Spirosoma linguale DSM 74 uid43413

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|284034983|ref|YP_003384913.1| Peroxiredoxin [Spirosoma linguale DSM 74]
    MKKNLVFTLIGVVVIATLTSFMSLSTLVKGIFSNKSEAIAAPANAVAPAKSLYDFTVNSLDGKPVALKAYKGKKVVILNV
    ASK
    CGFTPQYADWEKFYKEHGNKIVVLGFPANNFGSQEPGSSEEIATFCQKNYGVTFPMFEKVSVLGDDQAPLYKWLTDK
    SMNGWNDKAPTWNFCKYVINEKGELTNFFASKVKPTDEEFKKAVGI

    >gi|284035229|ref|YP_003385159.1| Rhodanese domain protein [Spirosoma linguale DSM 74]
    MDITVQELKERLDKGEKLNLFDVREPDEYEADNIGATLIPLGDLSYRLDELDGLQDEEVIVHCRSGKRSGMAQQILEENG
    FNNVRNVIGGMLAYRAQ

    >gi|284035321|ref|YP_003385251.1| Thioredoxin domain protein [Spirosoma linguale DSM 74]
    MNSFVSRLLLSFVLLASCKPGAYSLPVSFNEPPGIVFFKGSWKDVLAEAKRQNKPVFLDVYTTWCPPCKRMAIEAFPNPK
    LGAHYNVHFINYQLDAEKDEGPAIARQYLVGSYPTALFIAPNGDLIHRAVGYGGINAMLVQADHVLSLPRLKSTVAKGDK
    AYAEGKRDPDFLKKYIQTRQSLNRPISDVLDAYIDALPESERTTAQTVQFVAETIQSTDTKAFELLIANRPSLLTTDSAQ
    ESLLQAIFRALYRVVRSDFERAITTNDEQLLEKVIVNSERDATSANPFVTRREAEKQEAANDYRLTFYKRTRNFARYQTI
    AEPIARDQLMSQAIADLHEQDSVIAMRMQTAESALPDSIRNNPAFNPPMKKHLISSKVARTLNEIADTYRTMGTSAIHWE
    PALAWAERSVRLYRTHTLLHTFAQLLQKLGRIQDAVYAQKEAIHEAEKEGWPTHDYEAELADMGRN

    >gi|284035377|ref|YP_003385307.1| OsmC family protein [Spirosoma linguale DSM 74]
    MPTIHIDYLGGLRTDCIHLQSGTHINTDAPTDNQGRGEAFSPTDLVANALGTCIITTMAIFARRDGIELAGSTLEVTKIM
    TAQPPRRIARIEVDLVLHTDAMPDAETRARLEKIAHT
    CPVAISLHPDIEQAVRIQWTERAVTTE

    >gi|284035463|ref|YP_003385393.1| thioredoxin [Spirosoma linguale DSM 74]
    MAAGTHAVEATDANFNDLINSDKPVLVDFWAEWCGPCKMIGPVVEQLAGEYEGKAVVAKMDVDQNSQVPAKFGIRSIPTL
    MIFKNGQLVDKVIGAVPKNVLEQKLQGAMEPATI

    >gi|284035498|ref|YP_003385428.1| transcriptional regulator, AraC family [Spirosoma linguale DSM 74]
    MTSDSTFTYQQIARAIEHLTATYREQPSLSELAEKVNLSEFHFQRLFTEWAGVSPKKFSQYLTLEHAKTRLRNGAPLTDA
    AYDAGLSGTGRLHDLFVNIEGITPGQFKQGGSGLVLAYGLFTSPFGRYLLGAINGRIALLHFLNEGDTVETILASAWPEV
    SFQHDPITLQPLADQIFNPPAVGLAERTGSKPVLSVLMRGSAFQLKVWEALLKIPEGDLASYDQIANAIGQPTASRAVGT
    AIGSNPVGYLIP
    CHRVIKKTGLFGGYRWGAERKQAMLGWEAAQVDK

    >gi|284035578|ref|YP_003385508.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKNHIVSVGSTFPEFKKLAVVSLDKDKEFYEISSEDHKNAGQWLVMFWWPKDFTFVCPTEIAEFNKKFEDFQDRDTMVIG
    ASTDSEFVHLAWRKNHDDLRGLKFPMLADTSKSLAEELGILEANEKVAYRVTYIVDPQGTVRWVAVNDLSVGRNVNEVIR
    VLDALQTDELCPCNWVKGEETLTA

    >gi|284035633|ref|YP_003385563.1| Peroxidase [Spirosoma linguale DSM 74]
    MSLRLGDIAPDFEADTTQGHIHFHEWLGNSWGMLFSHPADFTPVCTTELGRTALLKDEFGKRNVKVIAVSVDDLESHNRW
    TPDIKDVTGSEVNFPIIADPDRVVATLYDMIHPNASEKATVRSVFVIGPDKKIKLTLTYPASTGRNFNELIRVIDSLQLT
    ADYQVATPADWQEGDDVIVTPAVTNDQLEAKFPKGVTFVKPYLRTTPQPNK

    >gi|284035709|ref|YP_003385639.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MRITLFYQLLLGLLLALSTIENLALGQQKKPTIVFVDPNISIQKWIGKKMPIFRLQDKQGNVYDNKSILGKVTVFNLWSI
    H
    CHPCIVEFPMLNGLVGKYSKDNIIFLAPAPESSEQINNAISVDSFNYTVLPDAQSFFDIMGLVGYPYHILVDRNGFIRY
    IHMGIKNRKSGKEIAITELPQVIEHELNEKEAEQK

    >gi|284035712|ref|YP_003385642.1| Redoxin domain protein [Spirosoma linguale DSM 74]
    MKIDISNPYPLILAYLLYIGHQNLSAKNIIPHPEEPNCYLDSIKIIVNKKKQKSQLEFEDYFGNKLTLQKGENVLFAPLI
    IKDVDWRHQTKFIFDKPIALMQFIQNDQGYWCIKAGNDNLDKEFNFDVHYRQEISPILTSGWARLKFVNANYMQDVQKRK
    NDIDKYFSVKGDYLNSYASKYGLSRSFITKWQTIIKYEKLSSMLFVGSNYQKWPKLYLTELNKIIYEFNDDYLYLSDYRE
    GCIQLLHLKAFLMLGKDVTLSQYYELAERSYTGKTKEYILLTLLLQSQDKYSDIKTTNFEYGKLVKKYLGSCQVKEFCEY
    LSKSKLPNKINTYNYQLLNIDRKQVDFSEITKQATINYIDFWASW
    CVPCRAEMPDSKKLSEEYTAKGINFIYISIDENSA
    AWERAMNQIGLPKKNSFLLPYFKKSQLYKKYNISTIPRYLLIDKQGNLISDDAPRPSDPKIREKLNNLLKK

    >gi|284035897|ref|YP_003385827.1| Peroxiredoxin [Spirosoma linguale DSM 74]
    MSLNIGDLAPDFTSTDQNGQPITLSDYKGKKVVLYFYPKDNTPGCTAQACSLRDNYADLRAAGYEVLGVSVDDQKSHQKF
    ISKFELPFTLIADTDIKVAEAYDVWKEKSMYGRTYMGTVRTTFLIDEKGIITDIIHKIDTKNHANQILN

    >gi|284036053|ref|YP_003385983.1| Redoxin domain protein [Spirosoma linguale DSM 74]
    MTSIKNSIHAFKLFFLGLAGLFITGISLGQTTGTAVTLGGKTIHTVGKLPAVGTPVKDFTLTGIDLTDKTLADYKGKYVI
    MNIFPSVNTGV
    CSKSVRKFNEDAAGLKNATVLCISKDLPFAQKAFCGAEGIKNVVMLSDFRTDFGSSYGVQIADGPMKGL
    LSRAVIVVNPEGKIVYEQQVPEIGQEPDYAAAIAAIK

    >gi|284036279|ref|YP_003386209.1| arsenate reductase-like protein [Spirosoma linguale DSM 74]
    MYTLYAIPNCDTVKKARTWLAGRGVEYRFHDYKKQGIDSKTIEQWLTQKPWEELVNRSGLTWKKLSDAEKPTNSAGAIAL
    MIEKPSVIRRPLVEADGQIIALGFNESAYQETFSDGTTVL

    >gi|284036281|ref|YP_003386211.1| hypothetical protein Slin_1362 [Spirosoma linguale DSM 74]
    MKKILLLLLVAHIALAQKPGGIEFKTTPINSIFQEARRAGKPVFVEIYSPSCHTCQSFIPTLADSRVGKLYNAKFLSTKL
    DINAPATQSFLTSRRLFVPSLPLFLYFDPQQNLIHFAMSNNSTDEVIRHGTNALDPKVRSQGMKARYQQGERSANFLIDY
    AMFGRVTKDTVANMAAMNEYARQQSASTFASQTNWLALQKLVLDYENPMFQYMLNHMDTYRKAYGAEQTLQVAENILMSS
    LFSGRGAQYPIAKIVQIRQDLIKIGIDTKVAYNRTLLPEVNAYFRARQTAKAVERMDNQVNSNQLSVPEYIYISRLFNRS
    SPDAVDAPTVVKWVNKGLALKPGSKEQADLYYELAEAYRRGGKTADAQKAAQKSMELAQATQLDTRRNVEQMGKLK

    >gi|284036315|ref|YP_003386245.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Spirosoma linguale DSM 74]
    MKNNKPVKTHSQSGINNTHNMTANKPTYDVISIGGSNAGLSAALLLGRSLRKVLVIDAGQPCNRQTPHSHGFLTRDGETP
    AQLASIARDQLGRYPTVQFRSDTVVTAVQTEDGFDLTTASGKSFTSRKLLLATGLFDIMPDIPGFAECWGRSVLH
    CPYCH
    GYEVHGQPLGVLANGEVGYEMATLIQHWSSQLTLFTNGPSTLTYTQQEMLQQLKIPIIETLLDAIEHQSGMLSGLRFNDG
    SQVQLKALFSRVPFRQHTNIASQLGCAITDNGLIETTEFGKTTVPGVFAAGDATTLFRQVAIAVANGSKAGAWINKELIT
    EDLEQINQVRSRYTH

    >gi|284036354|ref|YP_003386284.1| pyridine nucleotide-disulphide oxidoreductase dimerization region [Spirosoma linguale DSM 74]
    MGMLTFDLIVIGTGSAGATVAQTARKAGKSVAIIDKLPFGGTCSQRGCDPKKILVGAAEIVARSEQLTGKGITSPATIDW
    DALMQFKKTFTSPIPERTQSKFTDQGIQIFQGIASFSSANTIRIGEVELTANHIVVATGQRPQPLNIPGEKLLIDSTGFL
    ELPRLPAKIVMVGGGYIAFEFAHIAARAGAKVSIIHQGQRPLEGFDADLVALLVKAMNAIGIHIILDARVTALEGDRDEL
    IVRYSQHDKEHTVSTNLVVHAAGRVADVAELDLGNAGVTVGKKGIVVNEYLQSVSNPGIYACGDVAEKGLPLTPLASYEG
    SIVAENILNGNNRMYEDNPVPTAVFTIPTLASVGLTEEQAKDKGLRVQVRCQETNDWYSSRRINESFTAFKTLVEAETGT
    IVGAHVLGSGSEELINLFTLAIRHRINAKDLGAMLFAYPTHGSDLSSMLPDH

    >gi|284036357|ref|YP_003386287.1| OsmC family protein [Spirosoma linguale DSM 74]
    MALITARIERTPYETHLSTSSQVIVADEPSDVGGQDRGMGPGELLAGSLASCTVMTVRMYADRKGWSLDSAVARVEYTSN
    AITQRSLFTMELILNGDLTDEQRTRLAEIADRCPVHRTLQNPIDFETILIEDNHRQH

    >gi|284036376|ref|YP_003386306.1| rhodanese domain-containing protein [Spirosoma linguale DSM 74]
    MTTHTYTDITLPELERLRCQPDTAVVDVRDEWEFEEFNIGGLNIPLPDIRARKSELLPYSTLLVICTNGVRSRVAAKDLL
    RQPDLQTKSIYHLHGGIIEAVD

    >gi|284036407|ref|YP_003386337.1| DSBA oxidoreductase [Spirosoma linguale DSM 74]
    MDVEIWSDIMCPFCYIGKRKFEQALNQFEHKEQINIVWKSFQLNPDMKTQPGKSINQYLAEVKGWSLAEAQRMNDHVTGM
    AREVGLSYDLNKAVVANSWDAHRLIQLAKQHGLGDAIEERLFRAYFTEGRDTSDHATLLELGTEIGLEATAVEQLLNSNQ
    FADAVNRDVYEAQQVGARGVPFFVLNRRYAVSGAQQPETFLGALNTAWTEWENANSVLTDVQADGPACTPGEVC

    >gi|284036422|ref|YP_003386352.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKTVSLFQFLISVILYSCHQTEKATPATLPLTLVDGYGPFNPGFSKLGNERQTNPDAQEPWRKMCLNVRGIPADWSNVDK
    AMIWLNTNQLVYQNFIQGTFTKSQYNECRKYWKLTADTSQLSRKPIKCYVYTLRGFDEQAGKWAVLIDTNNNLDFSDETA
    FYPEVIQGNNPYSYKKLTLVNYEIYRKGKILKASLPMLVKTFGSDFFYNFPQYAQATLKHGGNTYNLAVSFGFTRPDFDI
    IGLADLSSLYKNERLSEDKLIEINENVRLDGITYKNKGVDFYNNVLRLDPVIDDKKEYSLQVGYPFRPFAEQEFTSRRPI
    ALADFKGKYVYVDFWGTW
    CKGCVDDIPNLKKLYAGLDKNRFEFIGIVQDSPERLTKFIKKQDVQWPQILSDEANKLVESY
    PFTGYPTSVLLDKNGLVLARDLRGNELRDKLKELSAE

    >gi|284036502|ref|YP_003386432.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MLTTGQKAPEFTLFSSDKKEVSLADFKGKNVVILFFPMAFTSVCTAELCEMRDNISVYSSLNAEILGISVDSPFTLAKFR
    EEQNLPFPLLSDFNKEVSQAYDTYYETFVMNLKGVSKRSAFVVDKDGNIQYAEVLESAGDVPNFQAVQETLKGM

    >gi|284036510|ref|YP_003386440.1| methylated-DNA/protein-cysteinemethyltransferase [Spirosoma linguale DSM 74]
    MTTTLFDSPLGVVAISGNDTGVSGITCTNVSPVDNAPGGPVPEPVRLAAEQLKAYFAGELKSFDFPINPAGTAFQQSVWR
    ALLEVPFGTTLSYLALARRMGDEKAIRAVAAANGRNPLWIVVP
    CHRIIGSDGSLTGYAGGLWRKQWLLEHEGAFARSNQM
    SLF

    >gi|284036514|ref|YP_003386444.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKTKKSLSLVNLLLIHSKRAVMGCAVTMLCALSAGHVQAQFCFSPERPQLGQVVSFTYTPQTTPLASDSTLEGRYVRYGA
    PNVIQLSQPATVKLVRHGNDFVGELFIPRKDVAGMMLLFRNSNQPKRTDLNNGQLYIIPVCDASGRIVPHATGGQASVFT
    RSHFLYESGARPDPNWVVTLYEHELAQNPDLHPFYWSDLLAAQVKQKKPGYGPKVKADIESYLTSRPTPTTAELTTAAQL
    YESLGDFPKANALRERQKLVEPTGSLAQKDRSMAIRTEPNWERKKAAYQAFATEFPTSSYLPALTVMMTDGYFKNNDISG
    LITFVENQPASHTDVLMLNTIAFQMADERRSLPEAEKLINRAIDVLKSQPKPRTGASNWEAEKLTRQRQLLNTYARVREQ
    QGDYAGAYTAYQTFIDPNDIDNTEPRLIERYFQCALQTNHVAEARPVAEAAVQIGKGTSGLKRALRDWYAKQPGSTPAKA
    DAYLTQLEADLRADQRDELQQLLINEPAPAFTLTDLQGRTISSSAFKGKVIVLDFWATW
    CGPCIASFPAMQQAQTRFQND
    PNVKFLFVNTREGGPVQRVHNFMSKHPYPFVVPLDGQQKVANAYKVQGIPTKVVIGPDGRVRYRTIGYSGNPESTVNELS
    LVVEMLKEGK

    >gi|284036572|ref|YP_003386502.1| peptide methionine sulfoxide reductase [Spirosoma linguale DSM 74]
    MTQKTFLLLVGWLIVGTLSFTGCRQRTDASKASTAIDVSPAKLPTLQPGESVATFAGGCFWAVQEEMRVLKGVRAVISGY
    AGGDLAFPTYEQVGTDQTGHAEAVQVYYNPAVISYDVLLDAFFAGHDATQLNRQGPDIGKHYRSAVFYRTPQEKARINAA
    IQRENASGHHQGRVVTQVVPFVAFYPAETYHQDYYRHNPYNMYIHLVSEPKVATFRERMETWLGE

    >gi|284036587|ref|YP_003386517.1| Rhodanese domain protein [Spirosoma linguale DSM 74]
    MKPYRVLLYYIYSPIENPEQYREEHHLLCLRLNLLGRIIVAPEGLNGTVSGLTADCEAYMETLKADPRFTGISFKIDESD
    GHTFQKLHVRVKPEIVHSDLPVDPLRQTGIHLEPEDFRRLKNDPDVVLVDMRSNYEHEVGKFKGAITFDMENLRELPNHV
    HELDEFRDKKIITY
    CTGGIKCEKASAYLLSQGFENVYQLHGGIIRYGLETGGEDFDGECYVFDNRVTVPVNHINPVTVSV
    CYRCGSPTSRMINCASPVCNNHVTLCESCGDAHGGTCTDACKDDPNLRPYDGTGYYGKQTQSYSPIQGFKSRLGQRVEVS
    I

    >gi|284036620|ref|YP_003386550.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKGKVYSPQTMVGKIVVLKCWFVHCVACVAEMPALNALKQRYQDRSDIEFVSLCLDPKDKVATFLGKTKFDYATVANQTK
    YLENQLKIGSYPMHFVVNKQGLVVKQVNRYQGVVYTLNKM

    >gi|284036694|ref|YP_003386624.1| thioredoxin reductase [Spirosoma linguale DSM 74]
    MTSEHVKCLIIGSGPAGYTAAIYAARANVQPVLYQGGQPGGQLTITTEVDNFPGYPNGVQGPQMMQDLEAQARRFGTDIR
    YGMVTKVVFADQPSLDNPHRAIVDDKHEITADSIIISTGASAKWLGLPSEMRLNGRGVSA
    CAVCDGFFFRGQDVAIVGAG
    DTAAEEASYLSNICRKVYMLVRRDEMRASQFMQKRVKTAHNIEILYNTSTEEVLGDEDVTGVRVKNSETGEERILDVTGF
    FVAIGHKPNTDIFQDYLDLDENGYIITEKGSTRTNIPGVFACGDAQDNIYRQAVTAAGTGCMAALDAERYLVTLEMQGEE
    IVH

    >gi|284036777|ref|YP_003386707.1| Redoxin domain protein [Spirosoma linguale DSM 74]
    MIYYRFLILLLFLSISRSFAQSIYQGPDPETLATTEAEKAFLTAFTTTFKTDFDVSGQYAKLADTGLDAWEMQLFDARKA
    QLAFYKAYPQESQFSAPFKQYIDACIRWNYWHLLLAYPILRGNAQTSQLNVPSLPAIMVDELSGLNMNDEAALPAESYQH
    FLYFYITYVNSKARNFVKYTQADIHTSLTDKAAVARNQLTGRPYQYALARLLVENCEKVTPASVRTVFDLLGNTPNASRY
    VTIVKARCGAVMDRKDEPVSATKKKPSDPNAFSFTNLSGKVVTLEEFAGKVIYLDVWASW
    CGPCRAEFPFSKQLQERLTK
    KQKEQVVFLYLSIDDSEEAWKKALNTLQLTGEQGLSKGGWHSRTVQYFGISSIPRYLLIDRKGKVADENAKRPSQTDAIL
    QDILKLISE

    >gi|284036789|ref|YP_003386719.1| hypothetical protein Slin_1875 [Spirosoma linguale DSM 74]
    MKLALISLLISLITLAPNWILNFDQAKTEATQSHKLILLNFSGSDWCGPCIKLKKTIFESAEFGQYADEHLVLVRADFPR
    LSKNQLDARQTAHNESLAEKYNKQGKFPFTVLLDASGKVLKEWDGYPQSLTIPGFIDAIQTATPASK

    >gi|284037137|ref|YP_003387067.1| protein of unknown function DUF255 [Spirosoma linguale DSM 74]
    MPNQLQYETSPYLLQHAENPVNWYPWGDEALTRAIEEDKPIIVSIGYSACHWCHVMERESFEKEAVAQVMNKHFVCIKVD
    REERPDVDAIYMDAVQAMGVQGGWPLNVFLMPDAKPFYGVTYLPQKNWVNLLESIDNAFNEHRADLAQSAEGFARELNLS
    DAERYGLTQNDPLFAPETLAVLYRKVAVKADDEKGGMRRAPKFPMPSVWRFLLRYYAVASSSRQIAEAADTSDQALNLVR
    ITLDRMALGGIYDQLGGGFARYSTDADWFAPHFEKMLYDNGQLLTLYSEAYSLTKSKLYKHVVYQTIAFAQRELLSPEGG
    FYSALDADSEGVEGKFYTFTTPELKEILGADFDWFADLYSISENGNWEHGRNILHRIEADDEFAARMGWSVADLNVRLDA
    THTRLLRVRNERIRPGLDDKILCSWNGLMLKGLVTAYRVFGEPEFLTLALRLAYFLLKKMRDSRNGRLWHTYKVSEGGTG
    RARQAGFLDDYAAVIDGLLALYQATFTRNWLTEADQLMQYVLTNFADLSVDELTGPEPLLFFTDKNSEELIARRKELFDN
    VIPSSNSMMAENLYVLSLLLDRPAYAERADQMLGRVQPLVEQNADYLTNWAAQFALRARPTAEIAIVGPEAGQFRAELDA
    DFHPNRVLCGTSDLQETGPDGLPLLQHRGLVNGQTAVYVCYNRACQLPVTSVSEVRELVQ

    >gi|284037254|ref|YP_003387184.1| Thioredoxin domain protein [Spirosoma linguale DSM 74]
    MTRHLLYKCLPYINNYVKYLSMVVFSTIKCAGADSTTINFYNGSYVELIAKAKSDNKAIFIDISTAWCGPCIRMNKEAFQ
    AKSVVDQLNPIFLAYKVDAEKGEGIKIAKQFNVSSYPTLLFLNSSASLMYRVVGYTNISNLLNQITVATNAIKYSEPISK
    WDDEYSSGNRNPIFLYNYLVKREKLGLLGGEVVDEYIKTQQADSILSKHNLELLSKTVSSSRTKAYDVLINYISKQPIED
    KEFYNRSILQLENALLNDRNEAIDKKNDVLFNKYIVRRKELFDLYKEDNKSRQLKVIKFIKMNYYQKTNNLKYYKRFAIP
    FAEQIMRLNVDSLHKIDSVDFIRFKEEIYLPPDSIRKQTYDAHFYERQHMHSELAAYDLNEIIKTYLQNAKYRNDLEQAI
    IWSKRVIMLIPDPLYLSINAQLLVKLGILHKAINLQKRAITQAKALGRDTKELERDLKIMRSRKP

    >gi|284037379|ref|YP_003387309.1| peptide methionine sulfoxide reductase [Spirosoma linguale DSM 74]
    MKLVQVFLFSLLAIYAQGQDVIPAKLPNPKPGEAIATFAGGCFWAQEEAFDQIKGVREVISGYSGGHVKNPTYREVGTDE
    TGHAEAVQVYYDPKVISYDELLVGFFAAHDPTTLNRQGPDVGRDYRSVAFYRTPAEKEAIQEAIKAVNASGHFAGPVVTE
    VVPFTVFYPAEGYHQNYCKLHPDQPYVRQVSLPKVAKLRKALAGKLKPDA

    >gi|284037380|ref|YP_003387310.1| methionine-R-sulfoxide reductase [Spirosoma linguale DSM 74]
    MNKQSFLQVISGLLVAGLVSFFLSAFVTPVTTDGGKAPRRVEKTEAEWKKILTPDQFAVMRKQGTERAFTSPLASNHEHG
    EYRCAGCHEPLFKSETKFESGTGWPSFYAPVSKNIVRELRDTSYGMSRTEVQCAVCDAHLGHVFNDGPRPTGLRY
    CMNGV
    ALEFVKK

    >gi|284037569|ref|YP_003387499.1| Rhodanese domain protein [Spirosoma linguale DSM 74]
    MLNLFKSIFGSSDSANIQDILSDGAVLIDVRSPGEFAGGHVKGAVNIPLDQVDARIAQIKRYNKPIVLCCASGMRSARAK
    GLLISQGITDVHDAGSWRNIR

    >gi|284037610|ref|YP_003387540.1| Redoxin domain protein [Spirosoma linguale DSM 74]
    MTRFFLFLLLMLSIELTYAQSKKDPLPIGLQAPKLEFKDLDNNLVSLEHLRGNIIVLNFWNIGCLGCEQERETLNRLSDS
    LQGKSIKFVSITLNKKEKIAAWLAKHPITYEFVGNVDFMGVSGSSFFNYRCMPTTVVIDQNGIVQYNQCGPIMTKEESDK
    FAKLLVKL

    >gi|284037611|ref|YP_003387541.1| peroxiredoxin, OsmC subfamily [Spirosoma linguale DSM 74]
    MKITRNAQAHWAGTGKDGQGTVSTASTVLNQTQYSYKTRFEDGVGTNPEELVAAAHAGCFAMQLAFNIQQAGFAADSLDV
    NCAISLEDGSISSSVLTLKASVPGLDKAKFDELVDHAEHN
    CPISKLFNTTITVNATLA

    >gi|284037673|ref|YP_003387603.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKRFIGLLLVGFGASLHPLWGQDAHQLIRAVRQKQALLNQITCSINRIDTLVTGQVRQFRGQLVLRPDPTDRLFGFWFRA
    KQDGQADEVLYNGHVGYKVNDKEKTYILLTDSTQIRTLRYQSGGRLIIPDLVKLDTTKVIRFTLRQDQHTYYLTMHYEDI
    KRYDVVNRYKTVQINRATLLPTSVREHQETLDKVQDLFYQVQSVTINPSRVDSLFHEPSFLGTYQQQLPLLPESKPVLGL
    MGQPAPSFRLASLGGDSLASSTFSGKVVLLDFWEVW
    CGPCLASMPKVAHLYHKYAAQGLSVYGITHEVGQLDAVRRLVAK
    RSIDFLTLIGTDQVRLDYKLAAIPLYVLIDRGGKIRYIGEGFSEKIEESIQHLLAQ

    >gi|284037807|ref|YP_003387737.1| heavy metal translocating P-type ATPase [Spirosoma linguale DSM 74]
    MTIADTGRKPDSGVSAGEIRKTYPVLEMSCAACAVSVESILQHTPGVSAAGVNYATQTAWVQFNPSVVTPAELQTAVQEM
    GYDIVIETEETGVDARQVQEEAQQQRVQRLKQRTIWAVILSLPVVVIGMFFMNQIPYGSYIMMVLSAPVVFGLGRSFFVN
    AWKQARHGSANMDTLVALSTGIAFLFSAFTTLYPDFWHSRGVHPHVYFEAASVVITFIMLGKLLEEGAKSNTSSAIKKLM
    GLQPKTVHLVVGDSEQEIPIASVQVGNRLLVRPGEKIPVDGRVASGQSYVDESMISGEPVPVEKMAGAPVFAGTINQKGS
    FQFHAEKVGADTLLAQIIRLVQDAQGSKAPVQRTVDRIAGIFVPVVLGIAVLTFIVWAVFGRYLMPEADSLTTALLTSVT
    VLVIACPCALGLATPTAIMVGVGKGAENNILIKDAESLEIGHTVNAIVLDKTGTITEGKPVVTDLLWSVKTDEQPQLEAV
    LYALEKQSEHPLAEAVVAHLTKSAPVQLETFTSVTGRGVSARYHNGIYLVGNQALLTENQIDLPAELARQALELQNQAKT
    VVFFARRMLEASKGEVLAILAITDPVKASSKQAIDRLVSQGIAVYMLTGDNAQTAAAVAKQVGISQFKAEVMPTDKADFV
    RELQAAGKVVAMVGDGINDSQALAQANVSIAMGKGSDIAMDVARITLITSDLTSVPKALQLSKQTVRVVRQNLFWAFIYN
    LIGIPIAAGALYPAFGFLLNPMIAGAAMALSSVSVVSNSLRLRGIRL

    >gi|284037821|ref|YP_003387751.1| methionine-R-sulfoxide reductase [Spirosoma linguale DSM 74]
    MRQNRFFFLAALLLASSLWIYGTYFAAPRPSHKRPSGTTSPGNRRVEKTDADWKAILTRSEYNITRKSGTEWPNSSDLTH
    ETRKGVYQCVCCRNPLFSSDTKFDSHTGWPSFYAPIVANAVYTEPDGNRTEVRCSVCDAHLGHVFEDGPDPTGLRY
    CMNG
    VALSFRSPGS

    >gi|284037891|ref|YP_003387821.1| selenide, water dikinase [Spirosoma linguale DSM 74]
    MIPTETTAFKLTQYSHGAGCGCKISPKILDRILHGQTSGPKGLATEPNSAPVFANLLVGNDSRDDAAVMDMGNGEAIIST
    TDFFMPIVDDAFDFGRIASANAISDVYAMGGEPIMAIAILGWPLDKLPPEVAAQVLEGSRAICREAGIPLAGGHSIDSPE
    PIFGLAVTGRVRLDHLKQNNTATLGCKLYLTKPLGVGVLTTAQKKGILKPEHADIAPAQMAKLNSFGAVLGKLPYVKALT
    DVTGFGLLGHLTEMAEGSGLSAVVSFADVPKLALLPEYLAQKSFPGGTVRNWDSYGHKISDVTELEKYTLADPQTSGGLL
    IAVEPESSIEFERVARENGFDLQSFGELVEQREKVVYVH

    >gi|284037953|ref|YP_003387883.1| methionine-R-sulfoxide reductase [Spirosoma linguale DSM 74]
    MKLALIAILSSCLLVSLAFTSDDTPPRRVVKTDAEWKKILTPNQYAVLREHGTERAFTSPLNDIHDHGTFYCAGCHSPLF
    SSSTKFDSGTGWPSFYAPISKTAVKENVDKSYGMVRTEVVCNVCGGHLGHVFEDGPKPTGLRY
    CMNGVAMTFEKK

    >gi|284038020|ref|YP_003387950.1| peroxiredoxin, Ohr subfamily [Spirosoma linguale DSM 74]
    MIQPLYTAHATATGGRDGHVTSSDKVLDLDVRIPREMGGAGGAFTNPEQLFAAGYAACFDSALNLVTRMSKVKTGITTVT
    ADVSIGKLADGGFGLAVTLDVNVPGVEQAVVEELVAKAHQV
    CPYSNATRGNIEVTLTVTNHETGVQA

    >gi|284038299|ref|YP_003388229.1| peptide methionine sulfoxide reductase [Spirosoma linguale DSM 74]
    MKGIHVLAFSLLLLAGCAQGQSKDYAPAKLPALKPGEAVATFAGGCFWALEEGMNQLKGVREVISGYAGGHVKNPTYEQV
    GTDETGHAESVQVYYDPKVISYPQLLDAFFAGHDPTTLNRQGPDVGRDYRSVAFYRTPAEKAEILAAIKRTNDSKHYANP
    VVTEVTPITDFYPAENYHQNYFALHPDQPYIQRVSLPKVEKLRKAMAGHLKNNTSLTMNN

    >gi|284038340|ref|YP_003388270.1| UBA/THIF-type NAD/FAD binding protein [Spirosoma linguale DSM 74]
    MEATTLVPAEKQRYQKHLNLPEISTKGQLLLKNARVLVVGAGGLGCPVLLYLTAAGVGTLGVIDPDVVDLSNLQRQVLYT
    TDEVGKPKAKVAVSHLNRLNPEITFDTYTMALDINNARAVIEAYDIVVDCTDNFKVRYLVNDICVTLGKPFVYGAIHRFE
    GQVAVLNADLGDGKRGPTYRCLFPDYPSEIEIPN
    CSITGVLGVLPGVIGTYQANEVIKLITGIGQSLNEHLFMIDLLSMN
    QQKIKTRRLPNAVDLAREGLASAGARPAPGTSGPQKISVQELSDRIALGEDLFLLDVRERPEYELCHLEGAVLIPVGMIP
    NNRKRIPTDRPVIVY
    CHHGIRSANVVQYLYAQGGLTNLYNLDGGINAWARDIEPEMAVY

    >gi|284038445|ref|YP_003388375.1| ATPase, P-type (transporting), HAD superfamily, subfamily IC [Spirosoma linguale DSM 74]
    MTTAAPTKTVCYHCGNECPSDTETIHFDHKPFCCQGCQTVYQILNEHQLCQYYDLNPTPGKTPKIERLAFLDHPDISAKL
    IDFQNESVAHVTFYVPSIH
    CSSCLWLLEHLYRIEPAVRQTRVDFLKKQVHLMYSPAQLSLRQVAELLTSLGYEPLISLDD
    VVKQGQKPSYRPLLYRLALAGFCAGNIMLFSFPEYLGLNDPDFKHLFGILNLILATPVVFYSGSGYFESVWKSLRRGIIN
    IDFPILLGILVAYFRGTYEVLALGGAGYYDSVTGLIFFLLCGKWFQQRTYDFLSFERDYKSYFPLAVTRLGQRGEANKSD
    LETPVPVADLQKGDRIRVRHGDLIPADSLLYRGAGLIDYSFVTGESEPESKDPGSLLYAGGRQMGGSIDLEIVRDVSHSY
    LTQLWNNDAFRKEQPNRAKTFADAVGTYFTITVLTLATLVGAYWYGWMGQPTTAVNAFTAILIVACPCVLSLSYPVALGH
    GLRWLSKQGVYLKNADVIEQLTHCDTIVFDKTGTLTTPASDVVTESFAKPLTSLERAMIRAVINQSAHPLSQRVRQFLAE
    CPPMLVENFTELPGKGVVGLVDDQLVKVGSAAFVGGVDQKSGPSVHVSIGGTYRGQFNVAAPLREGLASMLTSFVGNGKK
    LYLLSGDTSTARTELQSWFTDEAMQFGCSPDDKLRFIRKLQEKGHHVLMIGDGLNDAGALKQADVGIAVTDDTLRFTPAS
    DAILEARSLRKLPTYLRYSRFAMRLIRFSFGVSLLYNLVGLSFAAAGHLSPVVAAVLMPLSSATMVLIATVGMRMWGKAH
    PVSV

    >gi|284038616|ref|YP_003388546.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MSAKYLLLGLLALLLINSCSSRKPVVDPQLILQNGITFWNYNLQYVRLYEDYNAIDEKAKSVTRETFLRQLLTGRYLPLR
    LQSADSTAVYQLYPLPAKVDPSLKALLQQWAGDEYQFYRAEGKPLPNYHFVDMKGKVYSPQTMVGKIVVLKCWFVH
    CVAC
    VAEMPALNALKQRYQDRSDIEFVSLCLNPKDKVATFLGKTKFDYATVANQTKYLENQLKIGSYPMHFVVNKQGLVVKQVN
    RYQGVVYTLNKM

    >gi|284038796|ref|YP_003388726.1| Methyltransferase type 11 [Spirosoma linguale DSM 74]
    MQTDDQLKTVVREAYGQIASQSKAYNEASCCGATSCCSPTDNPAIMADDYSQLAGYVADADLGLGCGLPTQFAQIKPGDT
    VIDLGSGAGNDCFVARHETGPTGKVIGIDFTEAMISRARKNADTLGYNNVEFRFGDIEEMPVADNTADVIVSNCVLNLVP
    NKKNVISEIWRVLKPGGHFSISDIVLVGDLPANLLKAAELYAG
    CVSGAIQQDVYLNLIQEAGFTNLTLQKQKAIFLPDEL
    LANYMTTDEIASFRQSGTGIVSLTAYAEKPSKSAKPRVQLINLTTKTDARCEPGSGCC

    >gi|284038922|ref|YP_003388852.1| Thioredoxin domain protein [Spirosoma linguale DSM 74]
    MKKVIWLLAILLVGIHSVPTSAALNPSEPRPAKVGKRAPADDTEGIQFTEASWKDILKKAKAEKKVIFLDAYASWCGPCK
    LLQKNVFTKKAVGEFYNGKFINVKMDMEKGEGPALSQVYPLEAYPTLLFIDGNGKVLKKVLGLQTPENLIAIGKSVK

    >gi|284039079|ref|YP_003389009.1| hypothetical protein Slin_4225 [Spirosoma linguale DSM 74]
    MGHLNQSVKGLNSFYSRWIYQVIQPGVFARISRGKGDWKFKGLPVIGLALLLFVQLKPASSGLTVYAFLSTECPISQQYV
    RTLEKLHQRYSPVGVRFIAMFPLSTDSPQRIRQFRSEYGLPFTGRPDVGAQLARQFRVRTTPEVVVMQANGIVRYQGAID
    DWYISLGKHRPQVTNAYLQQALDALLANQAVTPARTEAIGCLLN

    >gi|284039095|ref|YP_003389025.1| alkylhydroperoxidase like protein, AhpD family [Spirosoma linguale DSM 74]
    MATFTVPTRDQVSAQNQQLFDNLQKGLGFVPNLYATFGLSDNGLGAYLAFQQSQTKGAFKAKEREAINLVVSQANNCVYC
    LAAHTALGKMNGFSDEQILQLRAGHADFDPKLDALVKLAKAITETKGHPATDLVDAYIEAGYAKSSVVDLILMVGDKIIS
    NYLHSLTQIPVDFPAAPVLETAEA

    >gi|284039130|ref|YP_003389060.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKKLLLTALFSLYLLPAIWAQSATKPIDSGFKIIGHVNGLKDTTCVLAHFFGSTQYIPKDTARVDGAGNMVFEGTKKLPE
    GLFIVVMPQKGYLQLLVTDDQQFSFDTDTTNIIASMKISGSKENELFYAYQQQLSKLSDQAQALTVQKKMRSDAVSAAMV
    NKQLSDLQKQATDYRSQFLKDNAGSFAVKLFKASAEPDVPPAPKAANGRPDSVWVFNYFKAHFWDDFDFSDERFVRSPLL
    QQKVERYIKELTVQVPDSLIKEADLVVNKAIAGKSTEVKYYTIYYITSQYEQPKVMGTDGLFVHMFEKYYKTGVMTVSDS
    STLKSIGERVATMKPNLVGKPFVAPVISDTLRRPIAFQNMKADYTVVFFYSPT
    CGHCRESAPKLKKLVDDYKGKGIEVVA
    IAIDQSPEEWKKFVKEFKLGNAINGFDYSYRTDFRRQYDVWTTPTVYVLDKNKRIIARKLPTEQIEDFILFNKRQEAAKR
    TASVSAKK

    >gi|284039277|ref|YP_003389207.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKHLLPMAAVTLLLLPSACSGQSTPATVKPGTYRAVLKTKGGELPFGLDIQPTATDPKTYTVFAINGNERLKMDPATVQN
    DSLRIPMTLFESELVAKINGNQLRGVWRRRRTAQQTQTLPFSAQHGLAYRFVPDNKSATTNLTGKWATDFGSKSGKVDTV
    NAVGVFDQKGNRLAGTFLTPTGDYRYLDGNVVGDSLFLSCFDGSHIYLFKAKHDPATKTLTGGHWAGVSGYEAWVARFDP
    AADLPDPAKLTYLKPGAKTLNFSFPEPGGKTVSTTDPRFKNKVTIVQIMGSW
    CPNCMDETNFLSPWYKRNKQRGVEVVGL
    AFERSAEMSESGPKIERMKQRFQIDYPVALAGTNDKAQASKALPDLNAVVAFPTTIFIDKKGQVRHIHTGFSGPGTGKYY
    DQYVEEFNRLVDKLLAEPGF

    >gi|284039303|ref|YP_003389233.1| hypothetical protein Slin_4453 [Spirosoma linguale DSM 74]
    MRHTRLLIVGFVWLGCLAVQAQIKPQTGFWRGVFTMAGGHTAPFNLELTGKTAYLLNGTERFELKNVTQRGDSLIIPVDV
    YNTVLAAKVEDAKTLSGVFKHLESPTTGVPFRMEHGKRYRFVENQAAPVVSMHGKWDILIDEKIKLIGVFEQHGSKLTGT
    FLSTGGDMRYYEGSVQNDEFALSAFDGSNPQLFIGKISGNELSGSFVNSRQVRSLKGTRNAQAALPDAYSLTKMREGIPF
    TFTFPDGFTGKLVSLSDPKYKNKVVIVTTMGSW
    CHNCMDEAAFLAPWYKANKDRGVEIIGLAFEVKNDPVFAKARLETVK
    KRYQIGYDMLFAGIADEKHASAVLPALSEMSVYPTTIYVRRNGEVAKVHTGYSGPATGQYYEAFIKEFNAEMDQLLNEPI
    SDRAPGKAN

    >gi|284039336|ref|YP_003389266.1| Thioredoxin-related protein-like protein [Spirosoma linguale DSM 74]
    MNRLLLFFAAFVLLTISAFRTTLPTESAIITPPNETKHIKWLTIQEAYALTQKKPKKFVVDVYTDWCGWCKVMDRETFSK
    PAIVDYVNENFYAVRFNAEQTADVTLGKQTFKYISGGSRGVHELAAALLKNQMSYPTTVFLDEKFNLIQPIPGYLEPRTF
    HQIITYFGKNYHQKEPFDQYKTGSYKEFQSSLTAGR

    >gi|284039516|ref|YP_003389446.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKLSYFTPIVLFTVISLASCQSRSGEQDYVVEGDLKNAYPFLEGKMIYLGNTATRDLEDSARVTNGKFRLALADQSTKYP
    LQVALVYKPSEPNQPYATIGYSNPFKKNTTEDNFYLEPGVTQLEPDTTAHARQLIARLARLNKRSILTRFVEVKPQTRVA
    FMHLSFLPNETQQPDKQKHNESQVRKYPSSIYLLGELYRNRTSLSEAEISRLLSLFDPSLNEIDVYKTLVAYTTNPAPTG
    DDFPASVSLMKPDHSFTSSVLSSDKHTLVVFWASW
    CGPCRQEIPQLKALYTKHKDKLNIVSISTDQQEERWQKAMQKEQM
    PWPQLVADNPSSFVQLDKKYDLKLIPVCLLFGPDHKLVKRYEGRGEGENSVDYQVSNLLNQ

    >gi|284039544|ref|YP_003389474.1| Rhodanese domain protein [Spirosoma linguale DSM 74]
    MKLRLLLLLFLASASLSSYAQKASAKSANDQYVCLPCGSDCDHAVLDGPGSCPHCGMRLVLKKSVVFTNISPAELCKTVA
    ARPNVILLDVRTPDEFAGRARENFGRLKNAINIPVQELESRLSELNGAKNKEIIVY
    CSHSHRSPRASHILTENGFTDVKN
    MTGGMSVWNESVGQLPLGKALLVK

    >gi|284039624|ref|YP_003389554.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKRFFLTALLLSPSMLWAQTGTYTLNGKLAGVKAPAKAYLRYMESGTAKMDSAQIQNGVFAFSGKVVTPMQATLFVDKLG
    TGFSRNRPIAATAVYLEPGTITLGSPDSLENALVSGTPLNADLQKLTTLLKPASTNMAQLMKEYRSASPEQRKSKEFEES
    LDKRYEAIEAEQKKAKRQFILANPNSLVSLNTLQQYDYAPDYKEVGPMFDGLSESLKTSETGKAYAKTLAIAKATSVGAM
    APEFTQADTAGRAVSLSSFQGKYVLVDFWASW
    CGPCRQENPNVVKNFHQYKDKNFTVLGVSLDRPTAKEAWLKAIHKDGL
    DWTQVSDLKFWDNEVAKKYGVRAIPQNFLIGPDGKIVAKNVRGEALGKKLEEILAAKP

    >gi|284039762|ref|YP_003389692.1| protein of unknown function DUF1573 [Spirosoma linguale DSM 74]
    MKKIFSLFVALFVFVAVGYAQKGVLKFTKETHDFGKVEQGKPVTHVFEFKNTGTDPVVINDAQASCGCTKPSFSREPIMP
    GKTGSISATYNAAAAGPFNKSVTVTSNAESGQSVLYLKGEVVSAAAVETAATPAPAPAAKDKKKSTKTSR

    >gi|284039820|ref|YP_003389750.1| cytochrome c biogenesis protein transmembrane region [Spirosoma linguale DSM 74]
    MKSISTLVVWLLVSLTALAQIRKDPTSWSAKVDKQPAQVGDVISVRIQVSIDQNWHVYSNDLDPNIGPLPTTFKFPASDA
    YTLVGKVTPVGVQEVYEEVWGAKVRQFENKAVFVQKVKLLKPTATFSGTAEYMSCSSKDGTCLPPAEADFSVAINASSAA
    TAPASPTVASAPTTASVVTSPVSETAVAATTPVETETKAASLTDAQIDSSVSKALTPPDANVEEGTPATSGSLWSFMLAA
    FLSGLVALLTPCVFPIIPATVSFFTNQQGGQWKALLYGAFIIGIYVLIGTVVSRFNGPAFANFVSTHWLPNILFFAIFFI
    FGLSFLGLFEIVLPNSLINKADAKSEQGGIAGIFFMAFTLVLVSFSCTGPIVGSLLVASAGGEVVKPILGMAAFSSAFAI
    PFTLFAAFPQWLKNLPRSGGWLNSVKVVLGFLELALALKFLSIADQVYHWGLLDREVFLSLWIVIFALIGFYFLGKLRLP
    HDSETKYISVQKLLLAIVTLSFVVYMIPGLWGAPLKALSGYLPPETSQDFNLTNAQVAASPANALGETPKYANLFHLPHG
    LQGFFDYKQALAYSKKVNKPIFIDFTGHG
    CVNCREMEARVWSDPAVMSRLQNDFVILALYVDDKTELPEADWYTSTYDQK
    VKKTIGAQNADLQITKFNNNAQPHYCLVNSEGKLLVSPKNYDRDISHFVAFLDSGKAKF

    >gi|284039838|ref|YP_003389768.1| tRNA 2-selenouridine synthase [Spirosoma linguale DSM 74]
    MVRKLSVSEFLSKARTLPVIDVRSPGEYDHAHIPGAVSIPLFDNDERAQVGTKYKNAGKDAAVLMGLSMVGPKLADFVKQ
    SKKLNPQNKEVLVH
    CWRGGMRSGSFAWLLDTAGLTASTLVGGYKAYRNAVLDSFAQPLKLIILGGKTGSGKTDILKELAR
    QGEQIIDLEGLANHKGSSYGAIGQRPQPASEQFENLLFQTLLTLDTSRQIWLEDESRNIGSCFIPMALWQQMRAAPVAFI
    DLPKAKRVARLVTEYANIDHGLLVEATERIRKRLGGKVTQDALNALANHDYATVADLTLDYYDKAYLHGLSHRDPSTIQT
    IETAEDDPRETAKHLIEWVEKANATAAGASIHSMSSSS

    >gi|284040013|ref|YP_003389943.1| beta-lactamase domain protein [Spirosoma linguale DSM 74]
    MIIEQLYTGCLAQGAYYIESNGEAAIIDPLRETSPYIRKSNKAGARIKYVFETHFHADFVSGHIDLAQKTGATIVYGPNA
    NTTYEAYHAEDGETFALGHVTIKVLHTPGHTLESTTYLLIDETGKDHAIFTGDTLFIGDVGRPDLAIKGDLTEHDLAGML
    YDSLQTKIMPLADDVIVYPAHGAGSACGKNMSKETTDRLGNQKRFNYALRTKSREEFIEKVLDGLTTAPAYFAENARLNK
    EGYESIDRVLQRGSQTFSPDAFEAAVNETGALILDVREAADFAKGFIPNAINIGLNGQFAPWVGALIPDLTQPIALVAPE
    GQEGETVLRLARVGYDNCIGFLEGGFGAWQKAGKEVDQIDSISAEEFSNRWQQNPHIPIVDVRKPTEFAAEHVAGASPVS
    LDNINDHMADIPRHEPVYVH
    CAGGYRSMVANSILKARGFDNVINVEGGLAAIRKTAVTVTSGASVI

    >gi|284040175|ref|YP_003390105.1| peptide methionine sulfoxide reductase [Spirosoma linguale DSM 74]
    MVAITLRKLTASLLTALSTALGRGPGRLSAKPTKQTPMTTDQSANLAKATFGTGCFWCTEALYESLDGVIGAVSGYEGGH
    KANPTYKEVCTGTTGHAECVEVTYDPAKITYQELLEAFFRSHDPTSLNRQGEDVGTQYRSVIFYHNDEQKELAETAKVEL
    DKSGAYDRPIVTEISPAETFYEAEAYHQSYFANNPNQGYCAFVIAPKVDKFKKVFKEKLKRENAY

    >gi|284040299|ref|YP_003390229.1| methionine-R-sulfoxide reductase [Spirosoma linguale DSM 74]
    MIQKVIKTDEQWRQLLTPEQYRVARGKGTERAFSGEYCEAHDPGLYACVCCGTELFESTTKFESGTGWPSFTEPIEQERV
    RLEKDYSYGMSRVEVLCNICDAHLGHVFNDGPPPGGLRY
    CLNSVSLVLKRAADAE

    >gi|284040586|ref|YP_003390516.1| dihydrolipoamide dehydrogenase [Spirosoma linguale DSM 74]
    MASQYDVIVVGSGPGGYVAAIRASQLGLKTAVIERESLGGICLNWGCIPTKALLKSAQVFEYIKHSADYGITISGESKAD
    FGAVIKRSRGVAESMSKGVQFLMKKNKIDVISGFGKVKSGKKVEVKAADGTVTTYDAKHIIIATGSRARQLPNVPIDGNK
    VIEYRKAMSLEKRPDSLLVIGSGAIGVEFAYVYASMGTKVTIVEFLPNVVPIEDEDISKELAKQYKKLGIDIYTKSEVTK
    VDTSGNGCKVFVKTPDGEKTFDVDIVLSAAGIVANIENIGLEELGISVDRGKIVTDDYYRTNVEGFYAIGDVTKGQALAH
    VASAEAIICVEKIAGLSHVEPLNYNNIPGCTYCTPEIASVGYTEKAAREAGYELKVGKFPFSASGKAKAGGVPEGFVKVI
    FDAKYGEFLGAHFIGSNVTEMIAEVVTARKLETTGEEILKAVHPHPTMSEAIKDATEAAYGEAIHL

    >gi|284040656|ref|YP_003390586.1| iron-sulfur cluster assembly accessory protein [Spirosoma linguale DSM 74]
    MVTVSDIAKNKIVELRQKDGLAEDTAIRVAVEGGGCSGLMYDLQFDATQQPTDHLVEDKGIKILVDRKSLLYLAGTELDF
    SDGLNGKGFQFKNPNATRTCGCGESFAV

    >gi|284040772|ref|YP_003390702.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Spirosoma linguale DSM 74]
    MIADYTEAPVCHIDDLADGDLKEVRVGDTDVLLARANGQFYALHPKCSHYQGPLAKGLLNGHRLVCPWHNACFDIRDGHR
    LEAPALNGLPTHEVRIEGDQVFVRLTTDKESLENPMSAPDTANSETYVIIGSGGAGAFAAEGIREGGFTGKIVMLTASGE
    APYDRPN
    CSKDYLQGEAPDEWMALRPEEFYKSYGIEIRTNQPVTALNPITKQIELASGEIIGYDKALLCTGGKPNKLPAV
    DLALKGVYTLRSLHDSQTLRDLGKQGKRVVIVGSSFIGLEGAMSLRKLGSEVDVVGPETTPFEKILGARIGRVIQGWHEA
    AGIRFHLGRRLDHLEGEETVNAVVLDNGERLPADFVLIGAGVKPRTDFLKGIPVEKDGGVRTDEYLKITDGLYAAGDIVH
    YPTSDGIQRIEHWKVAGQQGHVAGLNMAGKETPYQMAPFFWTNQQGKRINYVGHTTQVDDILYDGNPETDESFLAFYVQN
    NQIKAVAGLKRDQDIIAIRELMQAGKMPSVEAARNGIKWVDELKKA

    >gi|284040788|ref|YP_003390718.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKNLFFNVASLLAFSLTVNAQATKSFTVTGKVNKATPGSYVYLETNSQPTHKLDSTKLAAGNTFTINGKVADGGEVFVLN
    VGGGQKMALLVEGGETLNVVADGYRMDAKTGQTGQATVTGSKNMEYYNKLNTLRTDMEAKVAVWNKQVAAATEKKDNKRI
    SQIEQEYQTAEQDVVNKVKAMLPEMGTSLVSLFALNFINIDTDFATYESLAQRFEKENPNSPHAKSLIGRVARIKGVSVG
    APAPEIALNDTTGTPVPLSSLRGKYVLLDFWASW
    CGPCRAENPNVVRMYNKFKDKGFAIYSVSLDQAKANWTKAIRNDNL
    TWTHVSDLKFWQSAAAQQYGVQAIPATFLLDKEGKIIAKNLRGDALEQKLEEILKGGQ

    >gi|284040854|ref|YP_003390784.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MKSFISWFCTATLILQSTLAIRAQSPKGYSLGDVVADFRLRNVDSRQITLADYKDQRGVIVVFMSNHCPFAKAYEDRLIS
    LDRKFATQGYPVLAVMPNDPKAYDDDSFQNMQSRSREKNYPFAYAMDETQVTAKAFGATRTPEVFVLKQTGGQFIVEYVG
    TIDDSPQDGSSVQRRYIDEAVSSLLAGKPVQSPITKPIGCAIKWKN

    >gi|284040866|ref|YP_003390796.1| dihydrolipoamide dehydrogenase [Spirosoma linguale DSM 74]
    MEYDVIVIGSGPGGYTGAIRCAQLGLKTAIIEKYPSLGGTCLNVGCIPSKALLDSSEHYYNAAHTFAEHGIKLADLQVDL
    AQMITRKASVVEQTTKGIAFLMKKNKIDELHGVGSFVDPHTIKITKDDGSEQIIKGKNIVIATGSKPMSFPSMPIDKKRV
    ITSTEALTLQEIPKHMIVIGAGVIGAELGSVYARIGSKVSFVEFADSMIPTMDKTMGKELQKSIKKLGADFYFSHKVTKV
    ENTGEEVIVNVDTPKGEQITLTGDYCLVSVGRRPYTDGLNLEAAGLKTDDRGKLEVDNHLRTSVPHIYALGDVIRGAMLA
    HKAEEEGTFIAETIVGQKPHIHYRLIPGVVYTWPEVASVGYTEEEVKKEGIPYKVGSFPFKALGRARASMDVDGLVKVLA
    HKETDEILGVHMIGARAADMIAEAVVAMEFRASAEDVSRMSHAHPTYTEAFKEACLAATDNRAINM

    >gi|284041005|ref|YP_003390935.1| beta-lactamase domain protein [Spirosoma linguale DSM 74]
    MTIEQMYTGCLAEAAYYIESAGEAAIIDPLRETKPYLDRARADGAVIKYIFETHFHADFVSGHLDLAAKTGATIVFGPTA
    QPGYKACVARDGEEFRVGKVKIRVLHTPGHTLESSTFLLLDEAGKETAIFTGDTLFIGDVGRPDLAVKTDLTRDDLAGYL
    YDSLHTKIMTLPDDVIVYPGHGAGSACGKNMSKETTDTLGNQKRFNYALRAQSKEAFVKEVTNGLVPPPQYFPKNAVMNK
    MGYNSLDAVMQQGTLALSPAAFEVAANATNALILDVRDASVFAKGFIPNAINIGLEGQFAGWVGTLIPDLKQPILLVVPE
    DKTEEAVLRLARVGYDNCIGYLNGGFEAWQADGREVDAIRSISAEAFANLFEQTPDLPVLDVRRKSEYDSEHIVGVENLP
    LDFINENVARIDKHKTYYVH
    CAGGYRSMIAISILNARGFTDLIDVAGGLMALKHTNRLPLTNYVCPKTLL

    >gi|284041051|ref|YP_003390981.1| alkylhydroperoxidase like protein, AhpD family [Spirosoma linguale DSM 74]
    MLHVTVPTRDQVSPQSQAAFDGLQKMLGFVPNLYATIAHSENGLPRYLAFQGAKTSLSNKEKEVVNLVVSEVNGCNYCLS
    AHTAIAKMNGFSDDDILHLRAGHSANPKINALVVLAKDITENKGRVSSENLDTFYAAGYTQGNLVDVILQVSDKTAMNYL
    HNLTEVPIDFPLAPALTEA

    >gi|284041156|ref|YP_003391086.1| protein of unknown function DUF1573 [Spirosoma linguale DSM 74]
    MHLKNWLLITAFAGLSFGQISCDNRQQGQASKETASTKMPKITFEEKGIYDFGTLTEGDTVEHVFAFTNTGEFPLIINNI
    TAS
    CGCTTPEWPREPVAPGAKSSVRVRFNSRGKSGQQNKTITIFANTEPSMTDLQFKALVNPKSETTKTS

    >gi|284041210|ref|YP_003391140.1| thioredoxin [Spirosoma linguale DSM 74]
    MNKQSFKDLINGDKPVLVDFYADWCGPCKQQAPILKQLTERSGDKVRVVKIDVDKAQAAAQQYQIRSIPTMIMFKDGKIV
    WRQSGVQPLHTLEGLVKQFSS

    >gi|284041402|ref|YP_003391332.1| UBA/THIF-type NAD/FAD binding protein [Spirosoma linguale DSM 74]
    MTNGELNRYSRHISLPEIGLAGQQRLKQARVALVGVGGLGCPAGQYLTAAGIGTLGIIDGDVVEESNLQRQILFSPEHIG
    QPKATVAATLLSRQNPYSQVVAHPVFLTSTNALSILSDYDIIVDGSDNFATRYLVNDACVILRKPLVFGSIYKFDGQVSV
    FNHADGPTYRCLYPEPSELAA
    CAEVGVLGVLPGLTGCLMASEVIKLVTGVGDLLSGTLLVFNALTLSFNTFSFTADPANK
    LISALTPSAPDCVMPVLEITASDWLAQTNRPFLVDVREPQEYERENLGGQLLPLAELYQHPERVPNDQPVVIH
    CQSGARS
    RQAVAFLLTKGYQNVFSLQGGLNALNRL

    >gi|284041422|ref|YP_003391352.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirosoma linguale DSM 74]
    MIRLYRLIVLVLTIISCQTTVETQLPDVKANLFKAGTIDLQVATQNKVTLLTIWSIFCGPCLKELPELQTVYDRYKLNKR
    VTVLTLALNTNQELNRFLSTSDSADIYRKIFVHSGLKQLTLPILVGTTSPYQIENGSARLSDTKAADHLKRIFKFDAIPT
    TRIYDQGGKLIFEQKGVETSALGLRRYRLNLIKKLDSLATHH

    >gi|284005580|ref|YP_003391400.1| copper-translocating P-type ATPase [Spirosoma linguale DSM 74]
    MMTQPITAPAKSATRGELTRQTFPVLEMTCAACAVSVESMLSHTPGIAKAAVNYANQSASVEYDAKLITPAGMQQVIQSI
    GYDLVVDVDDPQQVQQEAQQRQYESLKKRTLWAGILSVPVVVLGMFFMNAPSANWIMMALSAPVVFWLGRSYFVNAWKQA
    RHGKTNMDTLVALSTGIAFLFSAFNTFYPQFWHSRGLHPHVYFEAAAVVIAFISLGKLLEERAKSNTGSAIKKLMGLQPK
    TVRVVEGDTDRELPIALVRVGQVIVVRPGEKIPVDGVVESGNSFVDESMISGEPVPVEKRPGGLVFAGTINQKGAFRFKA
    QKVGGETVLAQIIRMVQEAQGSKAPVQKLVDKIAGIFVPVVIGIAILTFGAWMLLGGENAFTHALLTSVTVLVIACPCAL
    GLATPTAIMVGVGKGADNNILIKDAESLELGYKVNAVVLDKTGTITEGKPTVTDLAWQVSDGEVANLLPILYALESQSEH
    PLADAVVERLRGNGISGTALEEFESLTGRGVSGRYGNTTYAVGNARLLTERGVGVDRAVQLLATGWQNEAKTVVYFADQT
    RVLAVLAIADPVKETSREAIHTLRKRGIAVYMMTGDNAQTAEAVAKAVGLSDFRAEALSADKAAFVKELQQQGKVVAMIG
    DGINDSQALAQADVSIAMGRGSDIAMDVAKMTLITSDLNSVPKALQLSRKTVQTIRQNLFWAFIYNLIGIPIAAGLLYPV
    NGFLLNPMIAGAAMALSSVSVVTNSLRLRATKL

    >gi|284005677|ref|YP_003391497.1| Heavy metal transport/detoxification protein [Spirosoma linguale DSM 74]
    MKLAGLTGLLTAFVSSLCCTAPLLTLLVGATGSAGGWAWLEPLRPYSIALTVGALGWAWYEQLKPKKTMACNCETKKTAF
    WQTKPFLGLMTGMALLLLAFPSYSNWLYQDKNQATVQPAQKGSGQVAYVTIKGMS
    CEGCEQHIKQEVTKIKGVSAVDVSY
    QKGAATVKYDSKKTSLADIKKAVDATGYKVTSTKTL

    >gi|284005817|ref|YP_003391636.1| copper-translocating P-type ATPase [Spirosoma linguale DSM 74]
    MNTPTIAPEKPVRSAGATTRQTFPVLEMTCAACAVSVESMLNNTPGVAKAAVNYANQSATVDYNPKAITPQGMQQVLQSI
    GYDLVVDVEDPQQVQQEAQQRHYEAVKQRTLWAGILSVPVVIIGMFFMNASYANYIMMALSAPVVFWLGRSYFINAWKQG
    RHGKANMDTLVALSTGIAFLFSAFNTLYPEFWHSRGLHPHVYFEAAAVVIAFISLGKLLEERAKSNTSSALKKLMGLQPK
    TVRIIEDNTERNVPIASVRVGQLIMVRPGEKIPVDGRVESGQSYVDESMISGEPVPVNKQAGEAVFAGTINQKGSFRFRA
    DKVGGDTILAQIIRMVQEAQGSKAPVQKLVDKIAGIFVPVVIGIALLTFAAWMLLGGENAFTHALLTSVTVLVIACPCAL
    GLATPTAIMVGVGKGAENNILIKDAESLELGYKVNAVILDKTGTITEGKPTVTDLAWQVGDDEVARLLPILYALEAQSEH
    PLAQAVVDRLKQADVRDLSLDGFESLTGLGITGRYNGQTYWVGNRRLMAEQGQLDQLTNVNGLVSRWQDEAKTVVYFADQ
    TRILAILAIADPVKQTSREAIHTLRKRGIAVYMMTGDNKQTAQAVAKAVGVNDYRAEALPADKAAFVKALQAQGKVVAMV
    GDGINDSQALAQADVSIAMGRGSDIAMDVAKMTLITSDLNSVPKALHLSKKTVQAIRQNLFWAFIYNVIGIPIAAGLLYP
    VNGFLLNPMIAGAAMALSSVSVVTNSLRLRSAKL

    >gi|284005857|ref|YP_003391676.1| beta-lactamase domain protein [Spirosoma linguale DSM 74]
    MKIEQIYTGCLSQGTYYIESNGEAAVIDPLREVASYLEKAHSDGATIKYVFETHLHADFVSGHLDLARQAGAPIIYGPNA
    QTGFESYSARAGEEFPLGALTIQVLHTPGHTIESSCYLLLDADRLPIALFSGDTLFIGDVGRPDLAQGSALTTLDLAGML
    FDSLRTQIMPLPDNVVIYPAHGAGSACGKSMSKETSDTLGNQKRVNYALRADMSRLEFIQEVTDGLAKPPPYFPENVRMN
    REGYEQIDRVLKRGAQPLSPQAFEAAANQTGALLLDTRDAQLFATGFVPNAINIGLNGQFAPWVGALIPDVRQPILLITE
    AGKAAESLVRLARVGYDQVIGYLDGGLNAWINAGHEVDYIPSLSADEVATRLALDELTLVDVRKPGEFAAEHIDGAINLP
    LDTLNDRMAEIPKEGSVYVH
    CAGGYRSMMALSILKARGFDNLIDIAGGFAAMQQTGRFNTTNFVCPATQQ

    >gi|284005859|ref|YP_003391678.1| protein of unknown function DUF395 YeeE/YedE [Spirosoma linguale DSM 74]
    MEFLHIIRQPWPWYVAGPLIGFTVPTLLLMGNKSFGISSSLRHICAACLPANISFFHYDWKKEAWNLFFVAGVLLGGFIA
    TRFLANPDSMRLAPRTVVALQALGIRDFSGLMPADLFALSNLFTLKGLFFSVIGGLMVGFGTRWAGG
    CTSGHAIMGLSNL
    QWPSLVATICFMVGGFVMTHLLLPFIFAWVN

    >gi|284005935|ref|YP_003391753.1| Thioredoxin domain protein [Spirosoma linguale DSM 74]
    MLRHLFLRGLMVGLITLLYTQTVYAITFFQGSLQEAHQKSKQEHKRLLIYFTAKWCGPCRYMEKEVFNTDSVTQITDAQF
    VALKVDYDAWNTKPIVEKYRVASLPSFVIVDSLDAVEKRALGRVTTAEFIRFLAPTTVQVVERPIFELRSDEQRYTQRQL
    METKGQLELGLQAGVNLTPVSSLTISHQLGYDISLLLIWTKRRMSIRSGLSLVSIGAKSDDGQPLRFHYVAFPVNLSYLL
    RKTVVLGLPGGYRANLTPYICRLINNPDLAVSSLDYGTKLGLSAFVGSTSRLEAQLGYQLGMKDIGGPSSFNLYNRGLYF
    CVTFIL

    >gi|284035579|ref|YP_003385509.1| alkylhydroperoxidase like protein, AhpD family [Spirosoma linguale DSM 74]
    MTTTQNETVVSLLNLVGLNAEGTYPALDALAQADHRYLRDLKINVGNVLNNSQTLTKKETLLLALSVAVNEKHQPLMDSL
    TDAARQEGATTAELAETIACTSLLSTNNVFYRFRHFISKDYYQQTQPGIRMSIMMNPVLGKEFFELMSLAVSAVNGCEL
    C
    VRSHEESVLKHGSSEPRIFDAIRLASVIKGLITLL