Sphingobium japonicum UT26S uid47077

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|294010025|ref|YP_003543485.1| peptide-methionine (R)-S-oxide reductase [Sphingobium japonicum UT26S]
    MDKLNLTDAEWRERLSPEQYHVLREGGTERAFTGKYNSNKADGLYLCAGCGAELFDAEEKYDSGSGWPSFTAPVDIDAVD
    EIRDTSHGMIRTEVRCSNCDGHLGHVFPDGPGVNGLRY
    CMNSASLDFKSRDEAG

    >gi|294010042|ref|YP_003543502.1| uncharacterized protein Sco1 [Sphingobium japonicum UT26S]
    MAGGAMNKALISLTLPFAALLAACNMGAGGNASSGDDSAQGDLHGASIGAPFTLTDQDGKKVRWDDFKGRYRLVYFGYTY
    CPDVCPVDLQRILQGFAKFEKAKPALAARVQPIFISVDPDRDTPAVLKTYVAAFHPRLIGLTGTPDEIAKVAKDFVVLYN
    KEEAKGASGYLVSHSRTPYLFGGDGEPVALVPVDDPGTPDADEGDPAKVTAFLEKWVK

    >gi|294010075|ref|YP_003543535.1| protein-disulfide isomerase [Sphingobium japonicum UT26S]
    MTKLRLALLPLLAVPASLAAAPAANWLARIALSPIGGHVLGNPGAPTKLVEYVSYTCSHCAHFVKEASEPLRAGYVKGGK
    VSVEVRNAVRDKYDLAAALLARCGGPGRFFGNHEALFANQDAWMEKLIAYDKDATKPTEEKAALRDIGQKTGLYALMGKR
    GFKPAQLDACIDDPASMKQILAMTDEAWNKLRIGGTPAFTLNGALVHGSDWTRLQAALP

    >gi|294010076|ref|YP_003543536.1| protein-disulfide isomerase [Sphingobium japonicum UT26S]
    MKALSGLALIALSLTVAACGKKEEGGATSAQPVAAVAAPAGTTWSETIAATPEGYFLMGNPDAKVKLVEYGSYTCSHCRD
    FAAESAEEIRQIVDSGKMSFEFRNYVRDPIDISTALLARCGGKDIFYPLSDQFFANQNAMFEKAQALGDERYKALMSAPP
    AQRFGQLAEAIGLVDFAKQRGIAEDQAKQCLADTAAAEKLAKTVEDANRQYKIEGTPTFILNGVMVENTAAWPALRAKLK
    EAGI

    >gi|294010095|ref|YP_003543555.1| OsmC-like protein [Sphingobium japonicum UT26S]
    MIVVERIDPDGGTAHRISIRGHELIADMSAPDGHDAGPDPHDLYDSALGACKAMTMLWYAQRNGIPVEGIHVGVVRDASQ
    ERKGVYKLTTRIALSGPLSAEQHDRLIAVAAKCPVHKLMSEVETQIETIAVPYVGEGERP

    >gi|294010292|ref|YP_003543752.1| peptide-methionine (R)-S-oxide reductase [Sphingobium japonicum UT26S]
    MAGPMNRRRFLGMGGCAATMIVLWQAGLGRAAAYPFTLSDAEWRRRLSPLAYQVLRKRSTEHPFTSPLNKEHRPGVFACA
    GCGQRLFSSKTKFDSGTGWPSFWAPLPRAVGTSRDFELGYPRTEVHCARCGGHLGHVFDDGPKPTGKRY
    CMNGVALAFVA
    G

    >gi|294010411|ref|YP_003543871.1| arsenate reductase [Sphingobium japonicum UT26S]
    MSNAAIDIVIYHNPECGTSRNTLAMIRNAGIEPHVIEYLKTPPNRPRLVSLIARMGISARQLLREKGTPFAELGLADPTL
    SDDQLIDAMIEHPILINRPIVVSPLGVKLCRPSEEVLDLLPSAQRGAFTKEDGEQVIDAAGKRIGA

    >gi|294010553|ref|YP_003544013.1| putative dehydrogenase/reductase [Sphingobium japonicum UT26S]
    MASERFDFLLLGGGLASATAAETLRREGAIGTIGILSAEEFPPYHRPRLSKQYLIGTSTDVDILVHPVDYYRQQNISLVL
    GAEVTAVDPASRTVRTDDGDSFEYGKLLIATGAAPRRLDVSGADKEGVFYLRRKVD
    CDVVRKAAQPGRKVVVLGASFLGM
    EIALSLIELGLEVTMLDIATRVLPHLEAPAISTFFQGYAEGKGATILLDDTAVEVIGDGHVAGVRTQKGREIPCDMVIVS
    VGVMPATSFLDGSGILLEHGFVAVDDRLRTNTEDVFAAGDVTSFYDPVFRRRRHIEHWDNAVRQGRLAARNMIGRRLRYD
    EVSYFYCEMGELGFDMLGIPENAEDWISRGDLKDGSYALFYLRDDVPQAAFSMGRPSSEIRVAEGLIRYRVNLERYRDQL
    GDPAYLLETIPAQKVLVLQGGGALGAFECGVVHALEEEHIFPDIVAGVSIGALNGAIIAGNPRHSTEALQSFWNDLTVVA
    PPLPFAEMRRAAVGAQILAFGVPKFFKPRWMPPFDFLAPWTGYYDTSPMRRLIAQYVDFSSLKSSPVRLLVGAVNVTTAQ
    LEVFDSYIDDLTPDHVLASGSLPPGFSWTVVDGTAYWDGGIVSNSPLDLVLDRCGPDGKRIYIVDLFAGDAPLPTNMIEV
    LARRDEVVYSERVRSDLRIREMTDAYRSMINIILSGIDQVERAKIMRHPRFIQLMGDGFTNEITRFQRPRRPGEASSRDY
    DFSDESIRRLQAEGYDLVKQTLVKTSKAGVSATPKASSALEEIKHAEAAAGTAAGRSLSGADAVLQTIAQAAPVLGTPRK
    RKSKKESP

    >gi|294010676|ref|YP_003544136.1| thiosulfate sulfurtransferase [Sphingobium japonicum UT26S]
    MDILVSTDWLEGELGKPDLRLVDASLFLPGVPRDPRAEFEAAHIPGAAFLDLPTLADPDDPRPGMLPTDDFMTERCRRLG
    IDADSRIVVYDNSPTHSAARGWWMMRLYGVGKSAAILDGGLPKWLAEGRPTESGMPTPPPGNAVAKRAADQVRTKEDLLA
    NVESQAEQVLDARGAPRFTGEEKEPRPGMASGHIPGSRNIPSSAFYHADNSMKRGEELRRLFLDAGTDFDRPIITS
    CGSG
    VTAAILLAGLELLGKTDVTLYDGSWSEWGLDPATPKATGPAA

    >gi|294010749|ref|YP_003544209.1| DsbA oxidoreductase [Sphingobium japonicum UT26S]
    MTDQSRPGFRAALSNRTMMMTLGVFAFIAATATGAALGTQSTGRVDASDKAAIERIVHDYILEHPEIIPQAVEKLQAKRM
    SGAIDASRQTIETPYAGAWEGAAKGDVTVVEFFDYA
    CGYCRASLPDLARLVGEDKGVKVVYRELPILSDESIDAAKVSLL
    AAEKNQYMPFHRALYAAGKVTRETILAAAAKVGIDAKAAEAAIAGGKYDAEIQSNIGLAQKLQASGTPTFVIGGQVLNGA
    VGYDALKAAVSAARGK

    >gi|294010761|ref|YP_003544221.1| peroxiredoxin [Sphingobium japonicum UT26S]
    MMRSLNIALALAAAAVGSQGAMAALAIGAKAPDFTTRGAMAGKTFTLTLSHQLKRGPVVLYFFPKAFTPGCSAEAREFAE
    HIEDFRKAGATVIGMSADPVDDLVAFSTKECAGKFAVASAGPNIVSGYDVALKMRPGMTDRTSYVIAPSGRIAFVHSEMN
    YAGHVKSTLAAVEAMKQK

    >gi|294010803|ref|YP_003544263.1| peptide-methionine (S)-S-oxide reductase [Sphingobium japonicum UT26S]
    MRRADGIALAFLAALAVASPLRAERPVLAPIPAVDAVPARKLETAIFAGGCYWGVEGVFSHVKGVRLAVSGFAGGPRGRR
    VDYEQVSEGDTGFAESVRVTYDPRQVSYGTLLRIFFSVIADPTTLDYQGPDHGTQYRSALFPLNAEQERAARAYLVQLGQ
    SGLWRDPIVTRIERFTGFQDADDYHQDFLRKNPRHPYVQRWDIPKLTALKALFPAFYSDRPSA

    >gi|294011239|ref|YP_003544699.1| peptide-methionine (S)-S-oxide reductase [Sphingobium japonicum UT26S]
    MQDKDAHMAEEIATLAGGCFWCTEAVYQNLKGVKAVESGYIGGMLPDPTYEQVCSGATGHAEAIRITYDPAVIGYGDLLD
    IFFATHDPTTLNRQGNDVGTQYRSAIFPHSPEHAAEARAGIERAQADWANPIVTAIEPDAPWYPAEDYHQKYWERVGDRN
    PYCMAVIPPKLAKLRKGFAERIEAS

    >gi|294011517|ref|YP_003544977.1| hypothetical protein SJA_C1-15310 [Sphingobium japonicum UT26S]
    MTAKLDPFAAAPQLMKSWFATSTAINASLEPSLIELVKIRSSQINQCANCINMHTAEARAQGESEQRIYLLSAWREAPCY
    TARERAALQWTEALTRLSEGHSHEAAHEALAAEFSEEEQVKLTLMINVINGWNRIAVGFGLWHDTPARAAA

    >gi|294011617|ref|YP_003545077.1| ArsC-family protein [Sphingobium japonicum UT26S]
    MTDIVIYHNPECGTSRNALAMIRNAGMEPHVVEYLKTPPARALLVQLIERAGMSPRDLLREKGTPYAELGLDDETLTDDA
    LIDAMMAHPILINRPLVVTPLGVKLCRPSEVVLDILPAQQRGAFAKEDGEQVVDADGNRIRPA

    >gi|294011637|ref|YP_003545097.1| thioredoxin 1 [Sphingobium japonicum UT26S]
    MATKAVTDLSFQQDVINADKPVLVDFWAEWCGPCKMIGPALEEISDELADKVVIAKINIDENPDAPGRYGVRGIPTMILF
    KNGEAAATKVGAAPKSALKGWIESVL

    >gi|294011672|ref|YP_003545132.1| peroxiredoxin [Sphingobium japonicum UT26S]
    MTISKGERVPSTTFVKMTENGPEQVASDDFFAGRTVALFSVPGAFTPTCSARHLPGFVEKAEELKGKGVDEIACTAVNDA
    FVMGAWGKSANADGKVTMLADGNGEFAQAVGLTMDGSKFGLGTRGQRFSMIVKDGVVAELNVEAPGDFKVSSAEYLLDQI


    >gi|294011695|ref|YP_003545155.1| glutathione reductase (NADPH) [Sphingobium japonicum UT26S]
    MSDYDFDLFVIGAGSGGVRASRVAAAHGAKVAVAEEYRVGGTCVIRGCVPKKLLVYGAHFAEDLKDARRFGWNVPDCGFE
    WTTLRDNVLADVDRLEGLYRNTLDNHKVELIPERATITGPHGVRLASGREVSAKYILVSTGAWPIVPDIEGAEHGVTSNE
    VFHLDE
    CPKRIVIVGGGYIANEFAGIFHQFGSHVTMVNRSGTLLRGYDAQIRDRLLQISTMKGINFRFNAEMEKIEKKED
    GTLTVRFKSGDPIACDLLLFATGRRPHVEGLGLENAGVELSDKGAIKVDDYSRTSCESIYAVGDVTDRMQLTPVAIREGH
    AFADTLFGDNPRTVDYACVPSAVFSHPPLAGVGMTEAEARNKLGTVKIYTSDFRPMKNVLAGRDERALYKMVVDATTDRV
    VGLHMIGPDAPEILQAAAIAVKAGLTKQAFDDTVALHPSMAEELVLLK

    >gi|294011734|ref|YP_003545194.1| cytochrome c biogenesis protein CcmG [Sphingobium japonicum UT26S]
    MRKMLIWLPLALFLGFFGLFASGLLRPDDRIISSKLVGKPLPAFALPAAASDRPPLASSQLATGKPRLLNIFASWCVPCA
    AEAPQLLALKQAGVEIDAIAIRDARPDVDAFLQRYGNPYSRIGLDARSEVQIAMGSSGVPESFIIDGKGRIAYQHVGDIR
    EDDVPMILDRLRKAQ

    >gi|294011847|ref|YP_003545307.1| glutathione reductase (NADPH) [Sphingobium japonicum UT26S]
    MLTYDYDLFVIGAGSGGVRAARVSAAYGARVAVAEEHRVGGTCVIRGCVPKKLLVYGSHFAEDLQDARRFGWKVPDCEFD
    WSALRDNVLAEVSRLEGLYTETLGNNKVEIIRERATVAGPHEVLLGSGQTITAGKILIATGAWPIVPHFPGAEHGITSNE
    VFHLDTFPKRVVIAGAGYIANEFAGIFHQFGAHVTLVNRTDVILRGYDEQIRDRLLQISMTKGIEFKFHVAFEKVDKQPD
    GSLLVHMTGHEPIPADMLLFATGRRPHTENLGLETADVALDAKGAIKVDDDNRSSCASIYAVGDVTNRVQLTPVAIREGQ
    AFADTVFGNNPRRVDYGCIPSAVFSHPPMAGVGMTEAEARNKLGEVKVYTSDFRAMKNVLADRHERALYKLVVHPETDVV
    VGIHMIGPDAPEILQAAAIAVKARLTKAQFDDTVALHPSMAEELVLMR

    >gi|294011960|ref|YP_003545420.1| alkylhydroperoxidase AhpD core [Sphingobium japonicum UT26S]
    MSRITVPAREAAPAASQPLLDAVEKQLGVVPNLFRLVALSPAALQGFLGFNGALSKALDVKTRERIAITVAQANGCDYCL
    SAHTYLGLNLAKIDNTEIALNRRGASSDPKANAAVAFARKITENHGRAAEADLQAVRAAGYTDAQIIEIIAVVAENIYTN
    MVNIVAGTEIDFPVVLASEAA

    >gi|294011968|ref|YP_003545428.1| peroxiredoxin/AhpC/Tsa family protein [Sphingobium japonicum UT26S]
    MTLQQTLATIAKSGLPLQGKLDALKYEFDNNLAPPAAVEVLHRSTDELIASGAQDRALKVGSIAPEFTLPDPDGNPVSSK
    VLLEYGPLVVTFYRGAW
    CPFCNFDLSALEEARSEIEARGATLVAISQQTAPNSRKSQRQNGLGFPILGDHGGEIAA

    >gi|294011970|ref|YP_003545430.1| peroxiredoxin/AhpC/Tsa family protein [Sphingobium japonicum UT26S]
    MSLRAELRAFHADFMGQVPAEIAAAMTQADLDLSATGILDRALKAGDRAPHFTLPNSTGGVMSLAGAIKDGPVVLSFYRG
    GW
    CPYCNLELRALQKALPDFTALGASLIAVSPQTPDESLSTAEKNDLAFAVLSDTGSSTAKAFGIAFDLAKELRPIFTKF
    GQALPDRNGDGSWMLPLPATYVIDRDGIIAFAYVDVDYRNRLEPATIAATLAALARRKVA

    >gi|294012027|ref|YP_003545487.1| methylated-DNA-[protein]-cysteine S-methyltransferase [Sphingobium japonicum UT26S]
    MTYAYRTMDSPVGELTLVAGEAGLAAVLWQDDDPRRVRLGPRIERGDHPVLEEAGRQLGEYFSGQREAFDLPLHFSGTDF
    QKSVWAALLTIPFGETRSYADIARQIGKPSACRAVGAANGRNPISIIAP
    CHRVVGADGALTGFAGGLKAKRYLLGLERRF
    P

    >gi|294012048|ref|YP_003545508.1| dihydrolipoamide dehydrogenase [Sphingobium japonicum UT26S]
    MIMAENYDVIVLGSGPGGYVAAIRAAQLGLKTAIVERENLGGICLNWGCIPTKALLRSAEIYHYMQHAGDYGLAATQISA
    DIAAVVKRSRGVAKQLNQGVTHLMKKNKIAVHMGEGKLVAKGRLSVTKDGKTDELTAKNIIIATGARARDLPGTPTDGKR
    VWTYRHAMTPPEMPSKLLVIGSGAIGIEFASFYNDMGADVTVVEMMDRIVPVEDADVSAFLEKALKKQGMTILTGGGVSD
    IQVGANGIKVKLKDKAGKESAAEFSHMIVAIGIVPNTENIGLKELGVAMDERGFLKTDEMCRTNVEGLWAIGDITAPPWL
    AHKASHEGVIAAEAIAGKHPHAMDPRNIPGCTYCHPQIASVGLTEAKAKEAGYEVKVGMFPFIGNGKAIALGEAEGFTKT
    VFDAKTDELLGAHMVGAEVTEMIQGYTIGKTLETTEAELMHTVFPHPTISESMHESVLAAYGRALHI

    >gi|294012210|ref|YP_003545670.1| OsmC-like protein [Sphingobium japonicum UT26S]
    MSIDVKYVTRATATGGRDGEARTEDGRFAVKLSTPKELGGPGGDGSNPEQLFASGYSACFIGALKVAGGQLKIRVPQDVS
    VTATVGIGPRSAGGFGITADLEISLPGVERADAERLVEAAHQI
    CPYSNATRNNLDVGLTIV

    >gi|294012292|ref|YP_003545752.1| glutathione peroxidase [Sphingobium japonicum UT26S]
    MIQQIPLKTIKGADASLADYAGKVVLVVNVASQCGLTPQYEGLEKLYRDYRDKGLVVAGFPANDFGAQEPGSNEEIATFC
    TTHFGVDFPMFEKIVVAGPEKHPLYAALIGAQPNARGEGTQFREKLVGYGITPNPEPEVLWNFEKFLIAKDGSVAARFAP
    STAPDDAGLVAAIEAELAK

    >gi|294012325|ref|YP_003545785.1| NADPH-dependent thioredoxin reductase [Sphingobium japonicum UT26S]
    MTATHSTRMLILGSGPAGLSAAIYGARAGLAPIVVQGMQPGGQLTITTDVENYPGFRDVIQGPWLMEQMQAQAEHVGAQM
    MYDQIVDVDLSERPFRLKGDSGTLYYADSLVIATGAQAKWLGAEGEQLLQGKGVSA
    CATCDGFFYRGKKVVVIGGGNTAV
    EEALYLTNHSHDVTLIHRRDSLRAEKILQQRLFAHPNIRVLWNQAVERFVGGGNPEGLVGVDLVDTVTGHKSHIATDGAF
    VAIGHQPATELFVDKLPMDEGYLLVEKGTTKTAIPGVFAAGDVSDKVYRQAVTAAGMGCMAALDVEKFLAEADFEAVAAE


    >gi|294012415|ref|YP_003545875.1| dihydrolipoamide dehydrogenase [Sphingobium japonicum UT26S]
    MADFDYDVLVIGAGPGGYVAAIRAAQLGLKTACAESRETLGGTCLNVGCIPSKALLHASELYEEAANGALAKLGVKIDKM
    SLDLDTMQGQRKDAVKGLTGGVEFLFKKNKVDWLKGLASFTGANTVQVAGKTVTAKNIVIATGSSVTPLPGVQVDNEGGR
    IVDSTGALELDKVPGHLVVVGGGVIGLELGSVWRRVGAKVTVVEYLDQILPGMDGEVRKEANKIFKKQGFEYKLGTKVTG
    AEVGKKGVTLTVEPAAGGAAEKIEADVVLVSIGRRPNTEGLGLDKIGLELNARGQIETDHDFATKVPGVWAIGDVIPGPM
    LAHKAEDEGIAVAENIAGLTGIVNHDVIPSVVYTKPEIAGVGLTEEAAKEKGAIKVGKFPMLANSRAKTNHEPDGFVKII
    ADAETDKVLGVWIIATVAGTMIAQAAQAMEFGASSEDIAYTCHAHPTHSEAIKEAAMAVTGKPIHM

    >gi|294012476|ref|YP_003545936.1| osmotically inducible protein OsmC [Sphingobium japonicum UT26S]
    MMMNHGEPAGFPRQANRRTIMKINRSGSAVWSGGLKDGKGAISTQSGALDAHPYGFATRFEGVPGSNPEELIAAAHASCF
    TMALSLILGEAGLTAEKMETNAVVTLEQQEGGFAITASRLSLKATIPGADDAHFQELAAKAKAN
    CPVSKLLNAEISLDAE
    LLG

    >gi|294012561|ref|YP_003546021.1| thiol:disulfide interchange protein [Sphingobium japonicum UT26S]
    MRIFHVLLMTMLLLFAPAAARAQGAFGGGAPHIAAELRAESAAPQPGKDAAIAFSMTPEPGWHGYWQNPGDAGLGMTVKW
    TLPKGVAIGPLRYPVPETLLISGLMNHVYEGPYGVLAKLTVAPDVPLGTKLPVRVRADWLACTDKVCVPEGADLALDLVA
    GDGAILPGGRAQFDGWRSHLPRPLGSEASYAIADGRLRLSVPFPAAASARDVHLFALADGLTRYAASQSVTRQGDRLIIE
    TEAGQGLKSDPVQAVLRTGDHVGFLLTARPGAVPAARSVTAQTVLIALGGALLGGLLLNIMPCVFPILGLKAMKLARAGG
    DERTVRREAWAYSLGIILTCLALGGLLLGLRAAGAAVGWAFQLQDPRIILLLLLLVTAITLNLAGLFELSAFGGGDRLAG
    KGGATGAFWTGALVAFVATPCTGPFMGAAMGAALVLPIGAALAIFAGLGLGLALPFLALAHIPALRTRLPRPGPWMGRLQ
    KILAIPMALTALGLLWLLGQQRGVPAILLGLCAATALAIGLWWLGRRQLHGRRGGLAVACAALILFAGTAILLPTHAPAA
    AASEKGLPFDEARLASLRAAGKPVFLYFTADW
    CLTCKANEAAAIDRDETRAAFEKAGVTVMVGDWTNADPAITRFLEAQG
    RSGVPLYLWYAPGREARTLPQLLTPATLTALVS

    >gi|294012588|ref|YP_003546048.1| putative transporter component [Sphingobium japonicum UT26S]
    MIPAFPHAQPVEGLIGGLMIGIAAAIMLLGLGRIAGVSGLAARATGLADSGAPRNIAIAFIIGLPVGALITSLLSGGAPA
    RFPSIGLLLIAGLIVGFGTRLGSG
    CTSGHGVCGVSRLSPRSLLATALFMGSGFATVAVLRLAGAI

    >gi|294012631|ref|YP_003546091.1| glutaredoxin 3 [Sphingobium japonicum UT26S]
    MAKVEIYTKAWCGYCARAKALLNEKGVAFEEYDVTMGGPKRQEMLDRANGGTTVPQIFIDGRHVGGSDDLAALDRQGKLD
    ALLGA

    >gi|294012655|ref|YP_003546115.1| hypothetical protein SJA_C1-26690 [Sphingobium japonicum UT26S]
    MTDIDLTSSAAARVAAIAAKQGKPAILRLAVEGGGCSGFQYRFGLAEAVEADDIMVERDGVTLVVDDVSIDLVRGSAVDF
    VSDLGGKAFKVTNPNATAGCGCGTSFSI

    >gi|294012658|ref|YP_003546118.1| bacterioferritin comigratory protein [Sphingobium japonicum UT26S]
    MLDVGDAVPEVTLKDADGADFTLARYRGKPLVVYFYPKADTPGCTSEARDFTALAADFAALGMPVVGISKDKPARLKKFA
    EKYGLAVTLASDETGAMCEAFGTWVEKSLYGRKYMGIERATFLVGADGKILRAWPKVKVKGHAAEVLEAGQGL

    >gi|294012665|ref|YP_003546125.1| Ada regulatory protein [Sphingobium japonicum UT26S]
    MVGLRQCAKSAKPLFDRKRREAWCVGCGYRLFMSEMRQIDAPMQAMPDADVCWNAFLRRDRGFDGRFVGAVLTTGIYCKP
    SCAARHPRRENMIFLADPEAARAAGFRACLRCRPDEVGRDRLAVEAAVAFIAAAPTPPSLEEVAAHAGYAPHHFHRLFKR
    ETGMTPAAYARSLRAERLKSALEEGGSVTGAIYEAGYNAPSRAYADAERHLGMTPSAWKDGGRGAAIRHAVVPTGLGPVL
    VAGTARGLCRISFDEGEADLRRRFPKAEILPADEGLAALAAQVARLIDDPAAPPDLPMDVSGTAFQQAVWAALRAIPPGE
    TRTYGEIAAAIGRPGAVRAAGTACGDNNLAVLIP
    CHRVLRSDGSLGGYAYGTQRKRALLERERPLGRALIT

    >gi|294012726|ref|YP_003546186.1| peroxiredoxin [Sphingobium japonicum UT26S]
    MALINTTIKPFKATAYKEGKFVDVTDADVKGKWAVFFFYPADFTFVCPTELEDLADIYPTLQKLNVEVYSVSTDTHFSHK
    AWHDTSPAIGKINYYMLGDQSGQITNNFDVMRPGVGLADRATFLVDPEGVIQFMEITSEGVGRNATELLRKVKAAQYVAA
    NPGEVCPAKWEEGEATLAPSLDLVGKI

    >gi|294012727|ref|YP_003546187.1| alkyl hydroperoxide reductase subunit F [Sphingobium japonicum UT26S]
    MLDANLKGQLKAYMANITQPIELVASLDDGAKSRELKTLLEEIAELSDKVSIATGSDRRVPSFMIRRAGTDIGVTFAGLP
    MGHEFTSLVLALLQVGGHPSKAAQDLIQQIKDIDGDFAFETYFSLS
    CQNCPDVVQALNLMAVLNPRIRHTAIDGALFQEE
    VDARKVMAVPTVFLNGEPFASGRMELEQIVAKIDSGAAARAAAKIKAQDPFEVLIVGGGPAGAAAAIYAARKGIRTGIAA
    ERFGGQVLDTMDIENFVSVSRTEGPKFAAALEAHVKDYDVEIMNLQKAAKLIPARTEGGYHEVVLENGASLKGRTVILST
    GARWRQMGVPGEEEYRNKGVAY
    CPHCDGPLFKGKRVAVIGGGNSGVEAAIDLAGIVAHVTLIEYDSQLRADAVLQRKLAS
    LPNVKIVTSALTTRVDGNGERVTGLSYKDRNSGTEHDVELEGIFVQIGLVPNTEWLKDSIALSPRGEIEIDARGETSLPG
    IFAAGDCTTVPYKQIVIACGAGSTAALSAFDYLIRLPATEETAEAA

    >gi|294012810|ref|YP_003546270.1| monothiol glutaredoxin [Sphingobium japonicum UT26S]
    MTDAVQQRIADIVNGNDVVLFMKGTPLFPQCGFSSRAIAILEHLGVAYDSVDVLQDQAIRQGIKAFSDWPTIPQLYVKGE
    FVGGSDIMMEMYEAGELQQLMADQGVAAAN

    >gi|294012856|ref|YP_003546316.1| thioredoxin-family protein [Sphingobium japonicum UT26S]
    MTLLLLAGLGACDKQSPPAGQGPNATSGEATGPAQSGKGAFSYTLDKSKAGTPAPGFTFQNPDGSDAKLSDFAGRPMLVN
    LWATW
    CAPCVAEMPTLDAVAAEYGKQGLAVLTISQDSQGEAVIKPFFEKHPLPHLKGWIDPENQFGFHYNTGMLPTTVIY
    DAQGRETARVVGAMDWNSREGRALIEAAMAS

    >gi|294012880|ref|YP_003546340.1| putative thioredoxin [Sphingobium japonicum UT26S]
    MATLGLSEADKASVEAFRRDVVEPSRNQLVIVDFWAEWCGPCKQLAPVIEKVCADYAAKGVKLVKINVDEDKFIAAQFRV
    QSIPTVYAVFQGQPVADLSQARTEGQFKQYLDQLLSQLPIESEEKAQLEEIAPLIAMGEEMLAGGEPERALSVFQQIAQM
    VPDNADVASGEARALVALGRLDEAEAALAALPADVAKDQAVERARAAIALARDAKPVADLSGIEAKVAADADDHEARFEL
    ANGLMANGDRDGAAEQLLEIVRRDRAWNDGAARAQLLKLFEATGLEDPWVAAQRRRLSQILFS

    >gi|294013218|ref|YP_003546678.1| ArsC-family protein [Sphingobium japonicum UT26S]
    MLTMYGIKNCDTIKKARNFLDNSGKPYSFHDYKVSGVDKAKLEEWVMEHGWETILNRSGTTFKALDAGDKAHIDSEKAIL
    LMMSNPSMIKRPILDLGDRTIVGFKATTYEDALEGVKA

    >gi|294013308|ref|YP_003546768.1| arsenate reductase [Sphingobium japonicum UT26S]
    MKATIWHNPRCSKSRAALAILEAAPGVEVDVVEYLKTPPSRAEIEAVLKKAGVRPSEAVRRGEGVVKEIGLDLSDDKAVL
    DAMAQHPILIERAIVITNKGAVIARPPERASEVL

    >gi|294013360|ref|YP_003546820.1| glutathione S-transferase [Sphingobium japonicum UT26S]
    MWQLFQFPLCPFSRKVRLLLGEKGVGYDLVRESPWEGRDEFLDLNPAGTTPVMVDQEKGVTLIDSQAICEYFEETVEKFP
    LISGTAAGRAEVRRLTAFFDQNFYGDVVGPLLHERMKKRLIERAPPDARVLREAMKRANVHMDYMDYLLDHRAWMAGGTL
    SLADIAAAAHLSVADYLGGIDWAGHETVKRWYAGFKSRPSFRPLLSERMEVITPPPHYEKPDF

    >gi|294013378|ref|YP_003546838.1| hypothetical protein SJA_C1-33920 [Sphingobium japonicum UT26S]
    MTVETKIRSRPAAVILTPAAEQRIADLMAQAPEGTIGVKLSTPRRGCSGLAYSVDYVSEEAKFDEKIETPGGTFYIDGAS
    VLYLVGSTMDWVEDDFAAGFVFNNPNAKGSCGCGESFTV

    >gi|294013497|ref|YP_003546957.1| molybdopterin biosynthesis protein MoeB [Sphingobium japonicum UT26S]
    MTPQPLTDDQLERYARHIVLKEIGGAGQARLLSADVAIIGAGGIGSPAILYLAAAGVGTIRVIDDDAVALSNLQRQVLFG
    TAEIGAAKAESAMAAVARLNPDVKLIPINARIDAGNAVLMLRDADVVLDGCDSFATRLAVADCTQKLRIPLVSAAVGPFE
    GQLATYRGWEAGKPCYRCLVGSPEDAPERN
    CSETGVIGALTGVMGSLAALEVIRALVPFGEDMVGRLLLADLLSMRFRTV
    AVPKDPACRGCAVELCAS

    >gi|294023757|ref|YP_003547076.1| putative protein-disulfide isomerase [Sphingobium japonicum UT26S]
    MTGAKRGLLAASAALAFVGLIAGPASAQSQSAADKDLAKAAAEAEQQLHQTFTNLKFDDFGPAPVKGPIYQAIAGGKIIY
    YAPQSEHILLAAIYDKNGVNVTALAQDASTRRKLGVVDPAKALVIGPAGAPTVIEFTDPD
    CPYCRALEKFWAVKEAEGKP
    VRRLVYFVSGIHPEAAAKAEHILCSPDKAAEFKAIYAGAAPKELHKCLPGRSKVEADAEIVRQVGISGTPTLIVDGRVIS
    GFQQGELEEFLSKPKQEGKAPQ

    >gi|294023774|ref|YP_003547093.1| thioredoxin-related protein [Sphingobium japonicum UT26S]
    MKGSAIVLAAALGLAPLSASAQAQSDPAREGYWWYAPKPEPAEPKPAEEDALVKPAIPPMAELATWTPPKIRKLIEQQRD
    YAATVLTVDAVADFWRLQDFARRKARAFAGVTQLAMLQHPELNSKSANPMVGDARDQLLAYKDDTRRQYLRAHAGEFALV
    MFSRTT
    CGYCRVQWPIVQRFQDEMGWQVTLMDIDRRPELGARFGVEVTPTTMIIRRNSQQRMIIASGVEAYPNLAQMAYQ
    AVRLLTGDIRPEQFMTGAGEEGGFFDALGLGPVSASDPRAAEEMVGGNLISSPPDQKPR

    >gi|294023787|ref|YP_003547106.1| putative glutathione reductase [Sphingobium japonicum UT26S]
    MPQFDYDLFVIGAGSGGIRAARVAAAAGARVAVAEVSRVGGTCVIRGCVPKKMFVYGAQFAKDGRYRERLGWAGTEGTFD
    WQVLRDNVSAEVSRLEGLYRQTLFTHNINLFRGGARIVGPNAVDVAGSHLTAEKILIASGAKPTIPDVHGVEHGITSNEI
    FELESLPRSIVIIGGGYIAIEFAGILNSLGSEVTLLNRTHTILRSYDAELTAKLVDIYRARGIKLLFSTSLVGAERDVNG
    RIAMELSNGDHLVADALMFAVGRSPNITALGLDEVGVATGPNDGVTVDAENRTSVASIFAVGDVTDRIQLTPVAIREGHA
    LADRFFNNRPADIDYTAVPSAVFSDPPLASVGLSEAAAKAAGIEVDIFSSDFRPMKHALQGSCERAFYKMIVDRASGAVI
    GLHLLGPEAPEILQIAAVAMRAGATKQHFDDTMALHPTMAEELVLLR

    >gi|294146502|ref|YP_003559168.1| nitrogen fixation protein FixI [Sphingobium japonicum UT26S]
    MATKALISDPVAEGAAESLFAVPGIHCVGCIAKIEEGLPRQPGIMSARVNMGAKRVAIRHDPALTPPDLRAAIAALGFEA
    EPLADAGLDVAAAESRRLTRALVVAGFAAMNIMLLSVSVWSGAAGATRGMFHWLSALIALPTVAYAGQPFFRSAWAAVRQ
    GRTNMDVPISIGVLLTTGMSLYETVTGGAHAWFDGAVMLLFFLLAGRSLDSMMRGRARAGVAALLKQTAPGALVLEADGS
    SRWMRADALRPGMTILVAAGERLAADGRVTEGESGLDIAFLTGESAPVRVHPGDDVQAGALNIDGPIRVEVTAAGADTVI
    ADIARLMEEAGQGKSRYVRLADRAARLYAPCVHLLAALSFAGWMIAGAGVHQALLIAVAVLLITCPCALGLAVPAAQIVA
    CGALMRRGVLVKDGSALERLAEVSEAVFDKTGTLTLGRPVPQGLRRLWRDDRSILLSLSRASRHPLSVALRQALEARGVT
    PAALDNVREVAGEGVFGDYEGVAVSLARPRSLINLFGLAAEYRRGDQALLLGFTDALRPDAAETLDVLRGMGMKILIASG
    DRPEALEEIARETRTTAIGHLRPADKLALIDRLKARGEKVLMIGDGLNDGPALAAGHASMAPASASDASQLTADAVFLGD
    RLAPVALTVHAARRTVAVVKQNFALAIGYNVLAVPLAIAGKVTPLVAAVAMSTSSLIVIANALRLKGAVK

    >gi|294146578|ref|YP_003559244.1| peroxiredoxin [Sphingobium japonicum UT26S]
    MAENESLTEQFQALHRERVRSWKPENLAENVARRARLVADFDPSRTVRPGDVVEPFQLAEADGTTLTLERLTAEGPAVLV
    FFRYAG
    CPACNLALPYYERQLWPRLRKAGIPLVAISPHLPETGLGAIRERHGLTYGIANDRGNALARRFGITFDRDLVPD
    GQPSPGWIGELTGTGTAELPQPAVIAIDRDRVARFVDVSPDWLARTEAPAILEAVGRIESAAVG

    >gi|294146699|ref|YP_003559365.1| thioredoxin reductase (NADPH) [Sphingobium japonicum UT26S]
    MTAPLDCLVVGAGPAGLTAAIYLARFHLRIAIVDAGNSRAALIPHTRNHAGYPGGISGRELLALMRRQAAEFGGEVTEGL
    VTGLEKDGDIFLAHVETGAWQARSVLLATGVVNNAPPMSPDIHDAALRQGLLRY
    CPICDGYEATDRRIAVIGTGERGANE
    AMFLRTYSADISLISPQGDHELSADQRIRLEEAGVALVNGPCEPLRIEGERILVPTPNGAEAYDTAYPALGSIIRSELAM
    MLGAEATDDGCLVVDDHQRTSVPGLYAAGDVAKGLDQISHAMGEGGVAATTIRNDLAARISLLR

    >gi|294146859|ref|YP_003559525.1| rhodanese-like protein [Sphingobium japonicum UT26S]
    MTTETLDRTSDRTLTATPQDIRRALLVGSEIALIDVREEHEFAQGHPLFAAQIPLRRIDEEARWRIPRLDTPIIVYDDGE
    GLARKAAVRFEGLGYTDVRELEGGLNAWREAGYELFEDVNSYSKAFGELVEHRRHTPSLAAEEVQALIREKADIAILDAR
    RYDEYNTMSIPTGTSVPGAELVLRARTIAPDPDTTIIVN
    CAGRTRSIIGTQSLVNAGLPNPIFALRNGTIGWTLAGQELE
    TGQTRVAPEVDNRSAEDARAHARDVAYRAGVKRIGWEELEELKADKARTLYLYDVRQPREYESGHLPGFRNAQGGQLVQE
    TDHNAPVRGARIVVTDDIGPRADMTASWLAQLGWEVFVLDVDWSAVTLEKGPDGAPGPRGPEGRYKRPYEGTDNKAAAMQ
    AYLDWEYGLVAQLERDGTHGFFVI

    >gi|294146907|ref|YP_003559573.1| glutathione S-transferase [Sphingobium japonicum UT26S]
    MLKLYYNPGSCSLASHAALEEAGLPYEAELIDLTQNAQFSDAYRQKNPWARVPALQIGDDVLTENIAILNHIAELVPEKA
    LLPTEGLARARALEWLALLSSTVHVAFRPIFRPGRLAETAEGQKDVAATGLNSLKSVLALLDERLGKGPYVLGDTFSLCD
    PYLFVFVFWARRPILEGKLDPLPNLDAFAERMRARPSISAALAQEGLA