Sphingopyxis alaskensis RB2256 uid58351

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|103485541|ref|YP_615102.1| thiol:disulfide interchange protein [Sphingopyxis alaskensis RB2256]
    MASEAFVTRIGRALAALLAALLLAAGPARAQATHISPRLVAESAMPAPGGTTTLALTMTPEKPWHGYWVNGGDAGFGLTV
    EWNLPDGVSVAPFRYPVPDALILFGMMNHVYEHPYALLAELRVDRSVAPGSDLTLSGVANWLACTDKVCVPERAVISVEL
    TAGDGTIPAGARARFDGWRALLPQPLDRAGRWERRGGSVRFAIPLPASVAIDAPHLFVETQDVIDYAAPQRFSRRGDHII
    VETSAKGAREGPVTALLRTGEGRGLSLRLVPGPVPAAGEPVATDAAGINMGLFWTAFGGAILGGLILNLMPCVFPILSLK
    ALSLARSGGDARTARIEALAYTAGAILTALLLGGALLALRAAGEQVGWAFQLQHPVSVLALLLLALAITLNLLGFYELPS
    FSGGQALADQGGAAGGFWTGALAAFVATPCSGPLLGAALGATLALPAWAALPVFGGLGLGLALPFLAIGFVPALRNRLPK
    PGPWMSRFRRWMALPMGLTTLALVWLLWRQLGNGDQLIWPAVAVAMALVLLTHYGAIQRGDRRSWLLIASGLLFTVSLGA
    TVAEVARAERTAEGSGSTFSPDALAKARASGKPVFVYFTADW
    CLSCKANEAGAINRAAVQAAFDKAGVVTLVGDWTNGDP
    VITRTLAEHGRNSVPLYLWYAPGADKPEILPQILTPGMLIDKVGAK

    >gi|103485572|ref|YP_615133.1| thioredoxin-like protein [Sphingopyxis alaskensis RB2256]
    MKGWHASEGNRSMLRKRRGLGFAAIAVTAAIGAVVYCFGDIPGGRLNPTPSPIPSAAAAEYPGQPLVALAGNGPWLNTTE
    RTPQALRGKVVLVNFWTYS
    CINSLRPLPYIRDWAAKYKDDGLIVIGVHTPEFAFEKDGDKVRRAVAELGVTWPVKLDSDY
    ATWRLFGNDGWPGFYFIDAKGQVRHHRLGEGDYAASERLLQQLLAEAKAAPINEKLTGDIGKGIEAAPDWDQLRSPETYV
    GYRQADRLAAPQRLKRDAPLTYSLPSSVPANQWGLGGAWTVGAESARADAASAKIRYRFEARDLHMVLGARGDGTPARFR
    VTLDGLPPGTDHGVDTDANGMGTVTKDRLYQLVRQSAAVRARTFEIEFLDPGARAYVFTFG

    >gi|103485578|ref|YP_615139.1| OsmC-like protein [Sphingopyxis alaskensis RB2256]
    MSKPDKILYTAKTHTTGGRDGKSTSSDGRLDVKLSSPGGPGGGTNPEQLFAAGWSACFEGAMGLAAKKLDVKLPADLAID
    AEVDLGMTGDAYLLQARLNISLPGVDKETARAIVDMAHQT
    CPYSKATRGNINVEINLV

    >gi|103485600|ref|YP_615161.1| hypothetical protein Sala_0103 [Sphingopyxis alaskensis RB2256]
    MSMLEPQAPDLRVQKWIGADGESTGPLKLSDLGSGPKILFAFQHWCRGCHVHGFPTLQRLHSALSPRGVGFAVIQTVFEG
    ADENTFEKLRVNQLEYALPVAFGHDEPLVGATLPTFMEDYRTRGTPWFSIIDAGGRIVFSDFHLDADRIVKDLELV

    >gi|103485613|ref|YP_615174.1| methionine sulfoxide reductase A [Sphingopyxis alaskensis RB2256]
    MAKIGFGGGCHWCTEGVFQALRGVAQVDQGFVQSDAPADSWSEGVIVTFDPSIIPLATLCEVHLRTHSATRARSPSDKYR
    SAIYIFDDNQRHEAELAIVRFAEEFGNTAHTLVLPFRSFKASDERYQNYYRTDPSRPFCRRFIDPKLDYIRQHFSEVALP
    EPNSVAEHAVDRDNVSQDPASAGIMTDSSSSIATQSRTSP

    >gi|103485617|ref|YP_615178.1| dihydrolipoamide dehydrogenase [Sphingopyxis alaskensis RB2256]
    MTDFDYDVAIIGAGTAGMSAYREALKYSDRVVMIDGGPLGTTCARVGCMPSKLLIAAAEARHRAESVGLFGLRAGPVEVD
    GVQVMNRVRAERDHFVSFATEAIAGFAPGGLLREQARFVDDNRLELASGKQISARSIVIATGSRPVVPAGLEPAGDRLIF
    NDQLFDWTDLPSSVAVFGTGAIGLELGQALHRLGVRTHIYGRGGSVGPLTDPDVAAYAAAQFSSEIPIDWMAADASVARD
    GDAVIVRSAGGEERFDYLLAAAGRRANVDNLGLENTSLTLDAHGVPTYDHLSMRASYSDIFIAGDSAVDLSLLHEAADEG
    RVAGENAARYPHSYRRARRTPLTIVFTDPQIAIAGRSHADLLRDRMDFAIGEVSFEDQGRARILGLNRGLLRVYGDRPSG
    LLLGAEIFGPAAEHLAHLLAWSIESRLTVAELLERPFYHPVIEEGLRTALRHLNHHLGFGPNPPLRCIDCGPGG

    >gi|103485620|ref|YP_615181.1| helix-turn-helix, Fis-type [Sphingopyxis alaskensis RB2256]
    MQKSRMNFRTDMSMIEQAYFQAAGDEGRVAIAEGDRQILAMGIEVSAVQAGDVAPEFLLENALGGTVSLRGRLIGGPVVL
    SFFRGGW
    CPFCRAELRAMSKAAQAVEDRGASLLAISPQPLADSIAMARAEEMTLPLLADRGMTVASDYGLAFELPESMRR
    AALADGMVAGDDGADWRIPMPATYVISTDGIIRYSFLDPNYRNRLDPAVLMSILDRL

    >gi|103485621|ref|YP_615182.1| methionine sulfoxide reductase B [Sphingopyxis alaskensis RB2256]
    MTYLKTSEAIAKLTPQQRHVTQEGGTERAGSGELLHNKEPGIYVDIVSGEPLFASTDKFDSGSGWPSFTKPIVPANVDEI
    RDDSYGMIRTEVRSAHGDSHLGHVFPDGPRDRGGQRY
    CINSASLRFVHRDDMEAEGYSEFLNQIEEN

    >gi|103485622|ref|YP_615183.1| methionine sulfoxide reductase A [Sphingopyxis alaskensis RB2256]
    MTERSILAGGCFWGMQDLIRKLPGVVSTRVGYSGGDVPNATYRNHGTHAEAIEINFDPDQISYRRILEFFFQIHDPTTRN
    RQGNDRGGSYRSAIYYADEAQRETALQTIADVNASGLWPGKVASELEPIGPFWEAEPEHQDYLERRPNGYTCHFPRAAWV
    LPSAGERSEAA

    >gi|103485623|ref|YP_615184.1| glutaredoxin GrxC [Sphingopyxis alaskensis RB2256]
    MKPNITLYTKDYCPFCHRAKAHLRAKGVTDWIEIDVEDDPVQFRAMQTASGGRRTVPQIFINGTHVGGSDDLVALDADGG
    LDLLLREKMLV

    >gi|103485641|ref|YP_615202.1| thioredoxin reductase [Sphingopyxis alaskensis RB2256]
    MPSTHHTKMLILGSGPAGLSAAIYAARAGMQPIVVQGLQPGGQLTITTDVENYPGFAEVIQGPWLMEQMTAQAVHVGTSM
    IWDTIVDVDLSQRPFKLTGDGGDVYLAETLVIATGAQAKWLGVPGEQELGGKGVSA
    CATCDGFFYRGKKVVVIGGGNTAV
    EEALYLTNHSDDVTLIHRRDSLRAEKILQDRLFANPKIKVLWNKQVERFVAGEGVSGLVGVDLIDTVTGAASHEPTDGGF
    VAIGHSPSTELFRGKLPLDADGYLQVTPGTSLTAIPGVFAAGDVTDKIYRQAVTAAGMGCMAALDAERYLAEAEYHAMVD
    A

    >gi|103485643|ref|YP_615204.1| rhodanese-like protein [Sphingopyxis alaskensis RB2256]
    MTVTVAALYRFAAFDDPAALRQPLLNHCAIEGVKGTLLLAREGINGTIAGTDVGIAAVIDHIRALPGCAALDVKYSVASA
    MPFRRLKVRLKKEIVTMRVPGLDPARNAAPYVDPADWNALVDDPGTVLIDTRNGFEVGYGSFAGAVDPGTKSFGDFPGWW
    RANADRFTGKRIAMFCTGGIRCEKSTAFLRHEGVEDVVHLKGGILAYLEQVPASQSRWHGSCFVFDERVSVGHGLVEMGE
    KE

    >gi|103485652|ref|YP_615213.1| thioredoxin [Sphingopyxis alaskensis RB2256]
    MGTKAITDASFQADVLDSETPVLVDFWAEWCGPCKMIGPALEEISDELAGKVVIAKLNIDDHPDAPSKYGVRGIPTMILF
    KNGEIADTKVGAAPKSALKGWLEGAL

    >gi|103485662|ref|YP_615223.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingopyxis alaskensis RB2256]
    MSEKDAKMTIQPGDKLPDATFVKVTENGPEQVSAADYFKGRRVALFSVPGAFTPTCSAKHLPGFVEKADALKAKGVDEIA
    CTAVNDAFVMGAWSKSANAGDAVTMLADGNGAFAEAVGLTMDGTAFGMGKRGQRFSMIINDGVVEQLNVEAPGEFKVSSA
    DHMLEQL

    >gi|103485669|ref|YP_615230.1| methionine sulfoxide reductase A [Sphingopyxis alaskensis RB2256]
    MMARRGGPALRALAALAPAVLLAQCAPAQAENVVKLPAALTDPAVPAKRATAVLAGGCFWGVEGVFSHVKGVISVESGYH
    GGSAATARYELTHDGTSGHAEAVRIVYDPTQVSYGTLLRILFSVVADPTLKDRQGPDVGSQYRAAIVPLDATQRQVATAY
    LAQIGRGGYFARPLVVPIERYKRFYPAEPTHQDFMRRNPRNPYIVRWDAPKLAALKRLFPDRLRATPAP

    >gi|103485696|ref|YP_615257.1| thioredoxin domain-containing protein [Sphingopyxis alaskensis RB2256]
    MILGLLLAGSVAGCDREKAGGGQAQQGQANVSAGQATGAAKFDYMIDRSHRGTAAPTATFTGPDDAPVTLADFRGRPLLV
    NLWATW
    CAPCVAEMPTLDALAAARGEAMTVVAVAQDLQGAEVVDPWFRKARLKALQPYLDPENGLLDAANSALPTSIYYD
    AEGREIWRVVGAIDWQGDEAKALLAEGIR

    >gi|103485736|ref|YP_615297.1| peptide methionine sulfoxide reductase [Sphingopyxis alaskensis RB2256]
    MTRETAIFAGGCFWCTEAVFQSLAGVERVESGYIGGTVANPTYKQVCGGDTGHAEAIRITFDPAVIGYDDLLDVFFATHD
    PTQLNRQGNDVGTQYRSAIFPLDDAQAAAARRGIERAAPDWPAPIVTTIENASEWYPAEDYHQAYWEGEGQRNPYCMAVI
    PPKLAKLRKGFAERLRN

    >gi|103485852|ref|YP_615413.1| glutaredoxin-like protein [Sphingopyxis alaskensis RB2256]
    MSDPATQARISKLVADHPVLLFMKGTPLFPQCGFSSRAIAMLDRLGVEYETVDVLQDMEIRQGIKEYSDWPTIPQLYVKG
    EFVGGSDIMMEMWEAGELHQLMDGIPTRAQ

    >gi|103485899|ref|YP_615460.1| thioredoxin [Sphingopyxis alaskensis RB2256]
    MEADKIKVVCPHCDAVNAIPPDRPAQAAKCGKCHKALFNGSPVDLLGQRFDRHITRSDIPVVVDFWATWCGPCRAMAPSF
    AQVTIAIEPRARFAKVDIDKAPELAARYGVQGVPALLIFKNGRLVDQRSGALPPSALRQWVEAHIG

    >gi|103486122|ref|YP_615683.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingopyxis alaskensis RB2256]
    MGIIGSSIKPFSATSYHQGKFVPVTDADVKGKWAVFFFYPADFTFVCPTELEDLADQYETLQSLGVEVYAVSTDTHFSHK
    AWHDSSPAIGKIAYHMLGDQNHVLANNFGVLREDSGLADRATFVVDPDGVIQVMEITCEGVGRNAGELVRKIKAAIHVRA
    NPGQVCPAKWEEGAETLAPSIELVGKI

    >gi|103486123|ref|YP_615684.1| FAD-dependent pyridine nucleotide-disulphide oxidoreductase [Sphingopyxis alaskensis RB2256]
    MPMLDPNTTAQLKTYLGNLRHPIELVASLDASPKSVEMRALVEEVAAQSDRITARFDGDDVRRPSFAIRGDEGKAEAVFA
    GLPMGHEFTSLILALLHVGGHPPKEDAELLDAVRALEGDFTFETFFSLS
    CQNCPDVVQALNIMAALNPNIRHTAIDGALF
    QDEVERRQVMAVPAVFLNGEPFGQGRMDLAQIVAKLDAGAVARAAGKIAAKEPFDVLVVGGGPGGAAAAIYAARKGIRTG
    IVAERFGGQLLDTLGIDNFVSVQHTEGPKLAAQLEAHVKDYDVDVMNAQEAAALIPGGANGLHEVKLKSGASVKGKTVIL
    STGARWRQMGVPGEAEYRGRGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGLVAHVTLIEFDSQLRADAVLQTKL
    GSLPNVTVITSALTTEVLGNGEKVVGLRYRDRGTDEEHLIELEGIFVQIGLVPNTEWLGDAVALSGRGEIEVDARGATSQ
    PGIFAAGDVTTVPYKQIVIAMGEGSKASLSAFDHLIRAGA

    >gi|103486160|ref|YP_615721.1| HesB/YadR/YfhF [Sphingopyxis alaskensis RB2256]
    MTDTKTRTRPAAVTLTPNAEARIARLMAAAPDGAIGVKLSTPRRGCSGLAYSVDYVTEEEKFDEKIETPGGVFYIDGASV
    LYLIGSTMDWVEDDFAAGFVFDNPNAKGACGCGESFTV

    >gi|103486221|ref|YP_615782.1| DSBA oxidoreductase [Sphingopyxis alaskensis RB2256]
    MAEMRTPRLSVDIVSDVMCPWCIIGWLKFERVMDHFDGRLDFRVQWHPFELNPDMPPEGEDAAAHVMRKYGISAEQSRAN
    TGRLAAIAGELGFAFNRGPGFRMRNSFDAHRLLTWAGASEVPDQAAPTGVQTALKLALFRAHFTDNRDVSDHDVLADVAA
    SVGLDRARAAAILASDEFGAMVRTEESWWADRNITGVPAFILGGQMLVPGAQDPEVFIRVIEKKVLAPAA

    >gi|103486650|ref|YP_616211.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingopyxis alaskensis RB2256]
    MEDCPMRLLKSVMIPLGLALGLGAALALVPAPGIAALQQGAKAPDFTLSAAQGGKPFSLSLKEALKKGPVVLYFFPAAFT
    PG
    CTLEAHLFAEASDDFNRLGARVVGVTAGNIERVAEFSRSECRDRFAVAADPGAKVAAKYDATMRRPDGTILSNRTSFV
    IAPDGTILMSYTDAKPQAHVEKTMAAVRAWRAKRR

    >gi|103486666|ref|YP_616227.1| glutathione peroxidase [Sphingopyxis alaskensis RB2256]
    MGLYDLSAKLPGGGTQSLADYRGKVLLIVNTASKCGFTPQYEGLEELYRDYRDRGFEILAFPCNQFGAQEPGDAEEIRTF
    CSLTYDVSFPLMAKIDVNGDDADPIFKHLKKEKTGLLGSAIKWNFTKFLVDRDGKVVSRHAPTTRPEQLRKEIEELLG

    >gi|103486704|ref|YP_616265.1| glutathione reductase [Sphingopyxis alaskensis RB2256]
    MSDFDFDLFVIGAGSGGVRASRIAASHGARVAVAEEHRVGGTCVIRGCVPKKLLVYGAHFAEDLKDARKFGWEVPDCRFD
    WDVLRDNVLAEVDRLEGLYGQTLDNHKVRVFKTRATVVAPQTVRLADGQELTAERILIATGGWPHVPDFPGSEHAITSNE
    VFHLETLPRRVVIAGGGYIANEFAGIFNEFGSKVTIVNRGDTILRGYDEQIRDRLLQISMTKGIDFKFNAPFEKIEKNDD
    GTLTIYLGGCEPIVADAVLVATGRVPNTKGLGLDEVGVDLDPTGAIRVDEHNQSSVPSIYGVGDVTNRIQLTPVAIREGQ
    AFADSVFGGHPTVVDYANVPSAVFSHPPIGAVGMTEAEARNKLGSVRVYTSDFRAMKNVLAGRNERALYKMIVNAATDQV
    VGLHMIGPDAPEILQAAAIAVKAGLTKADFDATVALHPSMAEELVLLK

    >gi|103486724|ref|YP_616285.1| dihydrolipoamide dehydrogenase [Sphingopyxis alaskensis RB2256]
    MADTNYDLIVLGSGPGGYVAAIRAAQLGMKTAIVERELLGGICLNWGCIPTKALLRSAEIYHYMQHAGAYGLKAAEISAD
    IDAVVKRSRGVASQLNKGVTGLMKKHKITVHMGEGKLTAPGKLEVKGEKGTETLSAKNIIVATGARARDLPFAPADGKRI
    WTYRHALVPSEMPKKLLVIGSGAIGIEFASFYSDMGAEVTVVEMLDRLVPVEDADISAFLEKQLKKQGMTIHTGAGVEEL
    KTTANGVIAKIKDKDGKTQSAEFSHAIVAIGIVPNTENIGLEALGVKTTRGHIDTDAMCRTNVPGVWAIGDVTAPPWLAH
    KAMHESIIAVEAIAGNHPHAMDVRNIPGCTYCRPQIASVGLTEAKAKELGYEVKVGTFPFIGNGKAIALGESEGFTKTVF
    DARTGELLGAHMIGAEVTELIQGYTIGKTAELVEDDFIGTVFPHPTLSETMHEGVLAAFGRPLHI

    >gi|103487000|ref|YP_616561.1| thioredoxin-like protein [Sphingopyxis alaskensis RB2256]
    MTNRWVLFVPLAIMGLLFGAFIYRLVTPAETLIQSQWIDKPMPLFDLPPATAGVPGLKSSDLADGRPRLVNIFASWCIPC
    RAEAPQLEALKAAGVPIDGIAIRDRPEDVAAFLNEYGNPFDRIGADMQSSVQIALGSSGVPETFLVDGKGVIREQIQGVI
    LADQVPEIVAKIEAMK

    >gi|103487109|ref|YP_616670.1| hypothetical protein Sala_1624 [Sphingopyxis alaskensis RB2256]
    MTKQAILHRMVMPGHICPYGLKAKYLLERRGYRVDDRWLTTREQTDAFKAQHGVQTTPQTFIDGVRIGGYDDLRRHFGLK
    VADPDAASYTPVIALFAMTALMALAASFAAYGDAFTLRAAEWFISFSMMVLALLKLQDVGRFATMFLNYDLLARRWVPYA
    SIYPFAEGLAGVLMTAHALPWLSIPLALFIGGIGAVSVFKAVYIDRRDIKCACVGGSSKVPLGFVSLTENLMMVAMALWM
    ARMWV

    >gi|103487274|ref|YP_616835.1| glutaredoxin GrxC [Sphingopyxis alaskensis RB2256]
    MARIEVYTKAFCPYCTRAKRLLDGKGADFSEIDVTMDRAGFDAMVARAGGRRTVPQVFIDDRHVGGSDELAALDAKGELD
    ALIGRA

    >gi|103487310|ref|YP_616871.1| arsenate reductase [Sphingopyxis alaskensis RB2256]
    MKATIWHNPACGTSRNTLAILDATPDVELTVIEYLKNPYEAAKLRQLFADAGLAPRDALRLRGTDAAERGLPDADADTII
    AAMAANPAYVERPFVETEKGVRLCRPQDKVREIL

    >gi|103487542|ref|YP_617103.1| alkylhydroperoxidase AhpD core [Sphingopyxis alaskensis RB2256]
    MTHVTDPFAAAPQLMKQWIGVSLAVQDSLEPSLIELVKIRASILNGCANCINMHTAEARAKGETEQRIYLLAAWHEAPVY
    TPRERAALAWTDALTALSQGHTQKAAKEALEAHFTPEEQVKLTLMINIINGWNRIAVGFDLWLETPAARAA

    >gi|103487623|ref|YP_617184.1| glutathione S-transferase-like protein [Sphingopyxis alaskensis RB2256]
    MWQLYQFPLCPFSRKVRLLLGEKGVGYELVRESPWERRDEFIDLNPAGRTPVMVDQVRGQVLIDSMAIAEYFEETVEGKA
    MINGTAANRAEIRRLTAWFDQDFYYEVTGPLLFERMQKRIVHRQPPDSGALREAMKAANNHLDYIDYLIDHRTWLAGATM
    SLADLAAAAHISVADYLGGIDWTGHEQTKGWYSGLKSRPSFRPLLAERMEIITPPKYYEDVDF

    >gi|103487662|ref|YP_617223.1| HesB/YadR/YfhF [Sphingopyxis alaskensis RB2256]
    MGAHPYLAAMATQISDIILSPAAAARVRWIADRKGQAEAALRLSVDGGGCSGFTYRFDLADSIDADDIVTETDGVKLVVD
    PVSIDLVRGCTVDFVDSLGGSSFKVENPNAASGCGCGSSFAI

    >gi|103487665|ref|YP_617226.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingopyxis alaskensis RB2256]
    MIAIGDPIPDLKLPDADGAAIELAAMKGAPLVVYFYPKADTPGCTTEAQDFTRLAPDFAHLGAQVLAVSRDAPAKLCKFR
    DKYGLTVRLASDEDGTACEAFGTWVEKQNYGRTYMGIERSTFLFGRDGKLAKEWRKVRVKGHADAVLEAAKAL

    >gi|103487691|ref|YP_617252.1| hypothetical protein Sala_2210 [Sphingopyxis alaskensis RB2256]
    MTMILYGIPNCDTVKKARRWLDERGIAHRFHDVRKDGLDPAALQRWIDALGWEKLLNKAGTTFRKLPDAAKAGLDASSAM
    TLMLDQPAMIRRPVVETADGISVGFSADDWQARFAA

    >gi|103487706|ref|YP_617267.1| dihydrolipoamide dehydrogenase [Sphingopyxis alaskensis RB2256]
    MADYDYDVLVIGAGPGGYVAAIRAAQLGLKTACAEGRATLGGTCLNVGCIPSKAMLHASEYFDAAANGSMAAMGIRVKPE
    LDLDTMHGQRRDAVKGLTGGIEFLFRKNKVDWLKGYARFTSKDSVEVAGKSYRAKNIIIATGSSVTPLPGVEVDNDKGVI
    VDSTGALELAKVPGHMVVIGGGVIGLELGSVWRRLGAKVTCVEFLDQILPGMDGDVRKEANKIFKKQGIEFKLKTKVTKA
    EVKGKKAVLTLEPAAGGESETLEADVVLVSIGRRPNTDGLALDKAGLEVNQRGQIEIDHDFRTAIDGIWAIGDVVPGPML
    AHKAEDEGIACAENIAGQTGIVNHDVIPSVVYTWPEIAGVGLTEEQAKEKGEVRVGKFPMLANSRAKTNHEPDGFVKVIA
    DARTDRVLGVWCIASVAGTMIAQAAQAMEFGATSEDIAYTCHAHPTHSEAIKEAAMAVTGKPIHI

    >gi|103487749|ref|YP_617310.1| protein-disulfide isomerase [Sphingopyxis alaskensis RB2256]
    MSAFDDPLLDRRTAVLALSGAALTLMAATPARTTWSRTVTTSPIGAYIVGNPAAKLRLVEYFSYTCHVCADFAKAASLPL
    RTQYIDPGLVRFEYRNLVRDPVDMTAALLARVGGPSAFTDNHQAIFAAFPTFIARVQKATDAQKSSWFEGSVAQRARRIA
    ADTGLAALMRARGYSEAQLTAALDSEVAQAELVGMTNIGRAADRVTGTPSFFINGQRADVVAWPALKSKLDAALKAA

    >gi|103487750|ref|YP_617311.1| protein-disulfide isomerase [Sphingopyxis alaskensis RB2256]
    MTASLRIALLASLGALALAGCGGGADSAKEQEVIAKVAPPAGKSWSQVVRVDGDGVVMGNPEAPIKLEEFGAFTCGHCAQ
    FAKDSHEELKRDFVDTGRVSYKLTPFMLHPIDAIAGAIVKCTGPDRFFPLADATFLEHDAFIAGASKPQPGIEAAMQLPP
    AQRFIALAKTWGIDQFYQQRGVPATTIQQCLGKVENVEAVEKGTNAGIEKYQITGTPTFVINGQVAEGIAAWGPLRDRLR
    TMGAR

    >gi|103487763|ref|YP_617324.1| AraC family transcriptional regulator [Sphingopyxis alaskensis RB2256]
    MSRHLLMTDDECWRAVQARDKAFDGRFVTGVLTTGIYCRPSCAARHPRRENVRFFADGAAARRAGLRPCKRCLPDDVARD
    ESAVIKAIAAIKQSEEPLALADLAARTGYSPTHFQRVFTRHTGLSPAAYARALRDERARRALSEGARVTDAIYDAGFSGP
    SRFYDNMEGRMGMTASAWVNGGRGVTIHWAVVPTSLGDMLVAATDKGVCRLSFAEGREALEERFPAATLVEGGEDFAALL
    SQVVAAVEAPTHGFDHIPIDVKGTAFQEAVWRELRRIPAGETRSYADIAAAVGKPKAVRAAGSANGANNVAVLIP
    CHRVV
    RSDGSLGGYAYGLPIKEELLKREVK

    >gi|103487855|ref|YP_617416.1| OsmC-like protein [Sphingopyxis alaskensis RB2256]
    MTVNRASVRYEGFGKEGRGAITTGSRVLDAQPYGFATRFEGQPGTNPEELIAAAHAACFTMALSFGLARAGYSGDTLETR
    AAVTLEQQDGGFTITKSALTLAAKVPGIDADEFARLAEEAERN
    CPVSKLLDCEITLEHSLES

    >gi|103487884|ref|YP_617445.1| arsenate reductase [Sphingopyxis alaskensis RB2256]
    MTDIVIYHNPACGTSRNTLAMIRNAGIEPHVVEYLKTPPSRALLEQLIVRAGITARELLREKGTPYAELGLGDMALGDEA
    LIDAMMAHPALINRPLVVSPLGVKLCRPSETVLDLIPAGQRGAFAKEDGEQVIDAAGNRVGA

    >gi|103487932|ref|YP_617493.1| heavy metal translocating P-type ATPase [Sphingopyxis alaskensis RB2256]
    MAEGAVTDPVCGMAVDPETSIHQLTHAGVHHYFCSAGCLGKFRADPARYHGGAENSAPPPPKGAIWTCPMHPEIQRPGPG
    ACPICGMALEPIVPEATDGPSEEYRDMRRRFWIGLVLALPVLALEMGGHMTGLHMLISRQASNWVQMLLATPVVLWAGWP
    FFERGWQSLRTRNLNMFTLIAMGTGVAWLYSMVAALLPDIFPDAFRAADGSVAVYFEAAAVITVLVLLGQLLELRARETT
    SGAIRALLDLSPKLARRVAADGSDEEIDLSEVVVGDVLRVRPGEKVPVDGIVMEGRSTVDESMVTGESMPITKDIGAALI
    GGTINQTGGLVMRSEKVGRDTMLARIVQMVADAQRSRAPIQRLADAVSAWFVPTVILVALVAFVAWSLFGPAPSMGYGLV
    AAVAVLIIACPCALGLATPMSIMVGVGRGAEAGVLIKNAEALERMEKVDTLVVDKTGTLTAGKPSVVAIEVAEGFAEEEI
    LRIAASLERTSEHPLAQAIVQAAEQRGIKLLEPTAVDQPVGKGIVGMVDGQTVQAGNASFLAEYDIGPGDLAGPADRLRG
    DGATAIFLAIGGRAAGVIAIADPVKETTPAALRALREAGIKVIMLTGDNRTTAQAIARRLDIADVEADVLPDQKSAVVTR
    LREEGRIVAMAGDGVNDAPALAAADVGIAMGSGTDVAIESAGVTLLHGDLMGIVRARHLSHATMRNIRQNLFFAFAYNVA
    GIPIAAGALYPVFGLLLSPIIAATAMALSSVSVIGNSLRLRLVKI

    >gi|103487989|ref|YP_617550.1| mercuric transporter MerT [Sphingopyxis alaskensis RB2256]
    MTQPKTASRRGAWIAIVGGSLGALGAASCCIVPLVLFTLGVSGAWIGNLTALAPYQPIFLAVAIAFLAAGFWRIYRQPRV
    VCAEGECGTPSSNRLAKTALWLATALIGLAVLFPYLAPLFLDL

    >gi|103487990|ref|YP_617551.1| mercuric transport protein periplasmic protein [Sphingopyxis alaskensis RB2256]
    MNKETMMKKLTLFAAAAALFASGPAFAAIRTTTLAVENMTCVTCAPTVKKSLSRVPGVTAVEVSAKTHTATVTYDDAKTS
    TAALIAATTNAGYPSRVRK

    >gi|103487991|ref|YP_617552.1| mercuric reductase MerA [Sphingopyxis alaskensis RB2256]
    MSDCCNRGDGSQAKKYDLIVVGGGSAGFSAAITAAEQGAQVAVIGAGTIGGTCVNVGCVPSKALIRAVESIHHANAAPMR
    FNGVEAGARMADWGKVIAEKDSLVSGLRQAKYADLLPLYNNIAYHEGTARLVENGVEAGGRRFTADRIVIATGTRPAVPA
    IPGLPDVDALDSTTALDLTELPKSMIVLGGGYIGVELAQMFSRAGVDVTLVFRSRLLPDMEPEIGAALTDYLSSEGITVL
    GDLAYQSAHKTAEGGTALTVLRNGVAETIVAERLLVATGRAPNVEDLGLIEAGVKQTLSGAIIVDDHMRTSVRGVYAAGD
    VTGRDQFVYMAAYGAKIAAKNALNGDSLRYDNSAMPAVVFSDPQVASVGFTEAQAIAAGYATRTSTLPLENVPRALAARD
    TRGLIKLVADGRTRKLLGAHILAPEGADSIQTAAMAIRCGLTIDDLAEMIFPYLTTVEGLKLAAQTFDRDVKRLSC
    CAG

    >gi|103488017|ref|YP_617578.1| arsenate reductase [Sphingopyxis alaskensis RB2256]
    MTSDIIIYHNPECGTSRNTLAMIRNAGIEPHVVEYLKTPPSRALLEQLIERAGLTPRALLREKGTPYAELGLGDERLTDD
    ALIDAMMAHPVLINRPLVVSPLGVRLCRPSEVVLDILPTPQQGAFTKEDGEQVIDEAGNRVSA

    >gi|103488022|ref|YP_617583.1| heavy metal translocating P-type ATPase [Sphingopyxis alaskensis RB2256]
    MTDSKETTHDGHAGCAAHDHAEGTAVVKDPVCGMSVDPARTPHHAVHAGHTYHFCSAGCRSKFVADPERTLSDVRVAPED
    VPHGAIWTCPMHPEIRQDHPGA
    CPICGMALEPETVTADAGPSPELVDMSRRFWIGLALSLPILVLEMGGHLFPALHQLVS
    ARPSTWIQLLLGTPVVLWAGWPFFERGWASVRTRKLNMFTLIAMGTGVAWAYSVVATAAPAVFPSAFRASDGTVAVYFEA
    AAVITVLVLLGQVLELRARERTSGAIRALLNLAPKTARRIRSDGSDEEVSLDLIAVDDRLRVRPGEKVPVDAIVEEGRSA
    LDESMVTGESMPVTKSIGDHVIGGTLNQSGALVVRAEKVGRDTMLARIVQMVAEAQRSRAPIQRLADQVSGWFVPGVLLV
    AIIAFVAWGIWGPEPRFAYGLIAAVAVLIIACPCALGLATPMSIMVGVGRGAGLGVLIKNAEALERIEKVDTLVVDKTGT
    LTQGKPSVTNIVAAEGFDENEILRLAAGVERASEHPLALAVVAAAQERDIAVPEVSDFDSPTGKGAVGTVEGKRIALGNA
    RFLEESGVGTDALSDQADSLRRDGATAIFIAVDGASAGILAIADPIKETTPEALATLRAEGIAVVMLTGDNRTTAEAVAR
    RLGIDEVEAEVLPDQKSAVVERLKRTGRVVAMAGDGVNDAPALAAADVGIAMGSGTDVAIESAGVTLLKGDLNGIARARR
    LSEATMSNIRQNLFFAFIYNAAGVPIAAGLLYPLFGILLSPILAAAAMALSSVSVVMNALRLNRVTL

    >gi|103488041|ref|YP_617602.1| mercuric ion transport protein, MerT [Sphingopyxis alaskensis RB2256]
    MMRSGSRGGAGTKGAVLLTLGGVTAAFGVAACCALPILLTTAGISAAWLGGISMATGPYRDLLLWLSALSLAGGTLLLWR
    MQRSADSCDSERACTPVWLRLILFIGLIAGAVLLWLGYSYV

    >gi|103488142|ref|YP_617703.1| thioredoxin-related [Sphingopyxis alaskensis RB2256]
    MATLGLNPQDKEAVEAFRRDVVEPSMTSLVILDFWAEWCGPCKQLAPVLEKVAADYADRGVVLAKVDVDANRFIASQFQV
    QSIPTVYAIFQGQPVANLTNARSESQLKAMLDQLLAQLPIESATKDRAVEIAPLLEMGENVLAEGDGARATSIFGQIAEI
    APDNAAAHGGLIRAMLLAGDVAGAQAVLDALPAEMADDPAIAQAKSALALAADAPDSGELAALEAAVAANPDDHQARFDL
    AAAQIGVGQRDAAADNLLHIIAADRDWQEGGARAKLLALFEAVGLEDAWVSAQRRRLSLILFG

    >gi|103488160|ref|YP_617721.1| mercuric reductase MerA [Sphingopyxis alaskensis RB2256]
    MTDYHAPKGRETVYDLAVIGAGSAGFSAAITAADQGANVALIGHGTIGGTCVNVGCVPSKTMIRAAEALHGARAAARFPG
    VSGNAQVDDWHSLIAAKDDLVSDLRQRKYVDLLPEYDGITYLEGAARLDGAGVIVGDEPITAGKIIIATGGRPSVPPIPG
    IETVNYLTSTSLLDLQELPRSLIVVGGGYVGAELAQMMARMGVDVTMVCRSRLLPQVEPQVSEALAGIFRSEGMTLYCGI
    AYDACREDERGVMLCVQEGGRPIELKAERLLVATGRTPNTEGLGLEEAGIARDARGAIVVDNHMRTSKADIYAAGDVTNR
    DQFVYMAAYGAKLAALNALNGDSLTYDNATMPWVVFTDPQLAGVGLSEAAAKSAGFETKTSILPLDLVPRALAARDTRGL
    VKLVADAGSDLLLGGQIIAPEGADSIQTLALALRHGMTVAELGETIFPYLTTVEALKLAAQGFGKDVTKLYC
    CAG

    >gi|103488162|ref|YP_617723.1| mercuric transporter MerT [Sphingopyxis alaskensis RB2256]
    MSNSNIEAVAPRASQQPEDRRKTWFAAGGAIGAVLASTCCIVPLLLLTLGVSGAWIGNLTLLEPYRPISAGIALVFIALG
    FRQVYLKARPACEEGSYCARPQSSVITKTILWLSTVLVLLALTIDWWAPYFY

    >gi|103488171|ref|YP_617732.1| alkylhydroperoxidase AhpD core [Sphingopyxis alaskensis RB2256]
    MTETFRTTLPLRRADDADPAVSGPLQAAQKAMGMVPNMYAAMANLPALLETYNFAYGKFRSEGGFTPVEQEVVLLAISRV
    NECHY
    CVAAHSFVADAMSKVPTEVTDAIRADQPIADAKLEALRRFAATMTESRGNPSPADAEAFLAAGYSETHILGIILA
    LSAKIISNYSNHIFHTEVDPAFAGRAWTPPA

    >gi|103488172|ref|YP_617733.1| peroxidase-like [Sphingopyxis alaskensis RB2256]
    MSIFPSLPVDAQLADVFRRFTTGVPALLSYHDDILRDDSPLTVATRELIAAYVSGLNACTYCHGSHLLAAEAFGIDPTLF
    ESLMQDVETAAIDPALKPLLAFVAKLTREPAKICGRDAAAVYAAGWSEEALFAAISVCALFNLMNRIVEGAGVRIDPLAE
    GEAERAARAARLAPGETASGAHAAERSYSLLAEKWGLATSRT

    >gi|103488176|ref|YP_617737.1| hypothetical protein Sala_2699 [Sphingopyxis alaskensis RB2256]
    MAPIWPNAGFLLAAAVAASAAAESPVTFDAALFAAAQREGRTIVVETYAPWCLPCRVRGPVLRDILRRERHRAILFLRVG
    EKTVDADWKRIGAKRYGMLHIYEGPQRVAAGAATREDEIVAMLERAR

    >gi|103488178|ref|YP_617739.1| pyridine nucleotide-disulphide oxidoreductase dimerisation region [Sphingopyxis alaskensis RB2256]
    MNKRLILLLLVALAFGAWVYFDLGDWLTLEALKSQQAAIDGYFRANPLLVAGLFFVVYVVLTALSVPGAAILTLAAGAIF
    GLYWGTLIVSFASTIGATFAFLASRYLFRDAVQARFGDRLRRVNDGIARDGAFYLFSLRLVPVFPFFAVNLLMGLTPIRT
    VTYFWVSQLGMFLGTVIYVNAGTQLARIDALSDIASPGLLASFAALGLLPWLGKWIMAAIKRRRVYGRFRRPRRYDRNLV
    VIGAGAAGLVSSYIAATVKAKVTLVEASKMGGD
    CLNYGCVPSKALIKSARIAEQMRHADRYGLVAASPQIRFRSVMQRIH
    DIIAAIEPHDSVERYTELGVDVVQGYARIVDPWTVEIARNDGEVQRLTTRAIVVAAGAEPVVPDLPGLAESGYLTSDTLW
    EAFAARDTMPQRIVILGGGPIGSELSQAFARLGADVAQIERGDRLLPREDDEVSELARDALENAGVEVLTGHEALRVEGI
    EADRRLIVRHAGGERAIAFDALIVAVGRKARLTGYGLEDLGIETQRTVVTDEYLATVYPNIYAAGDVAGPYQFTHSAAHQ
    AWYASVNALFGQFRRFKADYRVIPWTTFIDPEVARVGLSEAEAVEKGVAFEVTRYPLHDLDRAIADSATTGFVKVLTPPG
    KDRILGVTIVGEHAGELLAEYVLAMKHGLGLGKILGTIHTYPTMAEANKYAAGEWKRAHAPERLLKLVGRYHDWRRG

    >gi|103488341|ref|YP_617902.1| protein-methionine-S-oxide reductase [Sphingopyxis alaskensis RB2256]
    MIPRRYLLGGLALGGSIIAAPMLFAKSARPGAEPGWRLSEAEWKKRLSPLEYRVLREAATERPFTSPLDKEKRAGTFVCA
    GCALPLYSSRTKYDSGTGWPSFWAPLKGAIGTATDHDLGYPRTEVHCRRCGGHLGHVFNDGPKPTGKRY
    CMNGAALRFRP
    A

    >gi|103488452|ref|YP_618013.1| protein-methionine-S-oxide reductase [Sphingopyxis alaskensis RB2256]
    MTDPKTDKPLDPMAHHVLREGGTERAFTGKYTDHKGDGIYRCAGCGAPLFDSRTKYDSGSGWPSYTAPANEAAVTEHRDA
    SHGMIRTEVRCATCEGHLGHVFPDGPGPTGLRY
    CINSAALDFADRAPDEASTGEG

    >gi|103488537|ref|YP_618098.1| 3-mercaptopyruvate sulfurtransferase [Sphingopyxis alaskensis RB2256]
    MDALVSTDWLERELGASDLRVVDATKFLGTDRDARAEYEAGHIPGAVFMDLADLTDTSSAIENMAPPAEKFASRMQSLGL
    GDGSRIVLYDDSPLKSAARAWWLLKLFGAHDVALLDGGLAKWKAEGRALEMGKQTLRHRHFTVWRDPKAVRTKEQMLANL
    DSGAEQVVDARPAARFTGEERDPRPGLAPGHIPGSRSLPHSELFNADGTWKRGDALKAAFDAAGIDLDKPLVAT
    CGSGMT
    ATVVAFGAHLLGKDDVAVYDGSWLEWGADAATPKATGAA

    >gi|103488645|ref|YP_618206.1| DSBA oxidoreductase [Sphingopyxis alaskensis RB2256]
    MTENKDEYYQPWLRDPAPTPGVGARARDEGLAKPKEEPPVGIDLTQYSKADKPRGEPLVRPEAIKAGTASLWNQLRRGAE
    AFADWTIGIGERADIPARVEAMEIPRRASEFASRTGAATARAARVAGRGSARAGRALAKASGEAWARMALGAKARKLSRD
    AGRGLGEVADRTRAGVADLAKASSESLRESIGDAATRLRPAPREEPAPPPSGLEQLLAREDAAAEAKAPAAPDLPLFAGD
    AAIPLTTKPTPKTRTAAPDGDARSPLVKAPDARSASEKAMAAGRLPTLKGTGMESGSMRLWALAGGGILLLALVFWLGGR
    VGGGLSKSEVETVVADYIRANPQIIPEALEAQRGREIAKAIDAVRPALEKPYAGAWAGNADGDVTLVVFTDYA
    CGFCRAS
    VPDVDRLIREDKRLKVVFRELPIIAPQSRDAAIMALAAARQGKYDAFHHAMFAASSLDRGAIAAAAERAGVVTDGSADAT
    ANEALFQREIDNNMAIATQLGLNATPTWIVGDQLLQGQVGYAVLRQAIDKARTEG

    >gi|103488655|ref|YP_618216.1| UBA/THIF-type NAD/FAD binding fold [Sphingopyxis alaskensis RB2256]
    MLNDAELDRYARQIILPAFGGTGQAKLKGSHVAIIGAGGIGCPAITYLAAAGVGKLTIIDDDHVELSNLQRQPLFTDADV
    GAPKAMVAADAAWRINPHVEAIAVAERLDEANAAALLAGASLILDGCDNFATRLAVNRAAVTLQIPLLSAAIGAFEGQVA
    LYEGWRGESPCYACLVGNDPDRPGIN
    CAEQGVMGALAGMVGTMAALETVRALSGWGTPLVGRLAIIDMLDRRWREVAVAK
    EPECPICRG