Sphaerobacter thermophilus DSM 20745

  • Predicted redox-active catalytic cysteine residues are highlighted in blue.
  • Selenocysteine residues are highlighted in red.


  • >gi|269836071|ref|YP_003318299.1| electron transport protein SCO1/SenC [Sphaerobacter thermophilus DSM 20745]
    MPTRPASRRRIGPTLTLVLFLGLVTLLAACGGSRELTGTDLGQEPAPDFTLTDHRGQTVSLSQLRGKAVALTFIYTHCPD
    ICPLITQHLRQAYEQLPEDAQERVALVAITVDPARDTPEVLQEYSERHGLAENPAWFALTADAATLEPVWASYYVDSGAM
    MADDHAGADAHGGQGEHGDHADHEATPAAGDGQQFTHTDAIFLIDRDGNWRVLLRSGTPPEEIADNLEILAG

    >gi|269836164|ref|YP_003318392.1| protein of unknown function DUF255 [Sphaerobacter thermophilus DSM 20745]
    MANRLQHETSPYLLQHADNPVDWYPWGEEALEAARTQDKPILLSIGYAACHWCHVMERESFENPDIAALMNQHFINIKVD
    REERPDLDTVYMAAAQMMTGQGGWPLTIFLMPDGKPFYAGTYFPPEDRSGMPGFPRVLLAVAEAYRNRRADLERAANDIQ
    GHLTEHFRWSLPETAITPALLNEAASGLARQFDEANGGFGGAPKFPPPMALEFLLRYRLRTGSDTALRIVELTLERMARG
    GIHDQVGGGFHRYAVDATWLVPHFEKMLYDNALLARLYTLTYQATGHPFYAATALDTIEYVLREMTSPDGGFYSTQDADS
    EGEEGKFYVWTPEELEAVLGPEQAPIVARYYGVHPGGNFEGKSILHVPEAPESVAAAFDLTIDELVEIIGPAREKLYAAR
    AQRVWPGRDEKILTDWNGLMLRALAQAAIALGRSDLRDAAVRNATFLHTHLYRDGRLLHSYKDGEAKITGYLADYASLIA
    GLLALYEATFDVRWIAWARDLTDRAIADFWDNEGGAFFDTSADDAPLVARPKDAFDSATPSGNSLMAESLLRLGLLLGED
    DYRQRAMTVLERFAALAAKAPTGFGQLLCAADLALAEAHEIALVGDPQVPAMAEMLAVVQQPYLPHQVVALRHPDQDGED
    EVIPLLAGRTARDGQPTAYVCRNYACRQPVTTAHDLAAELGMAVE

    >gi|269836181|ref|YP_003318409.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
    MSKPVTVSDATFDQEVLKSDVPVLVDFWAVWCGPCRMVAPILDEIAEEKAGSLKVAKVNVDENARVAAQLGITSIPTLIL
    YKDGQPVERIIGAHPKQRLLQQIEKHLS

    >gi|269836384|ref|YP_003318612.1| DSBA oxidoreductase [Sphaerobacter thermophilus DSM 20745]
    MRVEIWSDIVCPWCYIGKRRFERALAGFPHADEVEVVWRSFQLNPDHPKGARVPLEESLAAKMGATVEQVRAMNARVKAI
    AAEEGLEYDFDRYNVVNTFDAHRLTHLAKAYDLNAELHERFLRAQLVEGEVLDDPDTLVRLAAEVGVPEAEARRVLESDD
    FAAEVEADSAELRALGGNGVPFFVIDRRFGISGAQPTEVFERALAMAHEAATQESSSSR

    >gi|269836389|ref|YP_003318617.1| OsmC family protein [Sphaerobacter thermophilus DSM 20745]
    MAKITPRYSTTVTVTGGREGHAVSDDGVLDVQLRRPKTDGPNEGTNPEQLFAAAWGACFQGALMAVGRQSDVDVSGSTVK
    VEVALGADPEGGFGLAAKIMVEIPGVDREKAQELVNAAHAA
    CPYSKATRGNIDVEVLVV

    >gi|269836650|ref|YP_003318878.1| Rhodanese domain protein [Sphaerobacter thermophilus DSM 20745]
    MSFSIDRSRVLVSTAWLAGNLDNPTVRIIDCRYYFEGPSGREVYAESHIPGAVYLDWVADLSDPNHPVDYMMPPAEQVAA
    VMSRLGVGDDTLIVAYDDEGGHYASRLWLILARYGKEGQMRILDGGWTRWVMEERPVTMEPTPLPAPATFTIDPAAERPN
    IIATLEDVMQARESGSAVILDVRRLSEYTGEEVRAKYGGRIPGALHMFWQENLNWDGDRTFIPVDRIRARHEAAGVTPDT
    PVITY
    CQGAVRAAHAALSLWMSGYRNVRVYDGSWAEWGNRDDVPIATGPADEA

    >gi|269836703|ref|YP_003318931.1| beta-lactamase domain protein [Sphaerobacter thermophilus DSM 20745]
    MILRHIYNPELAQASYLVGCAATGDALLVDPDRNVDQYIELAEREGLRITAITETHIHADFVSGARELARRTGARLYLSD
    EGPAEWKYAYADELGAILVRDGDSFMVGNVRIDVVHTPGHTPEHISFLVTDTANADKPMGIFTGDFVFVGDIGRPDLLEE
    AAGIRGTKEPGARQLFRSLQRFKELPDYVQIWPAHGAGSACGKALGAVPQSTVGYERLFNWAFQITDEDEFVKAVLSGQP
    EPPKYFAEMKRVNKIGPALVSELPPIRTLTGHEVPALLDTGAVVVDTRRADDYAQGFIPGTLNIPLDNAFTTWAGWLIGY
    DVDIVLLVDNACPD
    CAGRAVRSLRSIGLDRVAGIATVQEALAAWTASGRALESYQGLTPADLDGMLQGGRATVLDIRGKV
    EWESGHIPGSRHIPLGYLMDRLDQIPRETPVVLY
    CQGGARSAIGVSLLRAAGAKDVTHLDRGINAWAAEGRPVERSAGLV
    GAA

    >gi|269836704|ref|YP_003318932.1| Rhodanese domain protein [Sphaerobacter thermophilus DSM 20745]
    MLDVATLPTTIDVETASRLLAENSRVRLLDVRTPAEFESVHIPGSYNVPLDRLSEYRNELRSALADPVILVCRSGMRARQ
    AEQLLSEAGLSHIHILDGGLNAWERAGKPVTRGKRQKWSIERQVRGVAGTLVFVGAVGGLTLWSPLTLLAAAVGGALAFS
    AVTDTCGLAILLSKLPYNQGATCDIRDVIARLDAEQAS

    >gi|269836763|ref|YP_003318991.1| Rhodanese domain protein [Sphaerobacter thermophilus DSM 20745]
    MAKKTAAEMVAEAKSRIRNLSPDEVAAELKRGNVVLVDLREPEEREENGAIPGSVSAPRGMLEFYADPTTSYHREEFDPE
    QDIILY
    CSAGGRSALAADTLQQMGYRRVAHLEGGFTAWRDQGLPVEP

    >gi|269836798|ref|YP_003319026.1| iron-sulfur cluster assembly accessory protein [Sphaerobacter thermophilus DSM 20745]
    MITITPEAVERLKEYLVDEGFEDAMLRVFVAPGGCSGLQYGMSVEEVAEEDDQIIEQDGIKLLVDQFSAMYLEGAEIDYV
    NSLMGGGFTVRNPNAVATCACGHSFDTGDNAGTVQGCGCGA

    >gi|269836832|ref|YP_003319060.1| UBA/THIF-type NAD/FAD binding protein [Sphaerobacter thermophilus DSM 20745]
    MIETRTTPARYQRQAIFAPIGPEGQQRIQRARVCVIGVGALGTHVADTLARAGVGFLRIVDRDVPELTNLQRQILFDESD
    LDAGLPKAIAAARRLSAINSEIEIDARAIDVNQTNIESLITDVDFVIDGTDNFEIRYLLNDACVKLGKPWIYGGVIGSYG
    MSMTILPGETPCLRCVFPDPPPPGEAPT
    CDTAGVIGPAVAAVAAIESAEALKLATGARENLNRTLLSLDIWDLSFDRIPL
    GAPNPECPCCGRRQFEFLNREAPSHTTQLCGRDAVQVLVHPPARITLASLAERLKPVGEVGYNAYLLRFRTDGYDLTVFP
    DGRAIIKGTTDPVEARSVYARYIGM

    >gi|269836869|ref|YP_003319097.1| selenide, water dikinase [Sphaerobacter thermophilus DSM 20745]
    MQSRDEIRLTTLASCAGCASKMGPEALAQVLRPLTQLSDPNLIVGLQTSDDAAVYRLSDDLALIQTVDFFTPVVDDPYVY
    GAIAAANSMSDVYAMGGTPLFALNIAGFPDNLPLDVLQRIFQGGADKAAEAGVVIAGGHTVTDNEPKYGLVVTGTIHPDR
    VVTKAGARPGDVLYLTKPLGTGVITTALKAGAADPADVEAAVASMLKLNRTAAALMQEVGVNACTDITGFGMIGHATEVA
    QKSGVRLVLSAGQMPWLPGAERYAAEGRLPGGARRNQAFYGDGPESILEVTPGIPQTTLDLLFDPETSGGLLIAVPSDRA
    QALEQAFAAAGEPLWRVGSVEEGQGLVLQP

    >gi|269837108|ref|YP_003319336.1| Rhodanese domain protein [Sphaerobacter thermophilus DSM 20745]
    MVMVTGKRPVVPEIDPQQAWERASRGDAVIVDVREPDEVAEVAVPGALVIPLGKLDEEVETIPSDREVLFLCRSGNRSAY
    ATDFYRQRGHERTANITGGIIAWTKANLPTTRGR

    >gi|269837447|ref|YP_003319675.1| Redoxin domain protein [Sphaerobacter thermophilus DSM 20745]
    MERVSQDSLRNRIIPTLVVLIVVALLGLFAYAMWFSGDSTSLASGGRINTVGRLIRFENRTAPSFSLQTLDGQQISLEHF
    RGKTVVLNFWGSW
    CPPCEDEAPVLRDFAATLDENTVIVGIDIWDQPEAAQAFLEKHDLTYPNAVDDNGRTTIDYGVSGVP
    ETFFIGPDGALLGKYNGPVKSVEQLHGFIQELTGAG

    >gi|269837494|ref|YP_003319722.1| thioredoxin [Sphaerobacter thermophilus DSM 20745]
    MPAVIDPNVCDRNFAGCFPARRCPEQAFFVDTATEQVMIDSTLCGTCPGPCVNFCDRYAIRYTPDPDEFEVLKARTLGEM
    TEAEAAEALARRKEERAAAKAAEEAAKKAVIEATTATFDDQVLKADLPVVVDFWAPW
    CGPCKMMAPVFERLAEQYRGLVR
    FVKVNVDQEPSLAMRYRVQGIPTLAFFWQGKLVNIHVGALPESALQTAVYQFLSAVRAQQQQQQEQPASTAETVQEG

    >gi|269837549|ref|YP_003319777.1| Rhodanese domain protein [Sphaerobacter thermophilus DSM 20745]
    MSQSSVPPAVSEEIAARGYANPDVLVTTEWVAQHLNDPSIRIVESDEDVLLYDIGHIPGAVKIDWHQDLQDPVVRDFIGP
    EAFAALMSRLGIGDDTTVVFYGDKNNWWAAYAYWFFKYMGHDHLKIMDGGRKKWEAEGRPLTREVPSYPPAKWTPRAIRE
    ELRAFRDDVLKHIGYEGRRKVGPSLPLVDVRSPAEYSGELLHMADYPQEGAQRGGHIPGAKNIPWARAVNEDGTFKTGDE
    LRELYRNEGITPDKDIVVY
    CRIGERSAHSWFVLHELLGYPKVRNYDGSWTEWGNVVGVPIEK

    >gi|269837563|ref|YP_003319791.1| alkylhydroperoxidase like protein, AhpD family [Sphaerobacter thermophilus DSM 20745]
    MTTRLDEFRAYRERMNARIAEIDHLGIKRFFSLDSGAYRDGALDGRTKELLGLVASTVLRCNDCIDYHLDQCVKAGWSDE
    EIYDALNVALVVGGSIVIPHLRHAVETLDLLRAEQ

    >gi|269837841|ref|YP_003320069.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphaerobacter thermophilus DSM 20745]
    MADYSAFRGTVRAPEFPPGEWFNTTRPLEISDLRGKIVILDFWTYCCINCLHMLPQLRELERRFPDELVVIGVHSPKFPA
    ERRSESLRAAIQRYHVHHPVVNDANLEVWTRYAVRAWPTLMFVDPEGRVIGRHEGEASAEDLARVVRELVDQYDAQGLID
    RSPIPGLQPMAPPEGTLAFPGKVLADAATDRLIVADSGHHRLIVARLDGSDAWVIGSGEAGLRDGPGAIAAFHDPQGLAL
    YGDTLYVADTRNHVVRRVDLAARTVETIAGTGHIGWSYARAGAARAIDLRSPWDLVLHDGVLYIAMAGMHQIWALDLDEA
    ELRPYAGSGRESIRDHTLQRAWLAQPSGLATDGRLLYVADSETSAVRTVTFPPGDEVRTLVGTGLFDFGDVDGIGDEVRL
    QHPLAVACGDGVLYVADSYNHKIKRLDPATRRCETWLGSGEPGDADGTGTAARFHEPGGLSLAGSRLYIADTNNHAIRVA
    DTTTGAVTTLPLTV

    >gi|269837843|ref|YP_003320071.1| copper-translocating P-type ATPase [Sphaerobacter thermophilus DSM 20745]
    MTTTTTPRRAAQARATLLVSGMTCASCVRRVERALERLPGVTDAQVNLATERATVTYDPATVSVADLVQRVEQAGYTATV
    EATDDETAAHDTAAVDLAITGMT
    CASCVRRVERALTRLDGVEAATVNLATERASVTYDPERVSLDQILRAVQAAGYGADV
    VAEPEEISDAADEDAARRRREIARLRRDVIGAAILTVPTVILNMFFMSLMNVEYVLLALTLPVWAYFGWRFHRAALKNLR
    HGQFTMDTLVSLGTTAAFGYSLVGTLVLGRMDQIYYDTAAVIITLILLGRYFEARAKGQTSSAIKKLLGLQPRTARVIRG
    GEAIDIPISQVRAGDLVVVRPGEKIPVDGRIIEGRSAVDESMLTGESLPVEKGPGDEVIGATLNTSGSFTFRATKVGRDT
    ALAQIIRLVQQAQGSKAPIQGLADRVASVFVQAVLVVAAVTFAAWMLLGGDLTHALLATVAVLVIACPCAMGLATPTAIM
    VGTGRGAEHGVLIKGGDVLERARELTTVVLDKTGTITRGKPAVTDVVPAPGFNSVADPAAELVRLAAAVEQRSEHPLGAA
    IVQHAREAGIDLGAPVADITAVPGHGITGTVEGRPILVGTRKLLRDHGIAPDSLEADAARLEADGKTSMLVAVDGRPAGV
    IAVADTVKPGSAEAIAALKRMGLDVAMITGDNRRTAEAIARQVGIDRVLAEVLPGHKADEVRRLQEQGHRVAMVGDGIND
    APALAQADVGIAIGSGTDVAIEASDVTLVGSDLRGVVTAIALSRRTVRTIKWNLFWAFIYNTIGIPIAALGLLNPMFAAA
    AMAFSSVFVVTNSLRLRRFTPPTATG

    >gi|269837991|ref|YP_003320219.1| glutaredoxin-like domain protein [Sphaerobacter thermophilus DSM 20745]
    MAIIPQQDQEYLKELFAEKLEHPVTLRFYTQRQSVLSVPGQECGTCSDTHALLNELVALSDKLTLEVRDFVTEQEQAKAE
    GIEEIPAIVLEGQNKGTVRFIGVPAGYEFATLIEDLIDVSRGTTSLQPYSREVLAALQNPVHIKVFVTPT
    CPYCPSAARL
    AHMMAIESDKVTADVIEVSEYPLMAQRYRIYGVPKTVINESIELEGARPEEAMVGAVEAASRSAAS

    >gi|269838059|ref|YP_003320287.1| DSBA oxidoreductase [Sphaerobacter thermophilus DSM 20745]
    MSRQSEREARRSRRAERRLAAERAARRRRQMSIFGGLVAVALIAAVVLILLNRPQGSEDVSDIAVAPPPDASIPTNGRVM
    GQEGAPVHVVEWGDYQ
    CPGCGYFTRAVKPQLIQEYVATGKITFEYRDFAFLGAESTRAAEAAFCAEDQGKFWQYHDTVFL
    NQRGENQGAFSEARLKEMARQVGLDMEAFNECYDNRTHKQDVEAMYNEAKEAGVTGTPSIMINGQLLQGWNGRWETLKAA
    IDQALGQ

    >gi|269838062|ref|YP_003320290.1| Methyltransferase type 11 [Sphaerobacter thermophilus DSM 20745]
    MPEPSRPALDEIRLVVRDRYGAAARAVETGAATGGGCCGGAQVSPLVVTAYDPDALRDLPQEAVLAALGCGNPTALAALK
    PGEIVLDLGSGGGIDVLLSARRVGPTGFAYGLDMTDEMLELAERNRQQAGIENARFLKGHIEEIPLPDASVDVIISNCVI
    NLSGDKDRVLREAWRVLRPSGRFAVADIVVRGRLLPPVRQSLSAWSA
    CVGGALSEEEYREKLAAAGFIDISVEATRELTL
    DELMGDCCGGGGADLQALTTLQAEHGTLISAFIRARKP

    >gi|269838125|ref|YP_003320353.1| glutaredoxin [Sphaerobacter thermophilus DSM 20745]
    MHTVVIFSQPGCRACHQEMEYLSRRGISYTVRDITEDPDALRELLELGSYLTPTTLIDGEHVVIGFDQARLSRLLGLT

    >gi|269838154|ref|YP_003320382.1| beta-lactamase domain protein [Sphaerobacter thermophilus DSM 20745]
    MTVILEQILRRDIGCAAYLVGSEAAGEAAVVDPRIDMVDEIVALAERDGLRIRYIVETHNHADHVSGHHQLAARTGATIA
    VHEDAGVAYPHLALRDGDELALGEVRLRVIHTPGHRPEHIVLAVIDTSRGDEPWAVLTGDSLFIGDVARPDLAIDGREGA
    DALFDSLHQRLLQLPEGTLVYPGHVSGSLCGRVSNRMTGTTIGFERRFNPALTIDARPAFVEYMNESLPERPPNMARIVE
    LNRSAEPLELRDPAPLDAEAVRRLLDQGARVLDVRSTADFGQEHIPGAIGVPLDGSQFQNRVGLVVPTDVPLVLVADDEA
    MARRAATMLSVIGLTTIAGYLAGGIAAWRAAGEPLDQIPSMTVQELGAALGRDGAAPQVVDVREAGEWHSGHIPNAVHIP
    FYRVDERAGEIDPARPVAVI
    CGSGQRSMLAASLLKARGIEDVHNVEGGMTAWHAAGLPTTTD

    >gi|269838193|ref|YP_003320421.1| methylated-DNA/protein-cysteinemethyltransferase [Sphaerobacter thermophilus DSM 20745]
    MQELSCKDVVDRIPALVAGDLGAEAVAAIDRHTATCAACAREVAQGRALAGLLDQMAERSAVAPPGGSLLDTLPIVAYDR
    IDSPVGPLLVAVSPRGLCRVDYGGTEAEIVAWAESQRLVSRHDPDAVRPYATQLQEYFAGARQHFDLQVDLAAVSPFTRR
    VLEATAQVPFGRLVTYRDIARIIGQPGATRAVGNALGSNPVPIVVP
    CHRVVRSDGTIGGYTGGLAIKWHLLAIEGVTLPT
    V

    >gi|269838273|ref|YP_003320501.1| methionine-R-sulfoxide reductase [Sphaerobacter thermophilus DSM 20745]
    MSHRDNSPHKVPNGYCGLEGTGVACPAPAITGGEDDGLKPLASTEEEWRQRLTPEEYAVLREAGTEWPFTGEYTYTDDEG
    IYRCRACGNPLFDSETKYDAGCGWPSFTQVISPTAVTLHEDLSFGMHRIEVRCARCDSHLGHVFDDGPIEAGGQRW
    CINS
    LSLELERR

    >gi|269838283|ref|YP_003320511.1| peptide methionine sulfoxide reductase [Sphaerobacter thermophilus DSM 20745]
    MWFHRTPSTLIAPEEALPGRDRPAFAIPSHHAVLGTPIQPPFPEGLETAVFALGCFWGAERLFWRIDGVYTTAVGYTGGF
    TPHPTYEEVCTGRTGHAEAVLVVFDPAKVSYESLVRTFFEEHDPTQGMRQGNDIGTQYRSAIFYADDRQRRIAEGMRAAY
    QVALRQAGYHEEITTEIAPLGPFYYAEEYHQQYLHKVPCGC

    >gi|269838297|ref|YP_003320525.1| heavy metal translocating P-type ATPase [Sphaerobacter thermophilus DSM 20745]
    MREQTIPVEIDGNGAHCADLLLDTLMQHKGIDAIELDADRRALRIRYDPDVISLATVERLADRIGVQIGERYQRCVFAMN
    GVS
    CRGCGSVIERRLHGRNDIIWTSANPASRRLAVEYAGTRERLSEITRTIEDAGVRVRGQVAPPAPTRQKEEDEESWWD
    RYHLVVATVATLIFLASGWLLGRLGLISHEVQIGFYVLTYIAGGFYATRQAISSLLQRHVDIDLLMVTAAIGAATIGGWV
    EGGILLFLFSLGNTLEHYALGRTHRAIRALMELSPEDALVVRDGQEQRIPVDELVIGDTVIVKPSERIPADGKVISGESA
    VDQSPITGESIPVGKGPGDQVFAGTINGHGLLRVRVERLAQESTLAKIIRIVEEARSQKSRTQRFTDAFEGIYAIGVIVA
    SALAVIIPVVFLGRDFHDMFYRAMTLLVVASPCALVISTPASILSALANGARQGILFKGAVHLENVGAVDTVAFDKTGTL
    TIGRPRVTDVITCEGVDEREMLMLAAAVERLSEHPLGLAVVQYAEELDIPSLDDQEITGLQSVPGRGVRAVVRGQTLRIG
    NEALLESEGVTLPDDLRRQGDALREQGKTLMFIASDRALGVIAVADVIRPVVPAVIEDLHRLGVKRTIILTGDNERAARA
    IARQVGIDEWRAGLLPEEKLTVIREMQRNGEMVVMVGDGVNDAPALATADIGIAMGNAGTDVALETSDIVLMADDLTKLP
    YAIELSRRARRVIRQNLTFALTVIVVLVIATLMGRVPLPLGVVGHEGSTIIVVLNGLRLLRFRKPALHAPAVRTAPVPAD


    >gi|269838314|ref|YP_003320542.1| Peroxiredoxin [Sphaerobacter thermophilus DSM 20745]
    MTVPDTAATTPSLPRLNEPAPDFEAVTTHGPIRLSDLTNAGKWVLFFSHPADFTPVCTTEFVAFSELAPEFEKRNTQLLG
    LSVGSIPSHLAWMQDIERNLGVKVPFPVIADLDMRVSQLYGMIHPGVSSTAAVRAVFLIDPKRTLRAMVYYPLTTGRWMP
    EFLRVLDALQTTDAHGVSTPANWTPGNEVVVPAPATVQAIAAEEARKNDYDYKSWYLRLKKLE

    >gi|269838410|ref|YP_003320638.1| periplasmic binding protein [Sphaerobacter thermophilus DSM 20745]
    MRIVSLLPSTTEICFALGLGDQLVAVTHECDYPPAAQKRPQITRNVLPPDIDDGAEIDRLIRERVLRGESIYELDVELLE
    RLEPDLILTQELCAV
    CAVSYEDVQAIAQRLPNPPRVVSIEPRTVEEVLDSILTVGSLTRRTVTAKAVVAALRSRIAYIGG
    RVDSGQAPRRVVCLEWLDPPMVGGHWVPEMVALAGGQDVLGRAGQPSFAVTWEQIRDAEPEVLVLMPCGYDLQGTIAEAE
    RVSRTAGVLPSFLDDIPAVHDGQVYAVDGSGYFNRPGPRIVGGIEILAGILHPERFARGGPPGTVQQIRLGAAEPVR

    >gi|269838436|ref|YP_003320664.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphaerobacter thermophilus DSM 20745]
    MTTTDTKRHAIPGRGDQIDYFTATGSDGETIRTRDYYMRRNLALVFSHGPDCAACRDLLRGLARQYAAARAEDGQVIAVV
    AGEPAAAEALRHDLDLPFPVVADADLAVHARFGLVEDGAPLAAIFVTDRYGTIYDASVADATHQMMAPEEVPGWLEFVAC
    EC

    >gi|269928401|ref|YP_003320722.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphaerobacter thermophilus DSM 20745]
    MIRPEHPTTAPDFTLRDTHGRDIRLSEVLQRGPVVLVFLRGLLCPHCRRQLAQLRDNYQQFQERGAEILAIAPDRPDAVR
    TYWEREHIPFPGLTDPGHAVARRYGQQVRLLRFGRMPAVLIVEPAGVIRFRHDGRSMRDIPTVDDLLTHLDQLSD

    >gi|269928476|ref|YP_003320797.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphaerobacter thermophilus DSM 20745]
    MHADSNANRGSHIPDSTASDTASPARSATGLSSVPLMSLAVVVLLITGFLVYTFAFAGNSGGVVEPGKKAPNFELPGLNG
    ETVRLSDYRGQVVLVNFWATW
    CKPCQIEMPEFQAVYEKYRDNGFTILGVNQAEPPELVRPYVEEGGYSWTFALDEKGKIS
    ERYAVYGIPQSYLIDRDGKVVYMWLGIATQDSLESQLAKLGIGA

    >gi|269928686|ref|YP_003321007.1| methylated-DNA/protein-cysteinemethyltransferase [Sphaerobacter thermophilus DSM 20745]
    MLELEITQMPGLVLQVGEVETQFGSVWVAAGPRGLRVVTVPGRSREECLREALRNGRDATVIEGGPLAEQARKELTAYFE
    GRLQRFTVPLDPVGTNFQRRVWAAVAAIPYGETATYRQIAERIGQPRAVRAVGAANGANPLAIIIP
    CHRVVGSDGSLTGY
    GGGLAVKRALLDLEARCRGALP

    >gi|269928887|ref|YP_003321208.1| heavy metal translocating P-type ATPase [Sphaerobacter thermophilus DSM 20745]
    MTQTIHLAISGRTPIHCAGCEQRIGNALRRLPGVASVQASQETQQVRVAFDPEQVSVEQIRARLARAGFETAPAGGGCMS
    ARAPARPGGRGHVERGTPGAAQQKLLLSVGGMH
    CSLCTESIRRAIGRLDGVQSVQVSIAHEEALVEYDPARVTPEIITEA
    LEDIGYTVREPDQAERFAEEERDLAVARRKAVLSIGLLVAASAVMLTTVWLGPSLERTLAMGALALFTAGGPARFIIVRN
    GWQSIRRGILNQDVLVTASALGGLLGGLVGLVVPAVPAGGFFGATVFVLAFHLIGGYASVLVHVRASQSVRRLLALTPET
    AHRLTADGREEVVPVAQLAVGDRVRVRPGERIPADGVVLDGASAVDESLVTGEPIPVDKLPGSEVIGGSLNQAGSLIIRV
    SRVGAESFLQTVARQVAEARALKPGILRLVDQVLVVYVPAVFAASAAGLLIWTVGAWLLAGAPDLLRGGFAALSVLIMGY
    PCALGMSTPLAIIRASGEAAERGILMRSGEAFHVFRSVRTIVFDKTGTLTEGKPQLVACLSPLAATDRLLHLAASAETLS
    EHPLARAIVAEAHARGLTLETPTEFAAWPGRGVAATVAGHRLLVGTERFLAEENVNLAPLASLVEQVHARGQTAVLVAVD
    GRAAGVLALADRAKPDARATVERLRRLGMKPVLLTGDNWHAARAVAAAAGIDEVLAEVLPGDKAAEIRRLQAQGQRVAMV
    GDGINDAPALMQADVGIAIGAGTDVTLEAADVVLVSERLETLVEARELARRSYQLTVTNVGLALAFNGIGVIAAITGLVA
    PVWAMVAMAASVSVVLGNSFAGRLGHGRAREWRGE

    >gi|269928913|ref|YP_003321234.1| heavy metal translocating P-type ATPase [Sphaerobacter thermophilus DSM 20745]
    MIVTQRLDLSQLLPPEPAACDQCLDRVYTVLQSTKGIDGVHVAGQRGRVILHYDPDLIPLATIEALARREGQRLNARYVH
    EVVPIEGMD
    CADCARTLERGISRLPGVEWVSINFAGARMAVEYDANRVGREAIAKRVSDLGYRVGVTSGDPAAARPERPS
    WLAKEHLPLAVGAVATITGAALALLGAPSLASTLLYALAALVAGLPIARKAVATARATHRLDINALMTIAVIGAAFIGEW
    LEAATVVVLFSLGEALEGYTMDRARRSIRSLMRLTPAEAVVRRDGVEQRVRVDEIAPGEVVIVRPGERVPVDGVVLAGES
    TVDQAPITGESVPVGKAPGDDLFAGTINGAGVLDVRVTRRAGDSTIARIIRMVEDAQAQRAPTQRFIDVFASYYTPAVVA
    LAAALAVVPPVLFDGGWSEWLYRALVLLVVACPCALVISTPVTIVSAIAAAARRGVLIKGGAYLEAAGSLRALAFDKTGT
    LTVGQPEVTAVIPLDGADEADLLRVAAAAERYSEHPLGAAIRRAAVARGIETDGLAVHDVTAHTARGIEARVDGTTVRVG
    SRDLVLGGEVPPEVEERLASLEEAGQTAVLVGVDGRLAGIIALADAPRPEAPAAIRAIKDAGIRETIMLTGDRQAVADGI
    ARQLGVDGVEAELLPDQKVRAVENLLSRYGAVGMVGDGINDAPALARATVGIAMGAAGTDAALETADIALMGDDLGKIAD
    TMRLSRAAKRVILQNITLALAIKAVFLVLAVGGVATLWEAVFADVGASLLVIANGMRLLRR

    >gi|269929070|ref|YP_003321391.1| peroxiredoxin, OsmC subfamily [Sphaerobacter thermophilus DSM 20745]
    MAAERRAEVVWQGNLFQGSGTVSLGSGVISQQPVTWAARTEQPDGKTSPEELIAGAHAACYAMALSNTLAEHGHTPEQLE
    VTAVCTFDPPKITTVELTVRGRVPGLDDATFKQIAQEGEQN
    CPVSNALRNNVEIRLNAELA

    >gi|269929096|ref|YP_003321417.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphaerobacter thermophilus DSM 20745]
    MRPCPARARVRGSGLVRRARGAAAGKERGMPLETGARAPEFTLKDAAEGREHSLAEALKAGPVLISIYKSSCQASKTIFP
    FLERIYQQYPKDRLTVWGIAQDSPNVTRSFARRYGVTFPLLVDQDDYATSRAYDIMATPSVFLINQQGEIVWQGMGFQKP
    AMDDLSAEVAKLLGVEPVDITSGTDDVPPWVPG

    >gi|269929216|ref|YP_003321537.1| Heavy metal transport/detoxification protein [Sphaerobacter thermophilus DSM 20745]
    MVERVYRVPDVSCAHCVNAITQALSRIPGVEAVQVDLDTKLVKVQAGESVSDADIRAGIEEAGYDIAA

    >gi|269929301|ref|YP_003321622.1| Heavy metal transport/detoxification protein [Sphaerobacter thermophilus DSM 20745]
    MNATKKTLLRSQELNCPSCVAKIEKALTALDGVEKAKVHFTTGRIEVHHDPTRVSGDDLVKAIRATGYEAKVTAF

    >gi|269929378|ref|YP_003321699.1| dihydrolipoamide dehydrogenase [Sphaerobacter thermophilus DSM 20745]
    MPGESYDVVLLGGGTGGYAAAFRGAQLGLKVAVVEKDKVGGTCLHRGCIPTKALLKSGSVARLMRDGAQYGVTATGIEID
    YSKAIERSGRIVEQNYKGLQFLFRKHKIDIYEGVGRLKDNRTVIVTKADGSTEEVKGNAIIIDTGSRPRAIPGIEFDGKR
    VINSDHSTWSPDLPKRVIIRGGGATGVEFATIYRDFGCEVTLVGRVVPNEDREVSQQLTRSFTKAGIKIIPDYRPTAEDF
    NITEGGVELRVKRDGKEERIEADTLLVAIGRQGNIEDIGLEELGIKTKDSYIVTDDFGFTGVDGVYAIGDVIGKQLLAHT
    AMHQGIIVMELLAGKKPMPLDLKKVPSVTFCHPEIGSVGLTEEEAKAEGRTIKVGKFPLRANGKALIEDEVDGFAKVIAD
    AETDEILGVHLIGGHATELIGEAALASLLEATPWEIGLSVHPHPTISEVLGEAALAVDGMAIHI

    >gi|269929417|ref|YP_003321738.1| alkyl hydroperoxide reductase/ Thiol specific antioxidant/ Mal allergen [Sphaerobacter thermophilus DSM 20745]
    MTVTVGQTAPDFTVITTDRKQVRLSELVQDRPAVLAYYYFAFSSGCVNEMSSLQDRIDEFRRSGVEVYGLSVDTHFAAAA
    WAKELGLTFPMLSDFNREGMTALGITLDEFIGYRNISHRAIIIVDRDRVVRYVDVAPIRGMPDPDAALNAARALAHG

    >gi|269836274|ref|YP_003318502.1| electron transport protein SCO1/SenC [Sphaerobacter thermophilus DSM 20745]
    MRRWIILTVAALVLVGGATAGAFAAGWLPFGGGSLHGSAIDPPLPIVDAPLIGADGSEVRLADFRGKVVVLYFGYTYCPD
    VCPTTLANVARALKELGKRAEDVQVVMITVDPDRDTPEITQEYVSRFDPSFVGLGGDVERIREVATGMGVYFEKQERGSA
    GGYLVDHTATVLVLDRNGDLRLMLPYGLTGEQIANDLRWALKQ

    >gi|269836275|ref|YP_003318503.1| electron transport protein SCO1/SenC [Sphaerobacter thermophilus DSM 20745]
    MALRAGTQWLARGRGRLMKRTTILYGSILAVTVVIVALASLRPIRVLPRIAPAPGFALTDQDGNRLTSDDLRGSIVLFDF
    TYLSCQEP
    CNRTTATMREVQEQLAAEPEDDPPVRLVTISFDPERDSVEALKAAAEAAGADPTRWTFATGDPDLMKLIVGR
    GFNVFYEQKPDGSFRFDPTLVLVDGWGVVRAEYRVGPPRAEHIVNDIRIVANEARKSRGPARLAYEATHLFVCRTR