Spirochaeta thermophila DSM 6192 uid53037

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|307717790|ref|YP_003873322.1| hypothetical protein STHERM_c00730 [Spirochaeta thermophila DSM 6192]
    MYYRTMGRTGVEVSALGFGCMRFPTKGGDGSRIDETQAERMLLYAIEHGVNYLDTAWPYHGGRSEPFVGNVLERHGLRDR
    VFLATKMPMWEVKTGADLDRIFDEQRRRLKTDYVDFYLLHSLNKENWRRVEASGALEWIQKKKEEGAIRFIGFSFHDEIS
    EFKRYVDALGEGWDFCQIQYNYMNEYEQAGTEGLNYAVERGLGVVVMEPLLGGYLAGRIPRLEPVWAQSGRPWSPVEWAL
    RWLWNNPKISLVLSGMSTIEQVEENVRIASTEGGAPGNLPPEDLEVIVRVREVLESSKVIPCTSCNY
    CQPCPHDVEIPRI
    FKIYNDAEIFGNVGNARGAYRWIPEGHRASDCVACGECETKCPQQIEIIDWLKKAGELLEV

    >gi|307717815|ref|YP_003873347.1| peroxiredoxin bcp [Spirochaeta thermophila DSM 6192]
    MLREGEKAPAFTLPDDNGEVRDLSDFADKKKVIYFYPRDNTPGCTKEACGFRDMYETILATGAVVIGISPDSVRSHASFK
    TRYDLPFFLLSDPEKKVIRAYGALTVRKVKGEEKERVRRCTYIIDEHDVIRAVFPDVRPEEHAREVLEILSRME

    >gi|307717844|ref|YP_003873376.1| thioredoxin [Spirochaeta thermophila DSM 6192]
    MTHKLTTEDFKEKVFDYENETEWKYKGEVPAIIDFYADWCGPCKMVAPILEEIADEYEGKLVVYKVNTDEEQELAMVFGI
    QSIPSILFIPVEEQPQLAVGAIPREVFDQAIKEVLHVE

    >gi|307717881|ref|YP_003873413.1| hypothetical protein STHERM_c01640 [Spirochaeta thermophila DSM 6192]
    MAAKVTARHTGDMAFDVEVDGHTLTVDAHPEFGGKDAGPRPKNLLLAGLAGCTGMDVVSILGKMRMPYDSFTLHIEADLS
    EEHPKVFTRIHLVYAFTGDALDREKIEKAVRLSQEKY
    CGVSAMLGKTARITYEIRLDG

    >gi|307717882|ref|YP_003873414.1| hypothetical protein STHERM_c01650 [Spirochaeta thermophila DSM 6192]
    MKVVLYTTPTCAYCKMAKDYFRKNRIPFVEYNVAQDMRRAEEMVRKSGQMGVPVIDINGKVIVGFNLPEIERALRSA

    >gi|307717901|ref|YP_003873433.1| thioredoxin [Spirochaeta thermophila DSM 6192]
    MSLHVKTADFEKEVLQADIPVLVDFWAEWCMPCRMVSPILDELAEEYAGKLKVVKVNVDEEPDLASRFGIVSIPTILLFK
    NGQVAAQQIGAAPRQVFEQMIQPHLG

    >gi|307717948|ref|YP_003873480.1| methylated-DNA-[protein]-cysteine S-methyltransferase, active site [Spirochaeta thermophila DSM 6192]
    MVLEGKRTDAWRDRRVWYGTAECGLGWVLAAATERGVCRVAFGEGEGELVGLLVREFAGALLEEGGEGFREGVLAGVLEA
    VEEPGGEVGMDVDLVGTPFQLAVWDALRGIPAGQVRTYGEVARAVGRPGAARAVGAACGANRVAVLVP
    CHRVVGAGGSLG
    GYRWGVWRKRVLLEREGWRG

    >gi|307717984|ref|YP_003873516.1| peroxiredoxin [Spirochaeta thermophila DSM 6192]
    MYQQETGRFPLIGEAFPEMEVQTTHGPKRLPSDYKGKWVVLFSHPADFTPVCTTEFVAFAKRYDQFKELNAELVGLSIDQ
    VFSHIKWVEWIEEKLGVQIPFPIIADDQGRVAQRLGMLHLEAGSNTVRAVFLIDPEGTVRLVLYYPPEVGRNIDEVVRVI
    RAFQLSDKLKVAIPANWPNNELIGDKVIVPPPTSQKEAKERLKKYEGYDWWFCYRDA

    >gi|307718028|ref|YP_003873560.1| Na(+)-translocating NADH-quinone reductase subunit D [Spirochaeta thermophila DSM 6192]
    MAATPRRILAENTWTNNPIFIQILGICSTLAVTNNLTNTLIMTLGVTFVTGFSSLTVSLLKTLIPHRVRMITQTLIISFY
    VIIVDILLKAYLPEIHKSLGPYVGLIITN
    CIIMGRAEAFAQSNPPLLSLWDGLTSGLGYMWVLMLIALIRELLGFGTLFN
    IRVLPEGFEPWTIMVMAPSAFFILAMVLWAAKTLMNKEAA

    >gi|307718029|ref|YP_003873561.1| hypothetical protein STHERM_c03150 [Spirochaeta thermophila DSM 6192]
    MTPDISPLALFVASIFTSNILLANFLGMCSFISISKDLSSSNGLGLAVTVVLTITSAINWLVLHYVLIPLDLVYLRFIVF
    IIVIAAVVQILEMIIDRISPSLYMALGIFLPLITVN
    CAILGVALFIEIRGYSLLQSVVYGLGSGLGWWLAIMLLAAIRKK
    IERAPVPAGLKGPGITLITIGFMAMAFIGFSGMVAVQ

    >gi|307718380|ref|YP_003873912.1| hypothetical protein STHERM_c06810 [Spirochaeta thermophila DSM 6192]
    MDVSARLAEIDREIESLKARLAEVKGRETEIYTRIVGYYRSLKNWNKGKKEEYRHRKTFEVGLSFDTFRTRERREADEIL
    YFYRKA
    CPYCPAMRQALEEAGISYRAVDVDTAEGQSLAERYGVLGTPTVLLLDGKGKEVGRTTSPEELKDLLKGAAAVA

    >gi|307718383|ref|YP_003873915.1| hypothetical protein STHERM_c06840 [Spirochaeta thermophila DSM 6192]
    MVYPWRCEVNIIIYGTRKCRNTQKALRFFKERRIPVQFFDLTERPFSPGEARKIAQALGDDVIDTESRLYRERLAFMEVS
    PEELLLEYPGAVRTPVVREGARITAGYVPEVWSSWLA

    >gi|307718451|ref|YP_003873983.1| thioredoxin reductase [Spirochaeta thermophila DSM 6192]
    MTPDRDVIIVGAGPAGLAAAQYAARAALDTLVIEQMAPGGQALIIDTLENYPGFPEPISGFELAQRFETQARNFGASFLN
    ATVKRISKKEKVFEVETTKGVLTSYAVILASGAAHRKLGIPGEKEYTGRGVSY
    CATCDGPFFKGKRMLVVGGGDAACDEA
    MYLSKLTDKIVHIHRRDRFRAQKALAQRVLNNPHIEVRFNTVAVEIRGEEVNGVKKVSSVLLKRVDTGETYEEPIDAVFI
    FIGSDPQTGFVEGVEKDESGYIITNQEMMSSIPGLFAAGDVRNTPFRQIVVGAGEGAVAAHCAAKYIDELKGEAYE

    >gi|307718551|ref|YP_003874083.1| hypothetical protein STHERM_c08610 [Spirochaeta thermophila DSM 6192]
    MCGPERLDFFGHKYHIFSIFSLEEVFMRWWAMVLVLSLATMGCSAQQSESQKQAPGLGQKALERVSVSLEESLEGYLARA
    GFSTPSTPVPAPDFMLPLLEGGQVSLSDYRGKVVLLNFWATW
    CPPCRMEMPSIETMVRALKGEEVVFLAVDVQEQKSQVS
    SFIKENGYTFPVLLDATGQVARMYAVSGIPTTYFIDKEGNVRGKLVGARNWDAQVVYEAIKRALAE

    >gi|307718826|ref|YP_003874358.1| redox-active disulfide protein 2 [Spirochaeta thermophila DSM 6192]
    MKMKIQILGMGCPKCQKLTERAEQAARELGLSYELVKVTDPQEIMSFGVMMTPALAVNGKVKLEGKVPEVEEVKKLLQHV


    >gi|307718968|ref|YP_003874500.1| transporter [Spirochaeta thermophila DSM 6192]
    MKQNLLKGFFKENPVFVLLLGMCPTLGVTNSAINGLGMGLATAAVLIGSNTVVSLIRDFIPDKVRIPSFIVVIATFVTII
    DLVMAAFVPELHESLGLFIPLIVVN
    CIILGRAEAFASKHGVGASFIDGLSMGLGFTFALTILGSVREILGSGSIFGLSFV
    PEGASTVLLFVMPPGAFIALGLLIPSMNALRDKLSRKEA

    >gi|307718969|ref|YP_003874501.1| transporter [Spirochaeta thermophila DSM 6192]
    MEYIAIIFGAIFVNNIIFAQFLGICPFLGVSSRLSTATGMGAAVLFVMTLSTLVTYLIHDLVLMPLGLHFLVTVAFILVI
    ASLVQFVEIVLKKIAPPLYQALGIFLPLITTN
    CAILGVALLVLQKGFSFTESVVFAAATALGFTLALVLMAGIRERLELA
    DVPKRMQGGPITLITAGLLSLAFMGFSGMM

    >gi|307719170|ref|YP_003874702.1| dihydrolipoyl dehydrogenase [Spirochaeta thermophila DSM 6192]
    MSYQYDLVVLGSGPGGYVAAIRASQLGLKTAVVEKDKLGGVCLNIGCIPSKALIHMATLYRQAQETLSRTGVKVDTSGFD
    YEKVFSYSRQVADRLSKGVQFLLKKNKVDVITGEGVLEDPHTVRVGDARYTGKYILVATGSSPRSIPGFEIDEEVVLSST
    GALMLKDLPPRIIILGGGAVGMEFAYIFNSFGVEVTVVEMLDQVLPFMDHEVVEVLVKEFAKRGITILTSTKATALKKTD
    AGVTLTVEGPEGSRELAAEKLLVSIGRAPNTRGIGLEEIGVQLDERGFVKVGDYYQTAVEGVYAIGDILPTPQLAHVASK
    EGEIAVLHMAGRPKEKVLPQEEIPSAVYTEPQVAGFGLTEKEAKEKGLSYKTAVFPFRGVGKAVAVGEADGFVKLLYDPE
    TEEILGAFIVGPEATELVHELLLAKRSELLLDDISHMVHAHPSLSEGVMEAARMAQGWAIHV

    >gi|307719180|ref|YP_003874712.1| heavy metal-binding protein [Spirochaeta thermophila DSM 6192]
    MAGLFSSLKEGLRRWIDSLARENTRTFGTAGTLDCCNLPGKQPGSSSAAKKRRLPTEEAAVPAGEYDEYLQAYQSITTGG
    SGMATTIRLMIEGMT
    CDHCVMSVKSALVKQEGVKDAKVRIGSAEVEVEGQVDPQALVKAVEEAGYTAKIAS

    >gi|307719181|ref|YP_003874713.1| transporter [Spirochaeta thermophila DSM 6192]
    MAERTREMRGVRPLVLDIEGMSCTSCAQRVKKALFSREGVREAEVDFPSHRAKVVVEGAVAMEELLKAVEEAGYRARLAE
    VGEVAVKTYRVEGMS
    CTSCAQRVKRALEKVEGVQEAEVSFASGEARVVLEEEVPDEVLAHAVEEAGYRLLWEEEEDAEER
    YLRQERRRLLAAWLLTGPVAVLMVMRMFFGLSLLPGELTSWLELGIGGVVVLGLGWPILRSTWYAFRHLSFTMDSLIGIG
    ALASLATGVLRKAGVEIEDFSLVGAMILSIHLIGNYLKLVATGRASQAIRRLLELGAKVAHRIREDGQIEDVPVQALRKG
    DLVLVRPGEKIPSDGVIVEGHTAVDESIATGESVPVDRGPGDQVIGATVNQQGAITVRIEKVGKETFLSQVARMVQEAQA
    SKVPIQEFADRVTAVFVPVVLSISAATFVVWLLFPEALGEVVRWAAGFLPWVDPSRGVVSMALFAAIATLVIACPCALGL
    ATPTALMVGMGLGAEHGILIRSGKAIQIAQSVQDVVFDKTGTLTEGKPRVVGVWAPGGEEELARLLSAVESASEHPLARA
    VCAWAEERGAGGAQAQGVEAVPGKGVRGVVGGSVVLAGRQEWLEEEGVATEGFAGEAEAAYGRGETVVWVAQDGSLVGLV
    SLADTLKPSSKEAVEALKELGIRCIMLTGDNERAARAIASQVGIDEVRARLLPQDKIRVIRELQAQGRVVAMVGDGINDA
    PALTQADVGIAIGTGTDIAIESADITLVSENMLGVPRAIGLSRATFRKIRQNLFWAFFYNVIAIPIAVLGLLHPVIAEIA
    MAISSVNVVTNSLRLRRVRL

    >gi|307719191|ref|YP_003874723.1| hypothetical protein STHERM_c15100 [Spirochaeta thermophila DSM 6192]
    MKYLIVGGVAGGATTAARLRRLDEQAEIVIFERGRYISYANCGLPYYVGGVIPERERLFVQTPETFRAMFNVDVRVRSEV
    ITIDRARKEVTVRNLETGEEYRESYDKLVLSPGAEPIRPPIPGIGDERIFTLRSVDDTDAIVRFIEEKKPRRVVIVGAGF
    IGLEMAENFHSRELKVTIVELAPQVMNVLDFEMAAEVHQHLKTKNVAFFLGDAVSAFERTGDELRVRLKSGRTLVCDFVL
    LSIGVRPDSRLAKEAGLELGPRGGIKVNEYLQTSDPDIYAVGDAIEFPNPITGKSMPTYLAGPANKQGRIVANNIVEGNK
    YTYKGSIGTAIAKVFDLTVASTGMPEKVLKEEGIPHKAVIVHPGSHAGYYPGAQPMTIKLIFSPDDGRVLGAQIVGYEGV
    DKRIDLLASVIQRKGTVTELTEIEHAYAPPYSSAKDPVNIVGFVAENVLLGKSRHIHWYDILNAPQDEYFLVDVRTPEEY
    ALGTIEGAVNIPVQQLRARIAEIPRDRKVAVF
    CGVGFRAYVAERILRQHGYTEVYNLSGGYKTYQHVTQKQGNEDIFEGD
    VIEKDDILYQRGTGRQGVLEVRRLEVDACGLQCPGPIMRLKQAIDEASPGDRIVLKATDPGFARDVEAWCSMTGHTLVSL
    EQERGVITAVVEKAGPHGAQEQPAPQGEGATIICFSDNLDRALAAFVLAQGAASAGKKTTMFFTFWGLNIIKKRKKPRVR
    KDLMGRLFSWMLPSHSGKLGLSKMNFGGIGARMMRGRMKAKKIASLEEMREAALKAGVRIVACQMSMDVMGVTKEELIDG
    IEIGGVATYMEAASRSTINLFI

    >gi|307719306|ref|YP_003874838.1| hypothetical protein STHERM_c16250 [Spirochaeta thermophila DSM 6192]
    MNLREDQIYRYSRHILLPQVGGEGQERLLSGRVLVIGAGGLGSPVAYYLAAAGVGTVGLVDGDAVDLSNLQRQILHFTPD
    VGRPKVESAAEKLAALNPDVRVETYPYRVTAENIRSLIREYDFIIDGTDNFPAKFLINDACVMEGKPYSHAGVLRFQGQT
    FTYVPGHMCYRCVFRDMPPKGAVPT
    CAEAGVLGAVVGVLGTIQATEAVKYLLGVGELLTDRLLVFDALTSRFREVRVGRQ
    EECPLCGTSPEITELREYEQPACDLRERSSV

    >gi|307719607|ref|YP_003875139.1| thiol peroxidase [Spirochaeta thermophila DSM 6192]
    MATVTLKGEPIHTVGELPAPGQKAPDFLLTTVNLTDVTLADFRGKKKILNIVPSLDTGVCATSAKRFNEKVRGRADLVVL
    TISCDLPFAQDRFCKAEGIDNVITLSQLRNKEFGKAYGVEIADGPLAGLLARAVVVLNEHDTVVYTELVPEITREPNYDE
    ALRHV

    >gi|307719765|ref|YP_003875297.1| hypothetical protein STHERM_c20930 [Spirochaeta thermophila DSM 6192]
    MAYEFTRFEGRDVPYKVTVYGLSTCGFCRRAVEFLKEHEIPFDYLEVDLLPREERLSLKASLANEFEVRVGFPFLVVEWP
    EGRREFRVGFIRADWEDLLL