Sphingomonas wittichii RW1 uid58691

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|148550590|ref|YP_001260029.1| dihydrolipoamide dehydrogenase [Sphingomonas wittichii RW1]
    MADSYDVIVLGSGPGGYVAAIRAAQLKLNTAIVERENLGGVCLNWGCIPTKALLRSAEVFRYMRHAKDYGLVAEKITADL
    DAVVKRSRGVARQLNQGVSHLMKKNGIAVYMGEGKLTGKGRLSVTAPDGKTSELTAKNIIIATGARARDLPFPKADGKRV
    WTYRHAMNPPEMPNKLLVIGSGAIGIEFASFYNDMGAEVTVVEMLDRIVPVEDADVSTFLEKALVKQGMKILTGAGVQKL
    DIGATGVTVAIKARDGKLVSDEYSHVIVAIGIVPNTETVGLEALGVKTERGHIVTDGACRTNVEGIWAIGDATAPPWLAH
    KASHEGVIAAETIAGQHPHAMDPRNIPGCTYCHPQIASVGLTETNAREAGHEVRIGTFPFIGNGKAIALGEPEGFVKTVF
    DAQTGELLGAHMVGPEVTEMIHGFTIGRTLETTEAELMETVFPHPTISETMHESVLAAFGRAVHI

    >gi|148550805|ref|YP_001260244.1| hypothetical protein Swit_5369 [Sphingomonas wittichii RW1]
    MSVTDRLRAAAGRTPWSFGLIALPVVGLGAAAIAAAAVPTEDSQVAGLLKARLPKTEISAVNCAKVAGLCEVTAGANLFY
    VDRGARYLVIGRVYDMETRQDVTAARLLEMNPDMLVGGAAKANATAALGGEADASPVAPTAGARRVSVPVRPATLSLAGL
    PRDGAIVWGNKASSQSVTVFTDFR
    CGYCRALTSVLRSMDVKVIERPISVLGSRDLADRVYCAKNREEALHAAYSGAPFES
    GGKCDTRGLDANEQFARSHGLSGTPVIVRSDGAMLEGYRPKDVLEAWLKGAKS

    >gi|148552945|ref|YP_001260527.1| redoxin domain-containing protein [Sphingomonas wittichii RW1]
    MIGRTVPNVTLKTRVRDESVGGPNPFRWQDVHTGELFAGRRVVVFALPGAFTPTCSTEQCPAYERSYDELRARGADEVYC
    LSVNDAFVMYQWAKQLGVEKTRMLPDGSGDFTRRMGMLINKDHLGFGDRSWRYAMVVDDGRITGWFEEPGINDVGADDDP
    YGESAPDKVLAWLHENPVREPAEA

    >gi|148553003|ref|YP_001260585.1| peptide methionine sulfoxide reductase [Sphingomonas wittichii RW1]
    MAREIATLAGGCFWCVEAVFDDVIGVESVESGYTGGHVANPTYKQVCNGDTGHAEAIRVAFDPDVIGYGELLDIFFHVHD
    PTQLDRQGNDIGPQYRSAIFPHSPEQEAEAKAAIDRARADWPDPIVTRVEPEATWYPAEDYHQEYFAREGASSGYCVMVV
    APKLAKFRKSYAARLKK

    >gi|148553207|ref|YP_001260789.1| hypothetical protein Swit_0280 [Sphingomonas wittichii RW1]
    MTIRVLDPTASLAHDIADPGPDAGALRGKRIAIRIDMLWRSWDWVSAIWAEGLRAEGAEVTFWRSCGRTGAEGEAAAMDY
    AALLRESDAAIVGLGN
    CGSCTSWTIADALEAAATGLPTIAVATAHFEGLAHNLAKRGGRSGLRLHVLPYPLDILPRDQVD
    DIARDQYRSFLRNFGVRGGLAEQSAA

    >gi|148553466|ref|YP_001261048.1| cytochrome c biogenesis protein, transmembrane region [Sphingomonas wittichii RW1]
    MTSIGRLIPLFVALLLAVAGAGAAPAAHIRAVLEAETLRPAAGSRITLALGMTPERDWHGYWLNPGDAGAPADIAWTLPR
    GATVGPLRYPVPQRLIVQGLMNYVYERPYALLMTLTVPKGLAPGTPLRIAGKARWLACSPTICVPEQGPVAIDLTVGDGA
    VTAASRARFDAWRAKLPMPLGQTASFEAKPGKLRLAIPFPKGRPVTAPYFYPATDGVADYAAPQAISRRGDRLIVEIKAA
    RNPQPVQAIEGLIAIGPDRGLMVTARPGPVPAAGVPIAGAGDEAGEGGGWRTFLLALGGALLGGLLLNAMPCVFPILSLK
    ALSLARSGETDRHARVEALAYTAGIVLSCVALGLLLLGLRAGGAAAGWGFQLQDPRMVFVLLLLVTAISLNLAGLFELRV
    VGIGEAMTKGRGALPAFWTGVLAALVATPCSGPFMAGAVGAALLLPPAAALAVFAGLGLGLALPFLLVGFVPALRRLLPK
    PGAWMDRLRRILSVPMFLTALGLAWVLGQQAGVDRLVQGVGAALLLGLALWWVGARQAQGKRYSWIPVAPVLAAALALLL
    VTPSGGSPAAAAPAGEAGAEPFSEARLAALQAQKKPVFLYFTADW
    CLTCKVNEKAAIERPAVREAFDRAGVVVMVGDWTN
    GDPAIGRFLEAQGRSGVPLYLFYDKDGRQETLPQLLTPATLTALAA

    >gi|148553475|ref|YP_001261057.1| methylated-DNA--protein-cysteine methyltransferase [Sphingomonas wittichii RW1]
    MQEMIRFAWGTSYLGDVMVAVSDRGIVAIEFGDQRPAVEQVLRARFPEAVVHERPDELAPIAAKAVRAIEEPGYDPGLPL
    DLRGTPYEVMVWTMLRDIPSGETTSYGALAARLGTRDARDVTAAIANNAVAVLVP
    CHRVIRKDGSISGYRWGFRRKRSLL
    ARERKAIDR

    >gi|148553482|ref|YP_001261064.1| glutaredoxin 3 [Sphingomonas wittichii RW1]
    MDRMPKVEIYTKAFCPYCSRAKALLETKGVGFEEYDISMGGPKRAEMIERARGGSTVPQIFIDDRHIGGCDDMFALDRQG
    KLDPLLAA

    >gi|148553702|ref|YP_001261284.1| dihydrolipoamide dehydrogenase [Sphingomonas wittichii RW1]
    MTEPKTEIVKTRVLVLGGGPGGYVAAIRAGQLGLDTVLVEAGRLGGTCLIRGCIPSKALIHAAEQYAAMAGAATAPRLGI
    SLASPPSLDFAATIGWKDGVVDRLNGGVAALLKRAKVRVIAGHGRFSDARTCHVATAEGGAVTVQAEHIVLATGSEPIEL
    PFLPFGGKVISSTEALSLPAVPKRLAIVGAGYIGLELGIAYRKLGAEVTVVEAADRILPLYDAKLVEPVRRWLDRHGVAL
    HLSARATGQGRDGLLVETAGGEAIELPADNILVTVGRRPVTRGWGLEEMAVAMDGAFVAVDDRCATATRNVWAIGDLVGE
    PMLAHKASAQGAMVAEIIAGRKRRFDPRAIPAVCFTEPEIVSVGQGPDAPGTITGVFPFAANGRALSMEAGDAGGFVRVV
    ALEAGHRIVGVQAVGLHVSELSAAFAQAIETGAVLEDVEGIIHAHPTLGEAFHEAALKAMGHAIHA

    >gi|148553902|ref|YP_001261484.1| OsmC family protein [Sphingomonas wittichii RW1]
    MPTETFDFAGGGDHRLAGRLERPEGTARGWAIFAHCFTCGKDQRVAVRIARALAAQGIGTLRFDFAGIGGSEGSLAESSF
    AADRRDLIAAAEAMAAAGHAPSLLVGHSFGGAAALAAAGDMPSIKAVATIAAPFDVAHVLRHFDAAAVETIEREGAAEVV
    LAGRTFRIGKAFVDDLRRHDQGARIEALHRPLMILHAPFDEVVDIENATRIFLAARHPKSFVSLDKADHLLTGAGQAEQV
    AALVAAWAAPYLPRPDPTRDEGEADVVAEETGAGRFQVAIQAGGIRFLADEPAAVGGLGSGPTPYDLLSAGLAA
    CTTMTL
    RMYADQKGWEIGRIRTAVGHAKRKGEAPADLFTRRIAFGGEVDAERRARLLEIADR
    CPVHRTLEASARVETSLGGPPAAA
    EPIEAHMTAVEGLVESAE

    >gi|148553905|ref|YP_001261487.1| OsmC family protein [Sphingomonas wittichii RW1]
    MTHATATIGRDRYAVQIDASGHAITADEPEKLGGANAGPAPYDLLLASLGACTAITLRMYADRKQWPLESLDVSLRLTGG
    AEDRRIVRTIAPRGLDGEQAVRLADIAERTPVTLTLKSGIAIDTSVA

    >gi|148554046|ref|YP_001261628.1| glutaredoxin [Sphingomonas wittichii RW1]
    MDTAARPTAILYRMVMPDHVCPYGLKALHLLRSRGYAVDDRWLRTREETDAFKAEHDVKTTPQVFIDGRRIGGHDDLRRH
    LGLKVAEPGATSYRPVAVLFAMTALMALAASMAAFGSPFTMQAGQWFIAFSMCALALLKLQDVDRFATMFLNYDLLARRW
    VPYGTIYPYAEGLAGVLMAAGVLTWLSAPIALFIGGIGAVSVFKAVYVDKRSIKCACVGGSSNVPLGFVSMLENVMMVAM
    AAWMLAM

    >gi|148554049|ref|YP_001261631.1| DNA-O6-methylguanine--protein-cysteine S-methyltransferase / transcriptional regulator Ada [Sphingomonas wittichii RW1]
    MLMDTTVNDPRWMKLVTRDAGADGSFVYSVATTGVYCRPSCPARTPNPRNVAFHADPAAAEAAGFRPCKRCRPTEPPLAE
    RQAAIVAAACRRIEAAEEPLSLGELADGARLSPHHFHRLFKAITGLTPKGYADAHRARKVREALGKGAQVTEALYDAGFG
    SSGRFYAAADGALGMLPGAYRKGGAAAGIRYGIGDSSLGRVLAAASERGVCSIMLGDDDAELVADLGRRFPNARAIEADE
    DFQSTIAAVVALVEEPERGLSLPLDIRGTAFQRRVWQALQAIPAGETLSYAGVARAIGEPRAARAVAAACAANKIAVAIP
    CHRVVHSDGSDRGYRWGVERKRALLRKEARD

    >gi|148554121|ref|YP_001261703.1| glutathione peroxidase [Sphingomonas wittichii RW1]
    MATDIQQIPLKTIGGADATLGDYAGKVLLAVNVASKCGLTPQYTALEALYGQYKDKGFAVLGFPANNFGAQEPGTESEIQ
    EFCTTNYGVDFPMFAKLSVKGDDQHPLYAKLVAAQPDKTFKDGSFKEKLAGYGIVPEKDTDVLWNFEKFLIAKDGTVAGR
    FAPDIAPDDPIITGAIEAELAK

    >gi|148554169|ref|YP_001261751.1| methylated-DNA--protein-cysteine methyltransferase [Sphingomonas wittichii RW1]
    MTLAFTILPSPVGDLTLVAGERGLVAILWPDDDPGRVRLEGLAEQPGHPVLVETVRQLGAYFAGQLERFDVPLDFRGTDF
    QKQVWAALLTIPFGETRSYGEIARQIGRPSASRAVGAANGRNPISIIAP
    CHRVVGSAGALTGFAGGLDAKRYLLDLESGR
    LAA

    >gi|148554217|ref|YP_001261799.1| dihydrolipoamide dehydrogenase [Sphingomonas wittichii RW1]
    MSDYDFDVIVIGAGPGGYVAAIRAAQLGLRTACVESRETLGGTCLNVGCIPSKAMLHASELYDEAASGKLAKLGIKTQVE
    LDLDTMHGQRRDAVKGLTGGIEFLFKKNKVEWLKGHAAFTGKDRIDVAGKSYRARNIVVATGSSVTPLPGVEIDEKVVVS
    STGALELAKVPGHLVVIGGGVIGLELGSVWKRLGAKVTVVEFLDQLLPGMDGEVRKEAAKIFKKQGIELKLSTKVTGVAV
    KGGKATVTVEPAAGGAAETLEADAVLVSIGRRPNTEGLALERAGLTVNKRGQIEVDHDLATAVPGIWAIGDVVPGPMLAH
    KAEDEGIAVAENIAGLTGIVNHDVIPGVVYTMPEIAGVGLTEEEARERGEVKIGKFPMLANSRAKTNHEPDGFVKVIADA
    KTDRVLGVHIIASVAGTMIAQAAQAMEFGATSEDIAYTCHAHPTHSEAIKEAAMAVTGKPIHM

    >gi|148554286|ref|YP_001261868.1| dihydrolipoamide dehydrogenase [Sphingomonas wittichii RW1]
    MAETYDLIVLGSGPGGYVAAIRAAQLGLKTAIVERELLGGICLNWGCIPTKALLRSAEIYHHMKHAEAFGLSAVKPGFEL
    ANVVQRSRGVAKQLNQGVTGLMKKHKIAVHFGDGKLTDKGKLTVTRDGQATELSAKNIIIATGARARDLPFAKADGERIW
    TYRHAMTPKEMPTKLLVIGSGAIGLEFASFYGDFGAEVTVVEMLDRILPVEDEEVSAFMTKALAKQGMKIRPSTGVQKLT
    PSAKGVTAEIKDKDGKVTTEEYSHVIVAVGIVPNVENIGLEEVGVEPDKRYHIKTDEYCRTNVPGIYAIGDVTDGPWLAH
    KAMHEAVIAAEHIAGEHPHAMDKRNIPGCTYCRPQVASVGLTEAKAKEAGYTVKVGKFPFIGNGKAIALGEPEGFVKTVF
    DEATGELLGAHMVGAEVTEMIQGYTIGKTLETTEAELMGTVFPHPTISEAMHESVLAAYGRPLHI

    >gi|148554713|ref|YP_001262295.1| heavy metal translocating P-type ATPase [Sphingomonas wittichii RW1]
    MTHLSAITRLSADELLLASREVDTGLRHSDLSVPGIRCGGCIRKIEDAIGRLPGVTRARVNLSTRRVGVDWQESAGPPPL
    GETLTGLGYDAYLHEAREDAKDPQLGRMIRALAVAGFAAMNIMGLSVSVWSGAAGETRDLFHWLSAAIALPTLAYSGRIF
    FRSAWQALRRGQTNMDVPISLGVLLAFAMSLYDTIHHASYAYFDAAVSLLFFLLIGRTLDHVMREKARTAVKGLGRLAAY
    GATIVTPDGGRAYVGTEEIEPGMTILLRPGDRIPVDAVVIEGRSDIDAALATGESLPEPVVPGSGLRAGTLNLTGPLTIR
    AIAASKDSFLAEMMRLMEAAEGGRTQFRRIADRAARLYVPVVHSAALLAFLGWMAATGDWHQALTIAVAVLIITCPCALG
    LAVPMVQVVAARALFEHGVMVKDGSAMERLVEVDRTLFDKTGTLTLGRPRLRPDAAVDPAHLAIAARIGAQSHHPYAQAL
    AAAAAPADIAFDSIVEHAGLGLEARIGDDLWRLGRGAWAVDGDQASEAEGTVLSCNGKLLHAFLFEDELRPGAEAAVATL
    RARGHAIEIMSGDTPDAVAPVAAALGIDTVQAALLPAEKTAHLEALAAAGHKTLMVGDGLNDAPALVAAHVSMAPGSAAD
    VGRQAADFVFLRPDLDSVTYTIAIARRADRLIRQNFAFAALYNLVALPVAVAGYVTPLIAALAMSGSSIIVVANALRLGP
    RGGA

    >gi|148555069|ref|YP_001262651.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingomonas wittichii RW1]
    MRPLLPVLSLIAALALPAAAPAALKVGAKAPAFDTRASLAGKDFDFSLAKALKKGPVVLYFFPAAFTKGCTVEAHEFAEA
    TDDFARLGATVVGMAADPIEKLNQFSVQECRNKFAVGVATPAMIKGYDVALEAGLIPNVTGRTNRTSYVIAPDGRIVFVH
    SELGVAGHVSGTMNAVKALKAKR

    >gi|148555158|ref|YP_001262740.1| arsenate reductase [Sphingomonas wittichii RW1]
    MAVDIVVYHNPECGTSRNVVGLIRNAGIEPHIVEYLKTPPARALLVQLVERAGIRPRDLLREKGTPYAELGLDDMSLSDE
    ALLDAMMAHPILINRPLVVSPLGVKLCRPSEAVLDILPEAQRGAFTKEDGERVVDAAGQRIPSA

    >gi|148555582|ref|YP_001263164.1| redoxin domain-containing protein [Sphingomonas wittichii RW1]
    MTIAVGERVPETGFMTMTSEGPRPVASADLFAGRKVALFSVPGAFTPTCSAKHLPGYVDKADAIRARGVDEIVCTAVNDA
    FVMGAWGVSAGADGKVSMLADGNGDFVRALGLEMDARGAGMGVRGQRFSMLVEDGVVTRLNVEEPREYKVSSAEHLLGQL


    >gi|148555594|ref|YP_001263176.1| thioredoxin [Sphingomonas wittichii RW1]
    MPTKAITDSSFHDDVISADKPVLVDFWAEWCGPCKMIGPALEEIADELGEKVTIAKINIDDNPDAPGKYGVRGIPTMILF
    KNGQPTATKVGAAPKSQLKGWLEGEL

    >gi|148555634|ref|YP_001263216.1| NADPH-glutathione reductase [Sphingomonas wittichii RW1]
    MAEFDYDLFVIGAGSGGVRAARVAAAYGARVAVAEEHRVGGTCVIRGCVPKKMLVYGSHFAEDLHDAARYGWELGDIRFD
    WKTLRDNVNADVDRLEGLYTNTLDNNKVELFHERATVSGPNAVTLAGGRTVSARFILIATGAWPVVPDVPGAEHGITSNE
    VFYIDELPRRVVIAGAGYIANEFAGIFHALGSKVTVVNRSDQILRGYDEQIRDRLFQISTQKGIEFIFNASFERIEKRED
    GSLCVHFKDHERCDTDLLLFAIGRSPKTGGLGLEAVGVELNDKGAIVVDEDNRSSVPSIYAVGDVTDRVQLTPVAIREGQ
    AFADTVFGEKPHRVDYGAIPSAVFSNPPMAGVGLTERQAREQFGTVKVFTSDFRAMRNVLAGRTERSLYKLVVHPETDVV
    LGIHMISPDAPEILQAAAIAVKAGLTKAQFDQTVALHPSMAEELVLMK

    >gi|148555725|ref|YP_001263307.1| methionine-R-sulfoxide reductase [Sphingomonas wittichii RW1]
    MRVTVAKNRCGRWLTRVLDPGAGATHIRVMDKVERSDAEWREKLSPEQYHVLRQAGTERAFTGKYWNSKDAGAYRCAGCG
    ELLFESDAKFDSGCGWPSFTAPAEGEAVTEHRDASHGMIRTEVRCARCEGHLGHVFPDGPGPTGLRY
    CINSASIDFEKK

    >gi|148555752|ref|YP_001263334.1| methylated-DNA--protein-cysteine methyltransferase [Sphingomonas wittichii RW1]
    MTTTLLPSPLGPILIEADARWLRAIHILGDRTAPDDIDDAPAEGPAAEAIRQLQAYFDDGATAFDLPLLPAATPRGAALR
    DAIVAIPAGDTLSYGALARIAGSAPRAIGQACARNPFPIVVP
    CHRVVGSGGTIGHYSGGRGIITKTWLLDHERRPERRGG
    LL

    >gi|148555773|ref|YP_001263355.1| redoxin domain-containing protein [Sphingomonas wittichii RW1]
    MALAACDSKPNDAPQGGVPAESVGRVDISQRGKEMPAIPFADEKGGPATLTQFRGKPLMVNLWATWCAPCIAEMPTLDRM
    AAEDDRFRLITVSEDLEGAKAVEPFFKEKGFKALTRHSDQQNVLMTALGTETLPTTVFYDAKGKELWRVYGMMDWNGAPA
    KKLIGDAVGG

    >gi|148555808|ref|YP_001263390.1| methionine-R-sulfoxide reductase [Sphingomonas wittichii RW1]
    MTVDRRTLLGAGMAAAVTAIIAGRAFSAPKRAYAFTLSDAEWRKRLSPLAYAVLREEATERAFTSPLNKEHRAGTFLCAG
    CALPLFSSATKFDSGTGWPSFWRPLPRAVDTSTDYKIGVPRSAVSCHRCGGHLGHVFDDGPPPTGQRY
    CMNGAALTFVAK
    G

    >gi|148555821|ref|YP_001263403.1| iron-sulfur cluster assembly accessory protein [Sphingomonas wittichii RW1]
    MGLEFEPMTTTTRPRPAALILTPSAEARIAALMAAAPEGAIGVKLSTPRRGCSGLAYSVDYVTEADPFDERIETPGGTFY
    VDGGSLLYLIGSTMDWVEDDFTAGFVFANPNAKGSCGCGESFTV

    >gi|148555865|ref|YP_001263447.1| OsmC family protein [Sphingomonas wittichii RW1]
    MATKILYSTSSTATGGRDGRARTADGSFEVTLGTPKELGGNGQGNNPEQLFASGYAACFLGAMKFAASQGQHAKVPADAT
    VTATVGIGPRADKGFGLAVALEISLPGVDRAAAEALVAEADTI
    CPYSHAVRGNIEVKLSVA

    >gi|148556066|ref|YP_001263648.1| 1-Cys peroxiredoxin [Sphingomonas wittichii RW1]
    MTIQLGQIAPDFEQDSTHGRLRFHDWLGPSWGVLFSHPRNFTPVCTTELGEVAKLRPEWDRRNVKPIGLSVDPVDAHRIW
    EVDIAETQGAKLDFPMIADPDARVSSLYGMIHPESDPTVTVRSVFVIDPARKVRLILTYPPSTGRNFAEILRAIDSLQLT
    DARSIATPVNWAPGEPVVISPKLSDEEASRQFPQGYKTLKPYLRIVDLPVSGQ

    >gi|148556134|ref|YP_001263716.1| OsmC family protein [Sphingomonas wittichii RW1]
    MAPSAARHSPLNPLAGRRTPPFEGGRSMRSKTSLYRARATAIGGRVGGAASADGRLRVRLDDPADPVGRGTNPEQLFAAA
    YAACFLSALRRAAAEEGVAIAPDGNVTAEVSLSDDADAALSVDLSIDLAGLDDAVAARLVAAAHAR
    CPYSKAMRGDARVD
    VRIV

    >gi|148556154|ref|YP_001263736.1| methylamine dehydrogenase accessory protein MauD [Sphingomonas wittichii RW1]
    MNGMFLAAFALQWVVIVAMGLLMLGLFRQVGMLHERLGPVGALTLSGGSKVGEVAPSFDLPSLTGGEVRVGGATADGRST
    LLFFVSPT
    CPMCKSMLPVLLSIARENADTTRLVFASDGDEPAQMKMIVQQKLADYPFVLSTDLGRAHGVGKLPYAVLLGA
    DGTVASKGLVNNREHVESLFEAQRTGIASIQEYAARRDAQRVHTGAAK

    >gi|148556162|ref|YP_001263744.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingomonas wittichii RW1]
    MPETLIAQFDALHAERLRSWDPDKLRRNVEQRAALVAAFDPARIVAVGDRLEPFSLELSTGETVTLDRLTSRGPVALVFF
    RFAG
    CPACNIALPHYDRTLRPFLDAAGIALVGVSPHLPETGLSEIEARHGLGFPVAADRGNALARRLGIAFTPHDDPPVP
    QGDSHWIGALTGTGSWELPQPAVILIDADHVVRFVDVSPDWLRRTEADTVIAAVRQRAQAA

    >gi|148556452|ref|YP_001264034.1| peptide methionine sulfoxide reductase [Sphingomonas wittichii RW1]
    MTDSPNRPLIAGISAGVLLLVAAGTMATRSPAVAPAPRVDPGPIVRVPAPAVDPAEQGATATAVLAGGCFWGVQGVFQHV
    DGVSSAVSGYSGGVAQTADYETVGTGTTGHAEAVKITYDPRRISYGTLLRIYFAVVADPTTLNRQGPDRGPQYRTAIFPT
    TKQQQAVAQAYVAQLGTAKLWKTPIVTKVELYRGFFPAEKYHQDFLTRKPDYPYIVYNDLPKVEALKVAFPTHFRKQAVT
    VYPVG

    >gi|148556489|ref|YP_001264071.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingomonas wittichii RW1]
    MALTVGDKFPSFVLPVQQGVSALPAGETIDTGDTGGKWKVVFFWPKDFTFICPTEIIGYGELQKDFADRDAVLIGASTDT
    DFVHFAWRKSDERLANCDFPWIADNQKKLADALGIVDADAGVAYRATYIVDPHNVIQHVTVNGLNQGRNPQEAIRVLDAL
    QTDELCPCNWKAGDEVLKPAA

    >gi|148556500|ref|YP_001264082.1| DSBA oxidoreductase [Sphingomonas wittichii RW1]
    MATPIKIDFVSDISCPWCVIGLRGLEQAIERTGGELAAEIHFQPFELNPAMAKEGENLAEHVAHKYGSTPEQSAATREMI
    RDRAAQVGFAINHGPDSRIYNTFDAHRLLHWAGTLGGERQRALKHALFESYFTEQRDPSDRAVLIDAAAEAGLDRDEAAA
    VLASDRYAAEVRDAEHLWQRRGVHSVPAIIVDDRYLISGGQPADVFEQVLRSIAAEKAPA

    >gi|148556560|ref|YP_001264142.1| glutathione S-transferase domain-containing protein [Sphingomonas wittichii RW1]
    MSARRSRRAMPARPIFYSFRRCPYAMRARLALQVSGTVCELREVKLSAKPAALIAASPKATVPVLHLPDGEVIDQSLDIM
    RWALGQADPEGWLDRADAALIAANDGPFKHHLDRYKYPDRHGSDSAEHRTAGLGLLAALEERLARTAHLDGPARGLTDAA
    IFPFVRQFAETDRAWFDAQPMPHLHDWLARQLGSALFAAAMVRPDPWRPGDPPLLFPAG

    >gi|148556569|ref|YP_001264151.1| thioredoxin domain-containing protein [Sphingomonas wittichii RW1]
    MSAADREAIEAFKRDVVEPSMTSLVILDFWAEWCGPCKALAPVLEKVAADYADKGVVLAKINVDEQKMIAAQFRVQSIPT
    VYALFQGQLVADLTQARGESQLKQMLDQILRQLPIQGAADKMHEDIAPLIAMGEEVLEAGDVERALSVFGQLVEMAPDDV
    EVIGGLARAMVKAGQVDEAEALLGQLPPEKTKEAPIARAQAAVALAREAAPVDDLGPLRAKVAANPDDHEARFELAGGLM
    AAGDRDGAADNLLEIIARDRAWNEDAARQRLIKLLEVVGLEDPWVREQRRRLSALLFT

    >gi|148556624|ref|YP_001264206.1| rhodanese domain-containing protein [Sphingomonas wittichii RW1]
    MFGFKKRDAHREIGPAELDAMLKDGKALLIDVREAGEFATGHIAGAVNMPLSGFSPRNIPDPEGRTVVLQCAGGRRSGQA
    LDQ
    CAQAQSAIDTHLAGGIGAWKDAGLPVLGG

    >gi|148556634|ref|YP_001264216.1| redoxin domain-containing protein [Sphingomonas wittichii RW1]
    MISVGPLALALERLFAVLGIVAFMAAASWIGRRHGKDSDKAAWRALLVGLVAARAGFVGQNWSAFAVEPLSIFYVWQGGF
    FPLAGLAAAAISLVLSLRRSPALFPTGMAFVGSAAAALIATSLFLASSQRPLPQGLVLHSLAGEASALDDRKGKPFVINL
    WASW
    CPPCRREMPMLIEEAARSPVPILLANQGEDATKVRTWLDGQRLTSAHILLDSDQSAAAAIGSAGLPATLFVDSKGV
    IRELHVGEISRAALLAGLRELD

    >gi|148556642|ref|YP_001264224.1| 1-Cys peroxiredoxin [Sphingomonas wittichii RW1]
    MNPSANESGVCSPVQIGDAAPNFQARTTLGEMSLSDYRGRWVLLFSHPADFTPVCTSEFVALSRAGERFKALNCALVAIS
    VDSLYSHLGWIRAIHEHFGVTVGFPIVEDPSMVIGRAYGMIADDAPDAATLRATFFIDPDGIVRAKLCYPATIGRSVEEL
    LRVVAALQMVDSDNVVTPEGWRPGDDVLLPPYQDQDSALDAAGDACWFHRTRPDKHKKAGK

    >gi|148556643|ref|YP_001264225.1| thioredoxin [Sphingomonas wittichii RW1]
    MSESQLVVCPVCASINRVPAAKIGAAPNCGRCSMPLFQGQPVDVDATAFDRHVGRGSLPVLVDFWASWCGPCRAMAPAFK
    AAAAELEPHVRLLKVDTEAEQGISGRYRIQSIPTLILFKGGREIARQAGAMDRARLVAWVRQALAAA

    >gi|148556644|ref|YP_001264226.1| 1-Cys peroxiredoxin [Sphingomonas wittichii RW1]
    MTDVAAPSMPRINEPAPAFKAKTTHGERSLDDYKGKWLVLFSHPADFTPVCTTEFMGFAKAADRFKALNCELLGLSIDSV
    HSHIAWMRSIEEKFGVEITFPIIDDLSMNVARAFGMIHPGASDTSAVRATFLIDPEGVIRAMVYYPMSNGRSVDEFVRLL
    TALQTSDANKVATPENWQPGEPVIVPPPATAEAAKARKDEGYDYTDWYFSKKTL

    >gi|148556676|ref|YP_001264258.1| rhodanese domain-containing protein [Sphingomonas wittichii RW1]
    MCVRNEEEMMDMLVSTEWLAGELGANDLRVVDATYFALDPARDAQADYEAGHIPGAVYLDLANLKDDMSELPGMLPTAEK
    FASRMQSLGLGDGSRIVLYDNSLHRTAARAWFMFRMFGANEVAILDGGLQKWVAEGRPLEQGKVALRHRHFTVWRDPAQV
    RDLGQMKANVASGAEEVVDARSEKRFTGEEGDPRGLAAGHIPGSKNLPFDRLLDADGTFKDKGELQAAFDAAGVDGAKPL
    VTT
    CGSGVTASVVLFAAALLGREDIALYDGSWSEWGLRPDTEKAIGPA

    >gi|148556751|ref|YP_001264333.1| DSBA oxidoreductase [Sphingomonas wittichii RW1]
    MMIRDFMTRHRRIAATIGAGSAVLIGVGAAMLAHSRRAPEPPADKARIEMVVRDYILAHPEIIPQAIEKLREKQGKDAYA
    ANKAALETPYESAWAGDRDGDVTLVMFTDYA
    CGYCRSSLPDIDRLLADDPKLKVVWREIPILGPGSEIAAKASLAAARQG
    AFRTFHERMFAAGRPDGAKVSEVLRSMKLDLAKVQRDVDSPEVMAELRKNLELAGRIDESLATPTFLVNGRMLKGAVGYD
    ALREAIAEARKRA

    >gi|148556813|ref|YP_001264395.1| iron-sulfur cluster assembly accessory protein [Sphingomonas wittichii RW1]
    MDATPDIDLTPSAAARVALIAGKTGKPAILRLAIDGGGCAGFQYKFELADAPAEDDTVATRDGVTLVVDPMSLDLVRGGA
    VDYVESLGGAAFRVTNPNAASGCGCGSSFSV

    >gi|148556821|ref|YP_001264403.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphingomonas wittichii RW1]
    MLKEGDKAPDVTLDLPDGSKTSVAEQAGKILVLYFYPKDDTPGCTTEAQGFTALADDFAKAGATIIGVSKDSAARHQKFI
    DKYGLKIRLASDGDGSVCEAFGTWIEKSLYGRQYMGIDRATFLIGKDGTIARIWRKVKVKGHAEDVLAVAKTL

    >gi|148556892|ref|YP_001264474.1| periplasmic protein thiol--disulphide oxidoreductase DsbE [Sphingomonas wittichii RW1]
    MRKLLIWLPLALFLVFLGVFASGLISPESKTIPSKLVGKPMPGFALAPGVPGKPGLTSAELTNGRPHLVNVFASWCVPCI
    AEAPQLRQLAEAGVPVYGIAIRDRPEDLARFLERNGDPFRAIGGDPNSSVQIALGSSGVPETFIVDGKGIIRRQHIGAIN
    PEDVPGIMSALGDAR

    >gi|148556927|ref|YP_001264509.1| thioredoxin reductase [Sphingomonas wittichii RW1]
    MTASHSTRMLILGSGPAGLSAAIYGARAGLAPIVVQGLQPGGQLTITTDVENYPGFRDVIQGPWLMQEMQAQAEHVGATM
    MWDTIVDVDLSERPFRLRGDGGTLYVCDTLVIATGAQAKWLGVEGEAALGGKGVSA
    CATCDGFFYRGKKVAVIGGGNTAV
    EEALYLTNHSQDVTLIHRRDSLRAEKILQDRLFAHPNVKVLWNKQVDRFVGGSGNEGLVAIALRDTETGETSELAVDGGF
    VAIGHSPATELFRGHLELDEDGYLVVEKGGTRTSVPGVFGAGDVSDKVYRQAVTAAGMGCMAALDVERFLAEADFEARAT
    VAA

    >gi|148556976|ref|YP_001264558.1| glutathione peroxidase [Sphingomonas wittichii RW1]
    MTTVYDFSARAIDGSEVPLDRWRGKVLLIVNTASQCGFTPQYAGLEMLHEQLSDRGLVVLGFPCNQFGGQEPGSEAEIDA
    FCRTSYDVRFPMFAKVEVNGPAAHPLYGWLKSNARGILGTEGIKWNFTKFLIDRSGQVFSRYAPTTKPEAIRGEIEELLE
    DA

    >gi|148557000|ref|YP_001264582.1| alkylhydroperoxidase [Sphingomonas wittichii RW1]
    MNATSAPRYEQETPDIIKAFTDAQAAVGGHGLEPLLRHLVMLRASQINRCGFCVQMHTREARADGESDERLDRVIVWDQV
    RDFSEREKAALAWTEALTVLDHHSDLGALRARLREHFSEEEIAALSGLIAMINLWNRIGISRH

    >gi|148557017|ref|YP_001264599.1| glutathione S-transferase domain-containing protein [Sphingomonas wittichii RW1]
    MLRLYYGPNACSLASHIALEESGLAYERTAISIFDGEQKSSAYLARVPTGKVPALEIDGHVLTENVAIQAYVAAAAPSAR
    LMPDDPLSAAVALSRLAWFSNSVHISFRHMMRPMVLTAEETAHAGIAARGKEDFLHNLRRIEAMLEGGPWLMGDRFTLCD
    GYAMVFFNWASFAGLDLSPLPALRRHAARMIERPAVARVLTIEGSLDRIAEAVR

    >gi|148557260|ref|YP_001264842.1| methylamine dehydrogenase accessory protein MauD [Sphingomonas wittichii RW1]
    MQLRRPAEDRHPLSGPPCRAPRLAGDRRGAVAGRHAGRARPVRGACLLRPLSGRRRARRGFLHWQEPCSMTGFALASQIM
    LWIAVGVLGVLVMALARQVGVLHERIAPAGALTLHQKVSVGDKGPEMELTALDGARVRIGGRREGRSQLLFFLSPD
    CPIC
    KTLMPVLRSAARAEAGWVDTVLASDGEDEAEHRRLVMKQELAGIPYVLSETLGRSLGVSKLPYAVLLDEQGKIASLGLIN
    NREHLESLFEAKERGVASIQQFLAGA

    >gi|148557272|ref|YP_001264854.1| arsenate reductase and related [Sphingomonas wittichii RW1]
    MTITMYGIKNCDTIKKARTWLEGRGVGYDFHDYKASGIDRATLKKWAGVVGWEVLLNRAGTTFRKLPDADRADIDEAKAI
    ALMEAQPSMIKRPVLDAGGELLVGFKPDAYEKTLG

    >gi|148557585|ref|YP_001265167.1| protein-disulfide isomerase-like protein [Sphingomonas wittichii RW1]
    MISILVRAALSLALLSPAALVAATPAKPAVAAKSGVAAKKNWLAMTSRTAEGAIVVGNPAAKVKLVEYLSLTCPHCADLS
    TQSMPALQRDYIAKGLVSFEVRHAVRDGYDFAASLLLRCEPPTRYLESLEALFATQGNWMEKALTAKDIPGFDGKSGDEK
    MAAVAKAAGFDAFFAKRGVTPKAYAACMADTKAKEQLGQMAGYAWQRDQIPGTPLVLINGQRQEAVHGWADLEPLIRGAL
    K

    >gi|148557586|ref|YP_001265168.1| protein-disulfide isomerase-like protein [Sphingomonas wittichii RW1]
    MKKLLPVAAIGLALALTACGKKDADNAATNTVAPAAPSAPYTGKDWTATLVKTPEGGFRMGNPDAPVKLVEYASITCPHC
    RDFSKVGGDPLRQTYVRTGKVSWEYRNFVLNPLDVAATLVARCQGAETFFPFIDQLYATQTEWVGKFNSVDEATLRSVGG
    LPQQEQFTKLIELSGLGDFFKERGVPADRIQACLSDKAALAELLKIRDHGANEDKVDGTPNFLINGERQEGVYDWPGLEA
    KLRERVR

    >gi|148557590|ref|YP_001265172.1| arsenate reductase [Sphingomonas wittichii RW1]
    MKATIWHNPRCSKSRETLAILEAAPGVEVEVVDYLKTPPGRARIAEMYRKAGMTAAEGLRKAEDGAKLLKGASEDAILDA
    MAADPILIERPLVETPKGVRLGRPPEKVREIL

    >gi|148557605|ref|YP_001265187.1| glutaredoxin-like protein [Sphingomonas wittichii RW1]
    MSDDVQARIATAVHSADVLLFMKGTPLFPQCGFSSRAIAILDHLGVEYATVDVLQDPAIRTGIKEFSDWPTIPQLYVKGE
    FVGGSDIMMEMYEAGELLDLLDQNGIAHA

    >gi|148557615|ref|YP_001265197.1| glutathione S-transferase domain-containing protein [Sphingomonas wittichii RW1]
    MWQLYQFPLCPFSRKVRLQMEEKGIAYDLVRESPWLRRDEFLDLNPVGQTPVLVDPGSGVTLIHSCAISEFIEETIEPVP
    MLPGSAAARGEIRRLVAYFDEKFYADVVGPLLYERALKRIVHRAPPDAGVLRQAMKAVNDHLDYIDYLVGSRRWIGGQLL
    SLADLACAAHLSVADYLGGIDWRGHEETKQWYSGMKSRRSLRTILSERMELVSPPEHYEKPDF

    >gi|148557739|ref|YP_001265321.1| hypothetical protein Swit_4846 [Sphingomonas wittichii RW1]
    MDLRPAPALITSGWLNSPTPLDIPDFRGRVLVIEAFQMLCPGCVEHGLPQIQRVARTFPADQLAVIGLHTVFEHHAAQGT
    REALAAFAHEYRLGFPIGIDRQDGALPATMTAYGMQGTPTLIVVDRNGFRRFQRFGHIDDLALGSILGTLLAEPAAASAM
    ADPAGGCDATGCAVPPAA

    >gi|148557771|ref|YP_001265353.1| UBA/THIF-type NAD/FAD binding protein [Sphingomonas wittichii RW1]
    MSLTDEQLDRYARHIILKEIGGAGQQALLKATVAVIGAGGIGSPAIQYLAAAGIGLLRVIDDDVVDLSNLQRQTLFGTAD
    IGCPKAEVAAARVAAMNPDVLVEPVTVRIDADTADDLLEGADLVLDGCDNFATRLAVSDAATRLGIPLVSAAVGQFDGQL
    GVWRGWEADKPCYRCLVGDDPDRPDIS
    CADQGVLGALTGVMGSLGAMEAVRAITGFGDDPAGRLLLVDALAFRFRTIAVP
    KDPGCRCAG

    >gi|148555729|ref|YP_001263311.1| electron transport protein SCO1/SenC [Sphingomonas wittichii RW1]
    MAGRTMNNPILSRALAALLLLAAPPLLSGCGPARETPPLADAKIGGPFTLTDQDGRKVSDGDFAGKYRLIYFGYTFCPDV
    CPVDVQTLMKGYRKVEASNPALAAKIQPIFITVDPARDTPAVLKQFVRAFHPKLIGLTGSEAEIAAVAKEFAIYYKKQQG
    SPGTPGYLVDHSRQAMLFDPQGKPLALVAQDKDADTVAADIERWAR