Spirochaeta smaragdinae DSM 11293 uid51369

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|302336565|ref|YP_003801771.1| methionine-R-sulfoxide reductase [Spirochaeta smaragdinae DSM 11293]
    MESSSKMPHGESEWRDKLGPERYYVCRMKGTEAPFSGKLWDEHRKGTYHCVGCGTPLFRSETKYDSGSGWPSFMDLIDQK
    RVERRTDSSHGMIRTELLCARCGCHLGHLFEDGPQPTGLRY
    CINSVSLKFIAATS

    >gi|302336863|ref|YP_003802069.1| glutaredoxin-like protein, YruB-family [Spirochaeta smaragdinae DSM 11293]
    MAITIYTTPSCGYCVKAKEYFRGRGVNFTEYNVAQNMQKAEEMVKKSGQMGVPVIDINGRIIIGFNQSEIERALHR

    >gi|302336871|ref|YP_003802077.1| Peroxiredoxin [Spirochaeta smaragdinae DSM 11293]
    MEHSFPLIGEAFPELEVQTTHGRKSLPGDYKGRWFVLFSHPADFTPVCTTEFVAFAKRADQFAKLDCDLIGLSIDQVFSH
    IKWIQWINEKLEVKIPFPVIADDRGLVAQQLGMIHPGKGTNTVRAVFIVDPKGIVRLVLYYPQEIGRNMDEVLRAVRALQ
    VADKNNVAIPAGWPENELIGDRVIIHPPADEKSAETRLSEHEGFDWWFCHKKL

    >gi|302336886|ref|YP_003802092.1| peptide methionine sulfoxide reductase [Spirochaeta smaragdinae DSM 11293]
    MREEVIVLGGGCFWCMEAIFRRVEGVLRVTNGYAGGRDPEPTYEKVSSGTTGYAEVVEIRFDADRLSLKDLLELFWKAHD
    PTTRDRQGADIGSQYRSVIFFTEPHQQIIARESMQELHDLGHYENPIVTELLPLSQFHPAEAYHQDYYARNSFAPYCRMV
    IAPKLNKLEANGTGS

    >gi|302337016|ref|YP_003802222.1| protein of unknown function DUF395 YeeE/YedE [Spirochaeta smaragdinae DSM 11293]
    MSDEKKPDQQSTGQSSIRRSTSSRSSGRSRKKKKNQLPIGIAVLAVVVLIAILLGMKNELLAFFWITGIAFGYILQRARF
    CFTAAMRDPMLTGGTSLTRAVLIAFAFTSIGFIAIKYGAFARGLPIPGQGYVVPVSFATVVGSFMFGIGMVIAGG
    CASGT
    LMRVGEGFLMQVLSLFFFVIGSLWGAHDFGWWKLHVIMKGKAIFLPDLFGWIGAVIIQLLVIVLLWIAADKWEKHKNA

    >gi|302337018|ref|YP_003802224.1| protein of unknown function DUF395 YeeE/YedE [Spirochaeta smaragdinae DSM 11293]
    MAIKDNEYYKKFLKEAWPYVTGAVLLSLFQIVTLAVTGNPWGVSGILANWGAWLYQAVGGSVDKWYYFASEGAQRTLENG
    ILNHGGSMRNFGIIFGALLATLLASGFKIKKIKSWKQVVAAILGGLLMGYGARIGFG
    CNIGALFSGIASFSLSGWVYAVF
    LFIGAMVGSKLLVKFFM

    >gi|302337019|ref|YP_003802225.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Spirochaeta smaragdinae DSM 11293]
    MREKKREQYDVVIIGGGAAGLTAGIYCGRARLKTLIIEKALVGGLATYTNEIANFPGFPEPLPGLDLMNLFKKQAEGFGV
    KFKGTDVKSVNFEGDVKIVETFRNIFEAKAVIVAAGGRPRVTTAKNEEKYLFDKGISF
    CATCDAAANTDKTVMVIGSGDA
    AIEEGMFLTKFAKKVIVSVIHDEGKMDCNEIAREQALSNPKMEFKWNTLADSFEGEEQLERVVLKNLKTGELDPVAVDTC
    FEFIGYLPNTEIFENILKLSKQKYVITNERMETGIPGVFAAGDVREKELKQVSTAVGDGAIAGVGSEKYIAETEMFEKQI
    MQKEKVGLIYVYSAINAPSRELLPVLQETAESYDGKIKMNVIDLYKGKTLCDRLSCDIEPMTIFYTKNGEVSAVSTDCST
    PAVKKQLDALLA

    >gi|302337116|ref|YP_003802322.1| methylated-DNA/protein-cysteinemethyltransferase [Spirochaeta smaragdinae DSM 11293]
    MVMKAWQLDRDFSLGTMRMQVTESGELFSLRFVDRNSPMTEEQRPPRQASPYPPLPEEAERVLSSTIDQLREYFAGKRSG
    FDLAYHHTGGPFAEKVYSEVSRIPPGETRTYRQIAEAIGKPTAARAVAGALAANTLLIIIP
    CHRGVPSSGGVGNYRDGTR
    KKGELIALEKRLYGTSCE

    >gi|302337120|ref|YP_003802326.1| Redoxin domain protein [Spirochaeta smaragdinae DSM 11293]
    MEKRQVTKMGGNSITLLGPEPSVGNKAPDFTVLDTDLMPKSLEDYKGTYKLISVVPSLDTGVCDRQTRKFNEIASSLGDD
    VVILTISMDLPFAQKRWCGAAGVDRVVTLSDHKDADFGTAYGVLIEELRLLNRSIFIVDKDDTIRYIELVKENHDHPDYD
    AAVAALKKIRG

    >gi|302337121|ref|YP_003802327.1| dihydrolipoamide dehydrogenase [Spirochaeta smaragdinae DSM 11293]
    MSDNYDLIVIGSGPAGYVGAIRATQLGLSCAVIEKGDVGGVCLNIGCIPSKALIRQAEIFRNADELEGLGVTVDKSGFDY
    QKAWKKSRKASTSLSKGVKFLLKKNKVELIEGRATLEGGGVVLVDGEKRYTAKNILLATGSRPRELPPFPFDGKRILSSD
    QALMMETLPSSLAILGAGAIGCEFAHIMASFGVEVTLIEAMGKILPTEDPDTTDILARSFKKRKIKMLVGAKASGVETSE
    KGVSLSVESGGKQETVQADQLLVVVGRSPNTEELGLEKAGVGTDEKGFVRVADHYKAAEGVYAVGDMVGGILLAHAASKE
    AELVVEHIAGKDVPAAIDPTLIPTAVYTEPEIAGFGMSETEAKEAGHNAKSVQFPYRGAGKSVAIERPDGFVKILYDEKS
    REILGGRIVGDHATELIHELLLARSAELLPEDIANTVHAHPTLSEAVMEAARGVEGWTIHA

    >gi|302337129|ref|YP_003802335.1| NADH:ubiquinone oxidoreductase, subunit D [Spirochaeta smaragdinae DSM 11293]
    MVKGKLKKTFTDPLGKNNPVFAQILGICSTLAVTNKLENTVVMTLGVVFTTTLSSFVISLIRKWIPSRVRMMAETLIIAS
    FVIIVDITLRAYMPDIWKQLGPYVGLIITN
    CIIMGRAEAFALNNSPGLSLIDGLASGIGYSYVLIIVAIFRELLGTGSLW
    GIKILGSWWTNWSIMIMPPGAFFMLAILIWVVKGAIIPEKEEAKK

    >gi|302337130|ref|YP_003802336.1| RnfA-Nqr electron transport subunit [Spirochaeta smaragdinae DSM 11293]
    MSGSLYPVAILFAAIFTNNILLTNYLGMCSFLSVSRELKTSVGLGVAVTFVMASTSVLNWLVYNKILIPLELEYLRFIVF
    IIVIAAFVQIVEMVIERVSETLYAALGIFLPLITVN
    CAILGVSLFMVIREYSFIESFTFGLGSGIGWFLAILAMAGIRQK
    LKKARVPKGLEGPGITLIITGMMAMAFMGFSGMINIG

    >gi|302337924|ref|YP_003803130.1| thioredoxin [Spirochaeta smaragdinae DSM 11293]
    MAEHLTKTDFLEKIFDYENKKEWEYQGELPAVIDFYADWCGPCKMVAPIIEELSQEYEGKVNFFKIDTEAEQELSMAFGI
    QSIPSLLFIPKEGKPQMAAGALPKDTFKEVIDKELLG

    >gi|302337984|ref|YP_003803190.1| glutaredoxin [Spirochaeta smaragdinae DSM 11293]
    MFDQITFQRVEGKKNKHHITFLGLSTCGFCKRGIAFLNDNGFEYEYIYVDKIDPKTKKAIVEEFRDKFDTRLHYPTIIID
    DEHYEMGFVRPAWEKRLEV

    >gi|302337987|ref|YP_003803193.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirochaeta smaragdinae DSM 11293]
    MKLLPLFVSMATGALCAALVARFVPAFRVKGKESFSAAGSIFLDALLAGLVVWKLSPLFLHARYFALHPGALLFAPGGGI
    GIVAGSGAALLVSLFRLVYRGKHAIAFEMRKKVAFLLLVWYLAAALTALAYQAAAHHGFLPAETDVGSSVISASEYQAFD
    GNRYPLFEENSVTVVNFWASW
    CGPCKGELPEMISFYEKTLSAESGGRIRFLTVNLTATEKSHSQVASFIVKEQLPFPVIE
    DIDGRLSTAFAVSSIPSTIIMAPDGRIITELKGVQSAASLEREARSALNKVEE

    >gi|302337993|ref|YP_003803199.1| OsmC family protein [Spirochaeta smaragdinae DSM 11293]
    MSNKVSCEWKGGMAFEADVTGHTIVMDADASSGGNDTGSRPKPLLLAALGGCSGMDVVSILKKMQEPLTWFNMEIEGQAA
    EEHPRYYTEVTIVYQFKKGDGLDEAKVEKAVRLSQERYCGVSAQLSKGAQVNWRIEYLE

    >gi|302338017|ref|YP_003803223.1| Protein-disulfide reductase [Spirochaeta smaragdinae DSM 11293]
    MYRLRRVPALLFFLFVVLLPLAAAKPRIVDVGVFGQGDSQRITLSLEIPEGYHQSFNEDFFFFELVDPAGANLGRIDYPK
    GIDTETGPAYYGTISLSAPLLPEKLRSTSAQTGKLRLHYQLCDEAGTCFLPGTVEASFSIPIPDKNSFSSSIGGLKGEKG
    IWLMLAFALLGGILLNIMPCVFPILSIRALNLVKQSRNDKKLLRSGALLYGAGVLVSFLLLALVVIILKQSGELVGWGFQ
    FQNPAFVLALSAVLLVFALSLFDLYLFQPPIFGSKLAAAGSRGLVGSFVNGLVAVILATPCTAPFLGSALGFAFSQPPLL
    IIFFFLTIGIGFALPFVLLGFIPRIIHRIPKPGPWMELFKEAMGLVLIATALYFFAIFGRQTGAQAMIGALAFLLSLASA
    AWLYGKLAKPTSSKRQRWLSLLLFVILSSAAAMIFIDPSSWKPQEGSASETAMAEKGDEGVERIVYSPERVETMIRSQQP
    FLLVFSAQW
    CSVCKLNDRRIFATERGKELFQRYGIQMVYGDYTNADPVIGEAIKTLGRAGVPVYAFYRPAADKPILLPEL
    LTFEKLEELFSKADHEAETGETPAAQPLGDALFF

    >gi|302338018|ref|YP_003803224.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Spirochaeta smaragdinae DSM 11293]
    MLLLLVFALSPGLFAQESGDESASMSKGQAALYQLGFDIPRGSLAAPPFSLTTLDGETASLSAAKGKLLLLNLWATWCPP
    CRQEMPSMQKIYERFAGKNFEMYAVAAPTPPRETLELITAHVADNGFTFPVPIDNEYQVNSIYGTGSIPTTWIIDEKGNI
    IARLVGATDWSSPEIIGALEMLIP

    >gi|302338426|ref|YP_003803632.1| electron transport complex, RnfABCDGE type, E subunit [Spirochaeta smaragdinae DSM 11293]
    MWKEFTKGLFRENPIFVIVLGLCPTLGVSSRVINALGMGAGVIFVLLCSNIFISLLKNFIPNQVRIPSYIVIIASFVTVV
    QMVMQAFLPDLYDSLGVFVPLIVVN
    CIILGRAEAFASKNGVGASILDALGMGIGFTLALTVISLVREVFGSGTITLFAFG
    DFDGVVRIPGIVDSPARVFVLAAGALLVMGYLKALVGIIQEKGGKG

    >gi|302338427|ref|YP_003803633.1| electron transport complex, RnfABCDGE type, A subunit [Spirochaeta smaragdinae DSM 11293]
    MSYLGIIITFVFINNFILTQFLGLCPFIGVSKNLESAVGMGFAVTFVMALASFATWAIYHLILVPLNIEFLQTITFILVI
    ASLVQFVEMVIQKISPPLYKALGIFLPLITTN
    CAVMGIALIAVQNKYNALESFVAGIAAGLGFLLAIVLMSTIREKLDNE
    WIPKPFRGVPIAFITGGLMALAFMAFDKALLNNLLG

    >gi|302338595|ref|YP_003803801.1| alkylhydroperoxidase like protein, AhpD family [Spirochaeta smaragdinae DSM 11293]
    MNSFSKNKIEQSILNRKKLHQRFYDNSETYRHFLKLEKSAFSEGEISVKHKELMALSMSIITKCEPCIEWHTEQALLASS
    TDSEFFETIDVAIEMGGGPAGAYARFALNCLDYFKDKHNR

    >gi|302338888|ref|YP_003804094.1| Thioredoxin-disulfide reductase [Spirochaeta smaragdinae DSM 11293]
    MEHYDAIVLGAGPAGLSAGIYLARAKQNVVILDQGTVGGQVLLTHAVANYPGLPELSGYQLASTMKTQAEGFGCTLISNT
    NVTGITLKDTVKRVQTDDKEYGAPIMILAMGGRPRNLGIESEDRLKGLGISY
    CATCDGDFFTGQKIMVVGGGNSALEEAV
    SLTRYADKVTIVHQFDHFQGYAHAIEAARANPKIDFILESTVHEFLGKESLEGAVIEHTPSGEKRRLDITGAFILIGYLP
    NTAMVAEQLSLNERGEIITDEGMKTSLAGVFAAGDARQKRFRQITTAVGDGTVAALSAMEYLEAGKRAS

    >gi|302339034|ref|YP_003804240.1| thiol-disulfide isomerase and thioredoxin [Spirochaeta smaragdinae DSM 11293]
    MLESVTTLTEYSKRVETTPLFLAYFTAPGCGVCTSIRPKIEGLLAAHPSIESCIIDISTQQKISAQLSIFSIPAVLFYAQ
    GKETIREARYFSVEQLEEKIERYQALLEE

    >gi|302339110|ref|YP_003804316.1| thioredoxin reductase [Spirochaeta smaragdinae DSM 11293]
    MNTDYDVAIIGGGAAGLTAAQYAARANLKVVIIEEMAPGGQCLIIADLENYPGFPEPISGIEFSQRFEQQARNFGAEFLT
    ATVRSLKKEDNIFNIETSKGIITSLTVIVATGAKHRHLGIPGEKEFTGRGVSY
    CATCDGPFFRNKKILVVGGGDAACDES
    MFLANLTDKVILIHRRDRFRAQKALADRVVANKNIEVRFNTELKEIKGSMKVEKGVFLNNKSGEEYEEEVDAVFVFIGSD
    PQTAILPEVEKDEAGYIVTNQCMETEIPGLYAVGDVRNTPFRQLVVAASDGAIATHCASQYIDDLKGQSYT

    >gi|302339130|ref|YP_003804336.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Spirochaeta smaragdinae DSM 11293]
    MTYLIVGGVAGGAATAARLRRNDEKAAIIIFERGDYISYANCGLPYYLGGTIKERESLFVETPESFKKTLDVDVRISSEV
    VDIDTETKTVGVKDLKSGREYRESYDALILSPGAEPLRPPIPGIDSERIFALRNVPDVDRLKGFVDANQPKRAVVVGAGF
    IGMEVAENLYDRGVNVTIVELANQVMAPLDFEMAAQVHDHLKMKGVELYLSDGVKEFADREGKLDITLNSGTSIVADMAV
    LSIGVRPETSLAKKAGLDTGKGILVNEYMETSAKGVYALGDAAEFREPLTGAPGITPLAGPAGKQARILADNLVYGKKKR
    YKGAIGTSVARIFDMTVASTGAAWKVLDREKIPAISVVTHGHSHAGYYPGATPMVLKLVFSPEDGKIYGGQIVGYSGVDK
    RIEMIAGVLRRGGTIEDLTELEQAYAPPYSSSKDPVNILGFTAENVLLGRSNHTNWKELHELIEKKEPNLFLLDVRTPDE
    YNLGSLPEAVNIPKEEVRTSLDRIPKDKKVVVY
    CGVGLRAYLVERILKQNGYRDVSILSGGMKVYKAAVADQNNRDLFTQ
    YETGYAPSGESAAKSVLSSAVTVLEVDACGLQCPGPILKLKTEIEKIKPGERLLQKASDPGFARDVKSWCNMTGNKLVSL
    KEEKGIIEAVIQRSGEEAASQATPSGVHIAKNTGNELTLICFSDDMDKALASLVIANGALASGKKVTIFYTFWGLSIIKK
    RNKPRVSKGFMGKMFGMMLPGHNGKLKLSKLNMGGIGASMMKGIMKKQKIDTLENMLQTAIDGGLRIIACQMSMDVMGVK
    REELIDKAEIGGVANYLEAASSAGINLFI

    >gi|302339196|ref|YP_003804402.1| methionine-R-sulfoxide reductase [Spirochaeta smaragdinae DSM 11293]
    MKGASFLLIALLLPWNLHASGEVEQRLPEMLFSETHLQALEAYDSAVFAGGCFWCLEKPFEELVGVAEAVSGYSGGDEKD
    PRYQDVASGRTGHRESVTVYYNSEVITYRQLLDVFWRNIDPTDGGGQFADRGSQYAPAIFVGTRGEREAAEASKKQLEAS
    GTFSRPILVEILDRRPFYPAEEYHQDYYKKNREAYDRYYTGSGRGPFVDSLWNKAETSGGLATKEGRWGNFDKQERLSSL
    TDFEYRLTQEGETEPAFANEFWDNKEEGIYVDIVSGEPLFSSTDAFSSGTGWPSFIRPIDPDHIRYLQDTSGTMQRIEVR
    SRYADSHLGHVFTDGPDPTGLRF
    CINSAALRFIPRTEMKEAGYEEYLLLFDGYR

    >gi|302339208|ref|YP_003804414.1| methylated-DNA/protein-cysteinemethyltransferase [Spirochaeta smaragdinae DSM 11293]
    MQISDKRTIDDYYHAFVHKDPSYLGSFFAGVKTTSVFCIATCRARKPKKENVLFFTTFKDALDAGFRPCKICRPTENSAK
    APPQVAAAINLVKKNPKEKFSDYQLIQNGIRPELVRRWFKRQYGMTFQAFQRMYRINNAFQELQAGKSATEVAFDMGYDS
    LSGFGYTYKKYIGSSPSNSAGQNVILIDRLTTPIGPMFVCATENGICLLEFVDRRMLETEFRDLQRLLRATIIAGENYHI
    RQAKKELAEYFSGKRKVFSVALHTPGTEFQNIVWNALNDIPYGDTVSYQSQAEHIGRPKAVRAVASANGHNRIAIIIP
    CH
    RVIGKNGHLTGYGGGLERKSWLLAHERKWR

    >gi|302339430|ref|YP_003804636.1| selenide, water dikinase [Spirochaeta smaragdinae DSM 11293]
    MKDEAIKLTGFTRFSGCGAKLGPGLLDKALCGLSQPKNPAVLSDFSAAEDAGVYKIDEHMALVQTVDFFPPIVDDPFTFG
    RIAAANALSDVFAMGGTPLTALTILCYPKDKIPLEHLRSMMEGGISALTEASCSLVGGHSVDDPELKLGFSITGRVEPQK
    VWRNNTLRKGDALIFSKALGTGLINTALRAELASEEAIEAASRQMATLNLSAMEILKTADLSACTDVTGFGLLGHAAEMV
    SGSACGLTIKSGSLKLLPDVMEYASMGLVPEGTYRNKEFRLPFIANAETIDPVLLDLLFDPQTSGGLLAAVSPRDAERCV
    EAMNEQGLSAALIGSVEGPSEKITIA

    >gi|302339474|ref|YP_003804680.1| thioredoxin [Spirochaeta smaragdinae DSM 11293]
    MNERPKSFSELIRSSDIPVLVDFYADWCGPCKMVSPVVAQIAGELKGRVLTVKINIDKKPALATQWQISSVPTIMLFSGA
    QPVMRLSGAYPYESLKAEILKHL

    >gi|302339489|ref|YP_003804695.1| methylated-DNA/protein-cysteinemethyltransferase [Spirochaeta smaragdinae DSM 11293]
    MRSYYLYDFSIGTLRIATLEDAIVEISIVSGRKAHSEGEEKETILVQEAYKELKEYFEGTRRSFDLPLAPQGTMFQKRVW
    KALLDIPYGETRSYKQIAEVVGSPKGFRAVGLANNKNPIIIVVP
    CHRVIGADGSLVGYGGGLEVKDQLLRLEHTYLTGQQ
    ELL

    >gi|302339542|ref|YP_003804748.1| redox-active disulfide protein 2 [Spirochaeta smaragdinae DSM 11293]
    MKIQILGSGCPKCKALEANARQAVAELGMDVEIEKVTSTDEIMEMGVMMTPAIAIDGDVKNSGSILSSEKIIDLIRAEAG
    RGGK

    >gi|302339582|ref|YP_003804788.1| heavy metal translocating P-type ATPase [Spirochaeta smaragdinae DSM 11293]
    MDEAEEKNHFSFAVEGMTCASCARIVERGLKKIEGIEYVSVNLATEKAYVVGNTSINEEILQRAVEKTGYHYSADLPADD
    VLEQKFKEAGKRALIAGGVTIPLMVLMILHMSGIHIPGFALIETAAGLYLILGPGKNTLKGASIALTHGHANMDTLVSIG
    AVAAWLTAPLSLTPLKLLSFGTIGAMVIAFHLAGRYIEAKLKRKASRDIRAILAGEARAARVETGDTIREVPIESVRIDS
    ILVVRGGEKVPLDGEIIEGSCAVDESMITGEPIPVAKQTGEEVIGGTILSSGFIRVRVSKVGADTFLSRMIKLVEDAQSS
    TVPLQAFADRISLVFVPVVISIALIAAIVWGLAYDSMAPFLMKASQILPWVQPDMGAAATAIFVFVATMVIACPCALGLA
    TPMALVAGSGAAARRGIILKNGEAIGNARSLSTVLLDKTGTLTQGSPSVDSTNLSDTALAAVASIESASVHPLARAVVNY
    AEEKKLPLPSASEISEETGRGISGSCNGSLYHIGRPEDDSRYKELTQTGATVIEVGGDEGILGWIAIRDPLKSDAPAMIA
    RLKELGITPVMLTGDQKHTALAVASELGIDEVRARVKPEEKAAIVREYQGKGEIVAMVGDGINDAASLKTADIGIAIGSG
    TDLSIESADLVLVSDRLDRIADAIIISRKTVRTIRQNLFWAFFYNLIALPAAAAGLLHPAIAEAAMSFSSINVILNSLRI
    RRSV

    >gi|302340020|ref|YP_003805226.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Spirochaeta smaragdinae DSM 11293]
    METTKQYDVIVIGGGPAGMAAAIKAYEEGKGKVLIIERNDSLGGILPQCIHNGFGAVNFDRDYPGPQYAYMYEKKLRSYD
    IEILLDTMVLEISAEKEVYAMNSAMGYLHLQSKAIVLAMGCRERTRSQIRLPGTRAAGIYTAGTAQRLVNIEGYMPGKRI
    VILGSGDIGMIMARRFTIEGAKVLSVLELQPFLTGLRRNYVQCLQDYGIPLHLSTTVNKIMGADRVEAIETIQVDEQYNP
    IEGSEEILECDTLVLSVGLIPENEISRKAGVKLDRRTNGPIVDSYMMTSIPGIFAAGNVTFVYDLVDYVSQAGELAGLNA
    ARYARNERIDSQLGIRLKPGRNVGSVVPQKIMITKNDETGTSITLRPNALIEHRVTVELKYGDETVVSFKEQYARPAEMM
    FHKLKEKELARLEEIKSGELTAVIS

    >gi|302340045|ref|YP_003805251.1| Thioredoxin domain protein [Spirochaeta smaragdinae DSM 11293]
    MNLLIGVLIAIGFFFVLQYGMVLKMRMKKGKPAPELSGKYDRALKNGGAALFYFYSDGCGACKPMTPLFDEFSSTRKNVF
    KVNISNDMATARKFGVMGTPSTVLVRDGKIAEFLVGPQPRERIEALLPGR

    >gi|302340162|ref|YP_003805368.1| NAD(P)-dependent iron-only hydrogenase diaphorase component flavoprotein [Spirochaeta smaragdinae DSM 11293]
    MAFTNYILVCGGTGCESSKSDQIFKNLIAECEAQGLKDTVQVVKTGCFGFCEQGPIVKILPEDSFYVRVSPEDAKELISE
    HIVKGREVKRLLYNRDESKKRARVEDIEFYQKQFRIVLRNCGVINPENIDEYIARDGYKALERALFDMKPEDIINELKTA
    GLRGRGGAGFPTWMKWNFTKQAAGDVKYIVCNADEGDPGAYMDRSTLEGDPHSIIEAMTIAGIAVGAHQGYIYIRAEYPL
    AIKRLQIAMEQSRGYGLLGKDILGSGFDFDIEIRLGAGAFVCGEETALLASIEGERGMPKPRPPFPATKGLWGCPTVINN
    VETWANVPVIISRGGDWFAKIGTEDSKGTKVFALTGKIRNSGLVEVPMGTTLREIVYDIGGGIPGNKAFKAVQTGGPSGG
    VITADYLDTPIDYSQLQKLGSIMGSGGMIVMDEDDCIVDVAKFYLGFTVEESCGKCAPCRVGGRTLYNILDRITKGEGEM
    EDIERLKTIGKAMQKASL
    CGLGQTSPNPVMSTLHYFEDEYKAHIKDKRCPAGKCKPLISYHILADKCIGCGVCARKCPVH
    AINGERRQLHEIDHDICIKCGECYKACKFDAVYVR

    >gi|302340190|ref|YP_003805396.1| thioredoxin [Spirochaeta smaragdinae DSM 11293]
    MAKEVTLTSANFEDEVQNSAIPVLVDFWAEWCVPCKMISPILEEIAEAFDGKIKVGKINVDQEEALAGRFNIISIPTLMV
    FKGGEVVNQQVGAGSRDAIEKLFADYI

    >gi|302340288|ref|YP_003805494.1| Rhodanese domain protein [Spirochaeta smaragdinae DSM 11293]
    MKAMKKVLTVALMLCLATAVFAEGQQEKAAPAAAESSVDIDQLVYDYFANMPDHIYKIGQADFINMVKAGDDMLVLDIRQ
    AADYAKGHVKGAINAPWGPELGKVLGNLPTDKPVMVY
    CYTGQTAGQTVAVLNFAGVKARSVNLGFNLGISKVEGVDASLE
    TTANDFSGKSGASYDPAVKKMVEDYFADLANTKGTMYTNNIISEEDAKKILDSGDDQVQFVSVRGAADYAKGHIDTAINI
    PWGKGMQENFASLPADKKLIVY
    CYTGQTAGQTVAALRVLGYDAVSLKGGMGMGSNAPSGWANQGYPVVQ

    >gi|302340289|ref|YP_003805495.1| Rhodanese domain protein [Spirochaeta smaragdinae DSM 11293]
    MKFRRKMPIAVLAIVAAVGFISCGGPHFAESGSQIIDAKDALAMVQKGGVVLVDAQTGVKYNKEHADGAVNIGRADIVVN
    TPYPNLVADKAQFEKVMQSRGISNDSTVVAYDDSKNMDAARLWWTMVAYGHDPEKVKVISGGLAAMKAAGSAMSSGRTTP
    ASSSYTAKDFDTSMIATLADVKAQVNNPDSNTVILDTRTTEEVEAGTIPGSVHIDYENNNFSDNTYRPVQQIRIDYLEKE
    IDPSKTVIMF
    CKTSIRGAQSYVALYNAGYRNLKLYDGAWVEWSSKPSLPVQMPEKSELPALNSQDGS

    >gi|302337989|ref|YP_003803195.1| Heavy metal transport/detoxification protein [Spirochaeta smaragdinae DSM 11293]
    MKDKPKPIELDLQGASCASCIFAIEHEGRKLKGVKDIKVDSLRSKIVIDLDEKENDDQTEITDRVIKIVRTIGYDAQHPQ
    T

    >gi|302339324|ref|YP_003804530.1| FAD-dependent pyridine nucleotide-disulfide oxidoreductase [Spirochaeta smaragdinae DSM 11293]
    MLISKVREDADLLVVGGGPAGLGAAIEAGRRGARVLLVDEHNRPGGQLFKQIHKFFGSHAHYAGSRGFEIGNRLLIDARD
    AGVSVLLSTKVLGIFPDRRVSLLTDGQKVVTIKPRAVVLATGGGERGASFPGWTLPGVITAGAAQTF
    CNIHRVLPGKRVV
    MMGSGNVGLIVAYQLLQAGADVIALVEAKEEIGGYQVHGSKILRAGVPICTGHTVKEARGSTHVEEVVIAAVDASCSEIP
    GTEKSLQADTLCLAVGLTSDQRLATMAGCRLCFSPEFGGTIPWHDKNLETSIPGIFVAGDCAGIEEANTALDEGRIAGIG
    AACALRTISEAEREAATAEIWDRLNDLRSGSFGTRRRMGKERIMRSGHGQEISCSDCEASGTVTDNTDTVPTESCPDSFL
    IGDDHPPVGKGKKPVAVFYCDQDIPCNPCISACPVGAITMTPSLTGIPRLDSDLCTGCGRCLSVCPGQAIVLFREEYGQS
    QSTLTFVYEYLPLPQKGERVRAVDRFGAVLCNAEVIRVSQTQQQNRSPLVTIAYDRLYADRVRFIERKREEL