Bacillus cytotoxicus NVH 391 98 uid58317

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|152974102|ref|YP_001373619.1| DSBA oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKIEVWSDFVCPFCYIGKRRLEMALDQFPYKNDVEVEFKSFELDPNAPVYSGIGIDEMLASKYGISIEEAKRNNIQIGRH
    AANIGLTFHFEEMKPTNTFDAHRLAKFAKEHGKEKEIVENLLFAHFTESKNLSDVETLANIAEASGLDRKEALHVIQNKN
    AYANDVRIDEEIARQYQITGVPYFIVNQKYAISGAQPLETFLNALQKV

    >gi|152974155|ref|YP_001373672.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MILDADIKAQLSQYLQLMESDILLKVSTGDDDVSKDMLALVDELTAMSSKIKVEKAQLERTPSFSVNRIGEETGITFAGI
    PLGHEFTSLVLALLQVSGRAPKVEQKVIDQIKNIQGEYHFESYISLS
    CHNCPDVVQALNVMSVLNPGITHTMIDGAAFKE
    EVESKDIMAVPTVYLNGEPFGSGRMTLEEILAKMGNGPDASEFSDKDPYDVLVVGGGPAGASAAIYAARKGIRTGIVAER
    FGGQVMDTLGIENFISVKRTEGPKLVASLEEHVKDYDIDVMKLQRAKRLEKKELIEVELENGAVLKSKSVIISTGARWRN
    VGVPGEAEFKNKGVAY
    CPHCDGPLFAGKHVAVIGGGNSGIEAAIDLAGIVKHVTVLEFMPELKADAVLQERLYSLPNVTV
    LKNVQTKEITGTDTVNGISYIDRETEEVHHIELQGVFVQIGLVPNTDWLGDTVERVRGEIVIDKHGATNVPGVFAAGDCT
    NNPYKQIIISMGSGATAALGAFDYLIRN

    >gi|152974156|ref|YP_001373673.1| peroxiredoxin [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MLLIGTEVKPFKANAYHNGEFIQVTDESLKGKWSVVCFYPADFTFVCPTELEDLQNQYAALKELGVEVYSVSTDTHFTHK
    AWHDSSETIGKIEYIMIGDPTRTITSNFDVLVEEEGLAARATFIIDPDGIIQSVEINADGIGRDASILINKIKAAQYVRN
    NPGEVCPAKWKEGAKTLKPSLDLVGKI

    >gi|152974161|ref|YP_001373678.1| hypothetical protein Bcer98_0321 [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MNNSITLMALILLSILVVFQGLLLFKFTNQIKFFAGVIATSSYVKFRTELQIGQAAPPFKLKDQFKQELRVGPNSNSNTL
    LIFISSG
    CPTCKRFVDSISSTYNFEYIKIFFISNKELDDSYISKFKNHNLSFSVSPDIFQLYNIRSAPQAIIVNSRGYIT
    DTLKLQTWEDLAKQKIG

    >gi|152974164|ref|YP_001373681.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MFYFVMFILTLVIFIFTNLSLKKLHSKLHTIKSAKQNTMASNSLPINSIAPSFSLETLTGNIVTLEELRDKPVILLIAAD
    T
    CDACSLDIIEFREEARKYGDNYNFVLIVATSDPTMLNNMDFVEETKLQVLLATMNFMKDYKISMIPTFLFLDERGAVLG
    SPYIVNQFDRYYKLLGNSTITA

    >gi|152974291|ref|YP_001373808.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MITVGEMAPDFTLEASNGEQIKLSDFRGKHVVLYFYPKDMTPGCTTEACDFRDAYGVFQENDTVILGVSPDPANRHVKFI
    EKHELPFLLLVDEDHKVAEQYGVWKLKKNFGKEYMGIERSTFLINKNGELVQEWRKVRVKGHVEEVLESIKKQA

    >gi|152974300|ref|YP_001373817.1| DSBA oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKSSNKIMILGIVFSIAVLIVIGTIVYSIINDKKEKGNEMFAYSTQQALGKEDAPVKVVEFGDFKCPACRTWDATVFPRL
    KEDYINKGKVQFYFINFPFIGKDSELGAAAGEAIYKQDPDSFWKFYDEIYQSQKKDTEEWITEELLLNIVKEKLPKVNVE
    QFKKDLHSKEMKEKVRKDFDRAEKLKVQGAPSVYVNGNLTNPDYDSMKKEIDKELKK

    >gi|152974343|ref|YP_001373860.1| heavy metal translocating P-type ATPase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MAEALVKRKLVLEGLDCANCAMKIEKGIGNLEGVSSCSVNFATKTMVLETEKNKEGHVVTEAKQLVTKLEPHIKVREEQN
    KKSVKEVLVLNGLD
    CANCALKIETNVKEMPGISTATVDFVSKKLKIEVTNKKELETVVANVEHVVHKLEPDVKVVREGKK
    EHHHDHSHGEGNVKKMIVRLAIGGGLTAAALAGLPQAMSISLFIIAYLLIGGEIVWRAVRNIARGQVFDENFLMAVATLG
    AFAIGEYPEAVAVMLFYQVGELFQSIAVNRSRKSITSLMDIRPEYANVKVGNETKQVSPEDVQIGDYIIVKPGEKVPLDG
    KVIEGTSMVDTSALTGESVPREVEVGNEVLSGFVNQNGVLTIEVTKEFEESTVSKILDLVQNASSRKAPTENFITKFARY
    YTPVVVITAAVLAFIPPLILEGATFSEWIYRALVFLVISCPCALVVSIPLGFFGGIGGASKSGILVKGSNYLEALNDVQH
    IVFDKTGTLTKGVFKVTKMEPAGTTTKEELLEYAAFAEVYSNHPIAQSIRNAYRKSVDEKNIEDYNEISGHGTVVKVNGK
    EIFAGNAKLMKKENIEFQQPETVGTLVHVAVDGRYAGYIVISDEVKEDSKQAIQKLKELGIKKTVMLTGDAKRIGEAVGK
    ELGLDEVHAELLPEQKVEEIEKIAVAKQSKEKVAFVGDGINDTPVLARADVGIAMGGLGSDAAIEAADIVIMTDEPSKIA
    TAIKIAKRTRSVVWQNIIFALGVKGLVLLLGAFGIATMWEAVFSDVGVTLIAVLNAMRALRVKNL

    >gi|152974349|ref|YP_001373866.1| copper-translocating P-type ATPase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MGKTKQITIGIDGMTCSACSARIEKVLNKLDGVEANVNVAMEQATVQYDEEEQNIEAITNRIKKLGYEVRTKKVNFDIEG
    MT
    CAACSNRIEKVIGKMEGIETVTVNLAMNTATIVYKDGLLTIEAILDKIKKLGYKGKLQEDVGSTKKEEQLKKKRKQLF
    LSILLSLPLLYTMVAHLPFETGIPMPHFLMNPWVQLLFATPVQFYIGAHFYSGAYRALRNKSANMDVLVVLGTSAAYFYS
    LYEGIKTIQEPSYLPQLYFETSAVLITLILVGKYFEALAKGRTTEAISKLLSLQAKDALVIRDGNEILIPIENVVIGDSI
    IVKPGEKIPVDGIVLSGISSVDEAMITGESIPVEKQVGDAVIGATINKNGILTMRAEKIGKDTALASIIKIVEEAQGSKA
    PIQRMADIISGIFVPIVVAIAIVAFLVWYFAIAPNDLPQSLEVAIAVLVIACPCALGLATPTSIMVGTGKGAEAGILFKG
    GEYLEATHKINAVLLDKTGTVTKGKPEVTDVLSLQDNMLAFAASAENVSEHPLAAAIVEYGKQQGITLLPVEDFRAAPGH
    GIEARIEAQSIVIGTRKLMNEHGVNIGQFEEHMAAQEADGKTVMLVAIENQFAGMISVADTIKESSKEAIHEMKSAGIDV
    YMVTGDNQRTAEAIAKQVGIEHVYAEVLPEKKARIVEELQHNGKQVAMVGDGMNDAPALAKADIGMAIGTGTDVAIEAAD
    VTLVGGNLKHIPQAIELSTKTMKNIRQNLFWALFYNAIGIPIAASGLLEPWVAGAAMAFSSVSVVTNALRLKRVKI

    >gi|152974372|ref|YP_001373889.1| OsmC family protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MRLTIKHDHIQAEYSYGQLSIGKENGYSPLELFISSIAGCSAIVFRTILEKKRIQYDTFTIETTVEHSDALSRPVESVHL
    YYKVRAEGITLMQLEKALAIAVKN
    CTIAQSVKDSIQITETVELIEKK

    >gi|152974445|ref|YP_001373962.1| thiamine/molybdopterin biosynthesis ThiF/MoeB-like protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MNNRYSRQELFSSIGEKGQKKIGKKHVFIIGAGALGSANAEMLVRAGVGNVTIVDRDYIDWSNLQRQQLYAEEDVKNHLP
    KAIAAKQRLKAINSSVVVKAFVKDITAEELEELVTNVDVIIDATDNFETRFIINDISQKYSIPWIYGACVGSYGLSYTIL
    PGKTPCLSCLLQSIPLGGAT
    CDTAGIISPAVSIVVSHQVTETLKLLVEDYKALRDGLVSFDVWKNEYSCMNVQKLKKDHC
    PSCGEKAIYPYLNKENTSKTAVLCGRNTVQIRPPHKEKLDFHRYKELLRDRVADLTVNPYLLSFRADGKRLVAFQDGRVL
    VYGTKEIAEAKTIYHRYFG

    >gi|152974461|ref|YP_001373978.1| thioredoxin domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKKLLIFGGIVIVLFVALWGVRFMEDNSKKDYYANKITLEELRKNITDKKDQTIYFYQTNCVHCQKVSPIVVPLAKDLNV
    DMKVIDIEKEPDAVWDEFNIKGTPTIIHYKEGKEVSRISGDPGKETFRKWLKETKK

    >gi|152974716|ref|YP_001374233.1| transcriptional regulator Spx [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MVTLYSSPSCTSCRKAKLWLEENHIPYTERNIFSDPLTIEEIKEILRMTESGTDEIISTRSKVFQELNVNLESLPLQDLY
    KMIRDYPGILRRPIMIDEKRLQVGYNEDEIRRFLPRTVRTFQLREAQRLVN

    >gi|152974764|ref|YP_001374281.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKYVIIGGDAAGMSAAMQIIRNDKDAHVITLEKGEIYSYAQCGLPYVISGAISSTEKLIARDVKTFRDKYGIDAKVHHEV
    TKIDTEHKMVHGIHTDTKEEFQYEYDRLLIATGVRPVMPDWEGAHLQGIHLLKTIPDAHHILETLKERNVERVTIIGGGA
    IGLEMAETFVELGKAVRMIERNDHVGTIYDADMAKYIHEEAEKHGIEILTNENVKAFKGNEKVEEIETDKGTYETDLVLV
    SVGVKPNTDFLAGTNIRVNHKGAIEVNAYMQTNVKDVFAAGDCATHYHVIKEIQDHIPIGTTANKQGRLAGLNMVDKRRA
    FKGTLGTGIIQFMGLTLARTGLNEKEVNGLNLPYETVKVDSTSSAGYYPNAAPLHVKLLYRSDTKQLLGGQVIGAEGVDK
    RIDVIAMALFHKMSIHDLEDVDLSYAPPYNSVWDPIQQAARRAK

    >gi|152974997|ref|YP_001374514.1| thiol-disulfide oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKKNRLLFRVLILLILSVAVGFTLYQNFFADKEKMQVGKVAPNFVVTTLDGKKIERKDLKGKGIFLNFWGTWCKPCEKEM
    PYMNELYPKYKEKGVEIIALDADETEIAVKNFVNQYGLKFPVAIDKGSEVINTYGVGPLPTTFLIDKEGKVIQMITGTQT
    KEQMEEYLKKITP

    >gi|152975109|ref|YP_001374626.1| rhodanese domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MIVTVEWLRNHIEDEHVRVIDCRFDLANPNWGRQQYEQEHIPYALYFDLNRDLSSPVTKHGGRHPLPNMKEFAEKLSQAG
    IDENTTVVAYDSQSGAMASRLWWLLTYAGHKKVYVLNGGFHVWKERNLPTESECTEVKRKEFIPNVQENMLITMEEVRES
    IRTNVDMTLIDSREPKRYAGIEEQVDSQAGHIPTAQNYFWKEGITEEGKFKEQKEQEERFHHLDKEKEIIVY
    CGSGVTAC
    PNILALQTAGFQNVKLYAGSWSDWISYPENEIEKEQ

    >gi|152975240|ref|YP_001374757.1| peptide methionine sulfoxide reductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MSKKTFELATFAGGCFWCMVKPFDELPGIQKVVSGYTGGHISNPTYEQVKSGTSGHLEVVQMTFDPSIFPYQKLLDLYWS
    QIDPTDDGGQFFDRGPSYRTAIFYHNETQKELAEKSKQLLATSGIFNEPIVTEIRPAAPFYEAEEYHQHFYKKNPKKYAQ
    ERKESGREDFIKTNWQKK

    >gi|152975259|ref|YP_001374776.1| hypothetical protein Bcer98_1464 [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MAIKKPYRVLLYYMYTTIENPEEFAAEHLQFCNSLELKGRILVAKEGINGTASGTTEQTEKYMEAMKNDPRFAGIVFKVD
    EADGHAFKKMHVRPRSELVTLRLEDDINPKELTGKYLEPKEFYEAMQQEETIVIDARNDYEYDLGHFRGAIKPEIKSFRE
    LPNWIKENKEVLEGKKILTY
    CTGGIRCEKFSGWLVREGFEDVSQLHGGIVTYGKDPEVQGELWDGQCYVFDERIAVPVNQ
    KEHVIVGRDHFTNEPCERYVNCANPECNKQILCSEENEAKYLRACSHECRVHPRNRYVKEHELTEEQVAAALEKIEAENQ
    VKLG

    >gi|152975321|ref|YP_001374838.1| methylated-DNA--protein-cysteine methyltransferase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MYRAYYKSEVGLLEVTANEKGITSILFVEEQGEENPNVVVEQCIAELDEYFNQKRTVFSVPLSAEGTAFQKKVWEALYTI
    PYGTSASYLDIAKKIGNQKAVRAIGGANSRNPISIIVP
    CHRIIGKSGKLVGYTGGLWRKEWLLKHEGILK

    >gi|152975380|ref|YP_001374897.1| methyltransferase type 11 [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MTKFNWHKSAEKQWNRNAESWNRNSQEMWDHGSRSTIIPFFEKYVEKGEKVLDIGCGDGYGTYKLSIAGYKVCGIDLSEQ
    MIQKAKERGEGENLSFIKGDLLALPFENERFSAIVAINSLEWTEDPLQSLHEIKRILYSGGYACIALLGPTAKPRENSYP
    RLYGENVV
    CNTMMPWEFEKLAKEQGFQVVDGMGVYKRGVNEKMLEQLSVELRQALTFLWVFMLKK

    >gi|152975385|ref|YP_001374902.1| glutathione peroxidase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MTVYHFSVKTMTGEERSLRDYEGKVLLIVNVASKCGFTPQYKGLQSLYEKYKEQGFEILGFPCNQFGGQEPGEEEEILNF
    CEMNYEVTFPLFAKIDVKGKHAHPLYQYITKQAPGILGIKAVKWNFTKFLIGRDGIVMNRFAPQIKPEELEKAIETLLL

    >gi|152975485|ref|YP_001375002.1| thioredoxin domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKEIKTEQEFKDIIASEDPVVVKFFTTWCPDCVRMDHFIGDVMEEFNKFEWYAINKDEFPSIAEEYQVMGIPSLLVYQNG
    EKLGHLHSANAKTEEQVTEFLEAY

    >gi|152975942|ref|YP_001375459.1| hypothetical protein Bcer98_2214 [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MEKKTKRQETGWNFDNSYARLPESFFSKLLPAPVRAPKLVVLNDSLATSLGLDAEALKSEEGVAVLAGNKVPEGASPLAQ
    AYAGHQFGHFNMLGDGRALLISEQITPSGQRFDIQLKGSGRTPYSRRGDGRAALGPMLREYIISEAMYALGIPTTRSLAV
    TTTGESIFRETELPGAILTRVASSHIRVGTFQYAAATRSIEDLKSLADYTIKRHFPHIEAHETPYLALLQEVIERQASLI
    AKWQLVGFIHGVMNTDNMTISGETIDYGPCAFMDTYNPVTVFSSIDMQGRYAYGNQPYIGVWNLARLAESLLPLLHTDIE
    QAAQIAQNTISKFGPLYEKHWLAGMRAKLGIFNEEATDKELMEELLNTMEKYRADYTNTFLALTFDTNKDTDFFKSEAFT
    SWHKKWEERLSRQEESKSSSQQLMRDNNPAIIPRNHRVEEALEAAVKQEDYRVMERLLAALSSPYAHSPEQYEYATVPEP
    STQPYRTF
    CGT

    >gi|152975988|ref|YP_001375505.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MWRKIIIGAVLLCLASYALYEQFKPNEKQVSKGQVKSETTMKDMVAQNGIEVGKAAPHFELAKLDGTKVKLSDLKGKKVI
    VNFWATW
    CGPCQQEMPDMEAFYKKHKEDIEILAVNYTVSERANGTEKVRQFAEEKGVTFPILLDTDISVTTRYKVITIPT
    SYFINTKGIIQDKFIGPMTQKEMEKRVAKLK

    >gi|152976383|ref|YP_001375900.1| dihydrolipoamide dehydrogenase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MVVGDFPIELDTVVVGAGPGGYVAAIRAAQLGQKVAVIEKANLGGVCLNVGCIPSKALINAGHRFEHAKHSDDMGIIAEN
    VTVDFTKVQEWKNGVVKKLTGGVEGLLKGNKVEIIRGEAYFVDANTLRVMTEDAAQTYTFKNAILATGSTPIEIPGFKYS
    KRVINSTGALSLPEIPKKLVVIGGGYIGMELGTAYANFGTEVTVVEAGDEILAGFEKAMSSVVKRALQKKGNVTIHTKAM
    AKGVEETENGVKVSFEVKGEVQTVEADYVLVTVGRRPNTQEIGLEQLGIKMTDRGLIEIDEQCRTNVPNIYAIGDIVPGP
    PLAHKASYEGKVAAEAISGHAAAIDYIGIPAVCFTDPELASVGYTKKQAEEAGMSVAVSKFPFAANGRALSLNSTDGFLQ
    LVTRKEDGLLVGAQVAGAGASDIISELGLAIEAGMTAEDIAQTIHAHPTLGEITMEAAEVALGMPIHIVK

    >gi|152976401|ref|YP_001375918.1| YruB family glutaredoxin-like protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKKVEVYTQTDCPPCAIVKEFLKHNNITFEEFNIKKDAAARDRLLYDYDSYSTPTVVVDGEVVAGFQIEKLQQLLNIEQE


    >gi|152976568|ref|YP_001376085.1| dihydrolipoamide dehydrogenase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MAKEYDLVIVGGGTGGYVAAIRASQLGLKTALVEKDNLGGTCLHKGCIPSKALLRSAEVYATAKKGEEFGVVTSNVELNF
    AKVQERKGKIVAQLHKGVQHLMKQGKIDVFEGIGRILGPSIFSPMPGTISVEFTNGEENEMLIPKNVIIATGSRPNSLPG
    LELDGEYVMSSDHALKMETLPKSIIIVGGGVIGIEWASMLADFGVEVTILEYAKHVLPLEDQDVSKEMQRLLKKKGIKVV
    TGAKVLPETLGKDNGVTIQAEHNGEKKEFQAEKMLVSVGRQANTQNIGLENTDIVVEKGYIQTNEFYQTKESHIYAIGDV
    IGGLQLAHVASHEGIVAVEHIAGKDVMPIDYSMVSKCVYSNPEVASVGLTEQEAKEKGYKLKVGKFSFRAIGKALVYGES
    DGFVKLVVDEETNDILGVHMIGPHVTDMISEAGLARVLDATPWEVAHTIHPHPSLSEAIGEAALAVDGKALHA

    >gi|152976610|ref|YP_001376127.1| rhodanese domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MSTNLMIILAIILAFIGYSVWMYFYQKKLIQTLSEEEFRAGYRKAQLIDIREADEYNAGHILGARNIPLSQIRLRYKELR
    KDQPIYLY
    CQSGFRTGRAAQFLKKKGYKDFYQLQGGFKTWTGKIKKK

    >gi|152976919|ref|YP_001376436.1| thioredoxin [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MAIVNATDQSFAAEISEGVVLLDFWAPWCGPCKMIAPVLEEIDAELGDKVKVVKVDVDENQETARQFEVMSIPALFVLKD
    GKVVDQALGYKPKEALVELVSKHF

    >gi|152977007|ref|YP_001376524.1| redoxin domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MANVTFKGNPMTLVGTEVKVGDQAPNFQLLANDLSPVSLETYKGQVKLISVVPSIDTGVCDAQTRRFNEEAAGIENTKVL
    TISVDLPFAQKRWCAANGLENVVTLSDHRDLSFGEAYGVVMKELRLLARAVFVVDSNDKVVYVEYVSEGTNHPNYEAALE
    AAKAAK

    >gi|152977048|ref|YP_001376565.1| thioredoxin domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKTLESMEQFQELKNEENVIFMFSADWCPDCRFIDPFMPEVEETYSNFSFYYVDRDEFIDLCVKLDVFGIPSFVAYNKGE
    EIGRYVNKERKTQEQIEAFIEGLK

    >gi|152977064|ref|YP_001376581.1| hypothetical protein Bcer98_3371 [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MHYDVIVIGGGPSGLMAAIGAAEEGARVLLLDKGNKLGRKLAISGGGRCNVTNRLPLDEIVQHIPGNGRFLYSAFSIFNN
    EDIITFFENLGVKLKEEDHGRMFPASNKAQSVVDALLTRLKELGVKTRTNTPVETVEYENGQTKAVVLKTGEILETNHVV
    IAVGGKSVPHTGSTGDGYAWANKAGHTITELFPTEVPILSNEPFIQNRTLQGLALRDVNLSVLNPKGKIIISHKMDMLFT
    HFGISGPAALRCSQFVVKAMKKFKTNNIQMSIDALPDENNEQLFQRMMKQIKEEPKKSIKNVLKGYVPERYFLFLLERNE
    IDGSQQAGQVSHEKIRALAKDFKEFTFAVNGTQPIEKAFVTGGGVSVKEIYPKEMASKLMNGLYFCGEILDIHGYTGGYN
    ITSALVTGRIAGMTAGQRAILERNAH

    >gi|152977086|ref|YP_001376603.1| thiamine/molybdopterin biosynthesis MoeB-like protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MQDRYSRQMLFSSIGEDGQRKIREKHVLLIGAGALGAANAEALARAGIGKLTIADRDYVEWSNLQRQQLYTEEDAKQYKP
    KAIAAAEHLQKINSEVEIIPVVTDVAIQEMEDFIQGIDLIIDATDNFDTRLLINDISQKYNVPWIYGGCVGSYGVTYTIL
    PGKTPCFRCLMEHPTSGAT
    CDTAGVIQPAVQMVVAHQVTEALKILVEDFGALRETMLSFDVWNNQHMAFKVNRQKKESCP
    SCGKLRTYPSLAFESQMKTEVLCGRNTVQIRPGVSKSLNLEEIKKRLQKNMDIQVTPYLLSFFIEEYRFVLFKDGRAFVH
    GTNDKAEAKRLYTRYIG

    >gi|152977095|ref|YP_001376612.1| rhodanese domain-containing protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MTEVKTITTEEVQKRLENGETLFLVDVREDEEVAQGKIPEAVHIKMGDIPNKLEFFDKENEYIFICRSGMRSENVCHYLN
    EQGFKTVNMVGGMLQYKGEIK

    >gi|152977131|ref|YP_001376648.1| hypothetical protein Bcer98_3442 [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MYVTVTDTAYKKIMDTIPNETKFMKLFYDNEGCGCVMSGIIDLVAVSEKEERDVDVASNKLKFIADRTKLVFMDDKLIVD
    LHESGEYFQLKSPSQFYNPNMKLHIRV

    >gi|152977226|ref|YP_001376743.1| iron-sulfur cluster assembly accessory protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MITVTQQAAFQIKDMLKDAEDGERYVRFAVHGGGCSGLSYGLGFEREPNEDDTVLEFHGVEFVIDKESAPIVKGVKIDYK
    QSMLGGGFTIDNPNAIASCGCGSSFRTATNAGKPEEC

    >gi|152977230|ref|YP_001376747.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKHLVLLGGGYGGMRILQRLLPNNQLPDDVQVTLIDKVPYHCFKTEYYALVAGTISETHIRIPFPEHPRLNIQYGTVTNV
    DLENKSVHLDGGEEIQYDDLIIGLGCEDKYHNVPGAKEYTHSLQSIEQTRKTYEQLNSLEPNATVAVVGAGLSGVEVASE
    LRESRPDLTIYLFDRKERILFPFPEKLSRYVEKWFIKHKVTIIRNSNITKVEPNIVYNHDEPLPCDAIVWTAGIQANEVV
    RNLPVEHDSSGRVILTKYHNIPNNEHVYVVGDCASLPHAPSAQLAEGQGEQIVQILLKRWNNEPLPDELPVIKLKGVLGS
    LGKKHGFGLLANQPLMGRVPRLLKSGILWMYKYHNG

    >gi|152977263|ref|YP_001376780.1| thioredoxin [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MMIEVIDWTGAEATNLIVNQEKTVLYVYTPMCGTCQLAKKMLTVVEATIVDLEVGMLDLNYAPHLAREYEIESVPCLLIF
    ENGTLKKKIYAFHSVEYLYKELQ

    >gi|152977266|ref|YP_001376783.1| arsenate reductase and related [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MTVTFYSYPKCGTCQKAKKWFEANDVAYEMIHIVENPPSQEELRNLHMKSELPLKKFFNTSGMRYRELGLKDKLKVASED
    EMFELLASDGMLIKRPIVTDGTNVTLGFNEEQFESMWKKYQ

    >gi|152977359|ref|YP_001376876.1| glutaredoxin 2 [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MKIILYTKTDCGLCVKAKQVLNEVQKVYSFHLEEIDIYDNEELLEKYQMMIPVIEIDGEQVGYGIIHRDVIINYINKSVK
    S

    >gi|152977376|ref|YP_001376893.1| thioredoxin reductase [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MSEEKIYDVIIIGAGPAGMTAAVYTSRANLSTLMLERGIPGGQMANTEEVENYPGYESILGPDLSNKMFEHAKKFGAEYA
    YGDVKEVIDGKEYKTIIAGKKEYKARAIIIASGAEYKKLGVPGEKELGGRGVSY
    CAVCDGAFFKEKELVVIGGGDSAVEE
    GVYLTRFASKVTIIHRRDALRAQKILQDRAFQNEKIDFIWNHTVKQINEENGKVGSVTIVDVNTGEETEFKADGVFVYIG
    MLPLSKPFAALGITNENGYIETNERMETKVPGIFAAGDIREKMLRQIVTATGDGSIAAQSVQHYVEELLEELNTVTEK

    >gi|152977616|ref|YP_001377133.1| bifunctional methionine sulfoxide reductase A/B protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MSINEKVELATFAGGCFWCMVSPFEEMEGVIRIISGYTGGHKENPTYKEVCSETTGHYEAVQITFDPDKMPYEKLLNMYW
    RQIDPTDAGGQFHDRGQSYETAIFYHNEEQRKLAEVSKKELAESGRFSKPIVTKIIPASTFYPAEEYHQDYHKKNAFRYA
    LYRQGSGRDAFIKKHWPKDNAHLKEQLTEMQFYVTQENGTEPPFQNEYWDHKEEGLYVDIVSGEPLFTSLDKFDSGCGWP
    SFTKPVMAASVKEKIDLSHNMTRTEVRSREGDSHLGHVFPDGPGPNGLRY
    CINSAALRFIPKEDLEKEGYGDFLILFHQK
    K

    >gi|152974350|ref|YP_001373867.1| copper ion binding protein [Bacillus cereus subsp. cytotoxis NVH 391-98]
    MTVTLNVKGMTCNHCKAAVTNTLQEINGVSRVVVELQAGTVEIAYDETKVNVQQLKDAIEEQGYDIV