISDVVAHGEADPAERQRVEAQIG
    CAVGTLTTHQY
    RDMLSAIGFGDIDITLTADHGAGIHSAIVQAIKPG

    >gi|291302837|ref|YP_003514115.1| pyridine nucleotide-disulfide oxidoreductase dimerization region [Stackebrandtia nassauensis DSM 44728]
    MSHFDLIILGSGSGNSILDERFADWKVAIIDKGVGSRGSFGGTCLNVGCIPTKMFVHTADVAGSPEAGARLGVDLERRGV
    DWPAVRDRIFGRIDPIADAGERFRAEEQPNVRLLRGNARFTGLRKLSVELPDGDVTVSADRVVVAAGSRPRLPPIPGLAE
    SGFHTSDSVMRLERLPERMIVLGSGFVAAELAHVFASFGVAVTVVARFGALLRGEDAAISQRFTELASRHWDLRLNRKVV
    GVERDGEVVRLRLDGTDGAQTIEAEELLVAVGRVSNADQLDATVGGLELTRHGQIAVDAHQKTTAEGVWALGDVSSEHQL
    KHVANHEARIVQHNLLHPHEPIRSDGLVVPHAVFSSPQIASVGVTEEQARSRGLDYVSAVQDYAGIAYGWAMEDTTGFAK
    LLAEPDTGRLLGAHIIGPQAATLIQPLVQAMQFGLDARTMARGQYWIHPAMPELIENALLKLPLR

    >gi|291303282|ref|YP_003514560.1| heavy metal translocating P-type ATPase [Stackebrandtia nassauensis DSM 44728]
    MKTDTENIIELNIGGMTCASCANRIEKKLNRMDGVTATVNYATEKATATVPDGVAAADLIAVVEKTGYTAQPKAEVEEPD
    ADAELDGLRYRVILSLALALPVVAMGMVPAFQFPGWQWTSLVLTIPVIAYGGWPFHKAAAVNLRHGSATMDTLVSLGTLA
    AFGWSVVALFFGSAGMVGMTHGFSFGLTSGGGLSNIYFEAAAAVTALILLGRFFEHRAKKRAGSALRALMDLGAKDVTVR
    RDGVEHRVPAAELRVGEEFVVRPGEKIATDGEVVEGHSAVDESMLTGESVPVEVGVGDTVTGATLNSGGRLVVRATRVGS
    DTQLAQMARLVEEAQTGKAEVQRLADKVSGIFVPIVIALSLATLGVWLAVTGDAASAFTAAVAVLIIACPCALGLATPTA
    LMVGTGRGAQLGILVGGPQVLESTRAIDTVVLDKTGTVTTGTMALAEVIPADGVEAGELLRLAGAVEAASEHPIARAVAA
    ATESLPAVTDFSNHAGLGVTGMVDGHAVSVGRVAMLTEWALSLDDRLTKARDAAESQGKTVVAASWDGQVAGLLVVADEV
    KPSSREAVSRLRALGLTPVLLTGDNRRAAEAVAATVGIDEVHAEVLPKDKVDVVKSLQDKGRTVAMVGDGVNDAAALAQA
    DLGIAMGTGTDVAIEASDLTLVRGDLLVAADAIRLSRKTLRTIKGNLFWAFAYNVAALPLAALGVLSPMIAGAAMAFSSV
    FVVGNSLRLRRFN

    >gi|291303475|ref|YP_003514753.1| hypothetical protein Snas_6036 [Stackebrandtia nassauensis DSM 44728]
    MNRLANALSPYLRQHAGNPVEWYPWGEEALAEAKRRQVPLLISVGYAACHWCHVMAHESFEDDEVAARVNEMCVPVKVDR
    EERPDIDAVYMNATVALTGQGGWPMTVFATPEGTPFFAGTYFPREHFLRLLDAVDEAWTNKREEVVAQGNTIVEALASAG
    PKLADVTEACPIGEPCPPRPPLGAAVLGDMVAAIQGAYDERNGGFGGAPKFPNQPVLAFLLEWYRENPDAETRKVLRHTA
    SRMARGGMYDQLGGGFARYSVDASWTVPHFEKMLYDNALLLDTYAGLGGVTGEEFFGRVAEETARFVVEGLGTAEGGFAS
    ALDADTEGVEGSTYVWTPRQLRDVLGEDDGEWAAHAFAVSEGGTFEHGTSVLQLPVDPEDMKRYADVKARLLTARGQRAQ
    PERDDKVVACWNGLAISALTRYAREFEVPWAEAAADRAARLLAEVHTVDGRLRRVSRDGEVGAAVGILEDYGAVAKAYLD
    RWGATADEVWLERAAELVGVIVDQFTDETGALHDTAADAETLVTRPADPTDGPTPSGWALAASALLAYGNETGREEYRDA
    AWRAVALAEPLLTEHPRFTTGLAAVALRLAETESES

    >gi|291303861|ref|YP_003515139.1| thioredoxin [Stackebrandtia nassauensis DSM 44728]
    MGSMKAVTDASFKADVLDADKPVLVDFWAEWCGPCRKVSPVLEELATEMSDKVRVVKVDTDANPNTMRQYQIMSVPTIML
    FKGGEQVGAIVGAKPKSEIRKLIESV

    >gi|291303862|ref|YP_003515140.1| thioredoxin reductase [Stackebrandtia nassauensis DSM 44728]
    MSDIRNVIIIGSGPAGYTAALYTARADLKPLVIEGAESGGALMTTTDVENFPGFADGIMGPDLMDTMRKQAERFGAELLT
    DDVTKVELTGKVKTVWVGDTAYKAHAVILATGSAWRPIGIPGEQELLGHGVSS
    CATCDGFFFKGQHIAVVGGGDSAMEEA
    TFLTKFAESVTIVHRRDSFRASKIMADRALSNPKIKVEWNTVVDKVVGDQKVTGLEVRDVTTGKTRTLDATGMFVAIGHD
    PRSALFADQVDTDDEGYVKVDSPSTRTNLAGVFAAGDLVDNTYRQAITASGTGCAAALDAERYVAALETE